The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ILICAPKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLSF
KFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESF
QLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA
Sequence Info Allergen Name Length Opt Bits Score E Value
U6C8D6 Ory c 4.0101 172 1174 274.7 1e-75
AAS77253 Fel d 4 186 649 154.9 1.2e-39
XP_855342 Can f 6.0101 190 604 144.7 1.5e-36
P02761 Rat n 1 181 586 140.6 2.4e-35
Q95182 Equ c 1 187 586 140.6 2.5e-35
P02762 Mus m 1 180 551 132.6 6e-33
AAA39768 Mus m 1.0102 180 539 129.9 4e-32
S0BDX9 Cav p 6.0101 181 510 123.3 4e-30
O18874 Can f 2 180 282 71.3 1.7e-14
A59225 Bos d 2.0102 156 258 65.9 6.3e-13
Q9QXU1 Mes a 1.0101 172 255 65.2 1.2e-12
Q28133 Bos d 2.0101 172 254 64.9 1.4e-12
CAX62130 Cav p 3.0101 170 248 63.6 3.5e-12
B59225 Bos d 2.0103 156 244 62.7 5.7e-12
S5ZYD3 Phod s 1.0101 151 217 56.6 3.9e-10
O18873 Can f 1 174 154 42.1 1e-05
ADK56160 Fel d 7.0101 180 147 40.5 3.2e-05
P02754 Bos d 5 178 133 37.3 0.00029
AAA30411 Bos d 5 151 125 35.6 0.0008
CAA32835 Bos d 5 178 118 33.9 0.0031
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 274.7 bits 1174,  Expect = 1e-75
 Identities = 172/172 100%, Positives = 172/172 100%, Gaps = 0/172 0%
Query  1    ILICAPKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLSF 60
            ILICAPKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLSF
Sbjct  1    ILICAPKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLSF 60
Query  61   KFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESF 120
            KFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESF
Sbjct  61   KFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESF 120
Query  121  QLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA 172
            QLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA
Sbjct  121  QLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA 172

Sequence Alignment: 2. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 154.9 bits 649,  Expect = 1e-39
 Identities = 104/169 61%, Positives = 130/169 76%, Gaps = 4/169 2%
Query  1    ILICAPKRGDA-HSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLS 59
            IL+CA +  +   S+ ++S+ISGEWYS+LLASD +EKIEENGSMRVFVE+I    NSSLS
Sbjct  11   ILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEHIKALDNSSLS 70
Query  60   FKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGES 119
            F FHT  NGKCTE+FL  D T+D  VYTV YDG+NVFSI++ V D+YI++HL+N +    
Sbjct  71   FVFHTKENGKCTEIFLVADKTKDG-VYTVVYDGYNVFSIVETVYDEYILLHLLNFDKTRP 129
Query  120  FQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA 172
            FQL+E+Y R  DV   ++EKFV+ CQE GIV  NILDLT+VDRCL AR    A
Sbjct  130  FQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQARGSEVA 180

Sequence Alignment: 3. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 144.7 bits 604,  Expect = 2e-36
 Identities = 94/157 59%, Positives = 117/157 74%, Gaps = 0/157 0%
Query  16   EVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTELFL 75
            ++S+ISG+WYS+LLASD +EKIEENGSMRVFV+ I V  NSSL F  HT VNGKCT++ L
Sbjct  28   DISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKCTKISL 87
Query  76   TCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRSD 135
             C+ TE +  Y V +DG+N+F I++   +DYIIFHL N N  + FQLMELYGR  DV   
Sbjct  88   ICNKTEKDGEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPK 147
Query  136  IREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA 172
            ++EKFV+ CQ   I +ENILDLT+VDRCL AR   AA
Sbjct  148  VKEKFVRYCQGMEIPKENILDLTQVDRCLQARQSEAA 184

Sequence Alignment: 4. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 140.6 bits 586,  Expect = 2e-35
 Identities = 88/165 53%, Positives = 120/165 72%, Gaps = 3/165 1%
Query  2    LIC--APKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLS 59
            L+C  A +      + +V++++G+W+S+++AS+ REKIEENGSMRVF+++I V +NS L 
Sbjct  14   LVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHIDVLENS-LG 72
Query  60   FKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGES 119
            FKF    NG+C EL+L    T ++  Y VEYDG N F+IL    D Y++FHLIN  NGE+
Sbjct  73   FKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGET 132
Query  120  FQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYAR 167
            FQLM LYGR  D+ SDI+EKF +LC+  GI  +NI+DLTK DRCL AR
Sbjct  133  FQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQAR 180

Sequence Alignment: 5. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 140.6 bits 586,  Expect = 3e-35
 Identities = 89/172 51%, Positives = 129/172 75%, Gaps = 3/172 1%
Query  1    ILICAPKRGD---AHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSS 57
            IL+CA +  +   A  + ++S+ISGEWYS++LASD +EKIEENGSMRVFV+ I    NSS
Sbjct  11   ILVCAQQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSS 70
Query  58   LSFKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNG 117
            L  +++T VNG+CTE+ +  D TE++ VY++ YDG+NVF I +   D++II++L+N +  
Sbjct  71   LYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKD 130
Query  118  ESFQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA 172
              FQL E+Y R  DV  +I+E+FV++ Q+RGIV+ENI+DLTK+DRC+  R  G A
Sbjct  131  RPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVA 185

Sequence Alignment: 6. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 132.6 bits 551,  Expect = 6e-33
 Identities = 83/166 50%, Positives = 119/166 71%, Gaps = 3/166 1%
Query  2    LIC--APKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLS 59
            L+C  A +      +  V +I+GEW++++LASD REKIE+NG+ R+F+E IHV +NS L 
Sbjct  13   LVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENS-LV 71
Query  60   FKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGES 119
            +KFHT  + +C+EL +  D TE    Y+V YDG N F+I     D++++ HLIN  +GE+
Sbjct  72   LKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGET 131
Query  120  FQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARD 168
            FQLM LYGR  D+ SDI+E+F QLC+E GI+ ENI+DL+  +RCL AR+
Sbjct  132  FQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE 180

Sequence Alignment: 7. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 129.9 bits 539,  Expect = 4e-32
 Identities = 81/166 48%, Positives = 118/166 71%, Gaps = 3/166 1%
Query  2    LIC--APKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLS 59
            L+C  A +      +  V +I+GEW++++LASD REKIE+NG+ R+F+E IHV + S L 
Sbjct  13   LVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKS-LV 71
Query  60   FKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGES 119
            +KFHT  + +C+EL +  D TE    Y+V YDG N F+I     D++++ HLIN  +GE+
Sbjct  72   LKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGET 131
Query  120  FQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARD 168
            FQLM LYGR  D+ SDI+E+F +LC+E GI+ ENI+DL+  +RCL AR+
Sbjct  132  FQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE 180

Sequence Alignment: 8. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 123.3 bits 510,  Expect = 4e-30
 Identities = 83/166 50%, Positives = 109/166 65%, Gaps = 3/166 1%
Query  1    ILICAPKRGD--AHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSL 58
            IL+C    GD     + +  +ISG WY+V  ASD RE IEE GSMRVFVE I   K+S+L
Sbjct  11   ILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVESIEPVKDSAL 70
Query  59   SFKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGE 118
            SFKF    NG+C ++ L C+   +  VY VEYDG+NVF + +    +Y IF+L N     
Sbjct  71   SFKFWAHENGECKQISLICNRVAEG-VYAVEYDGYNVFRVAETDYKNYAIFQLRNFKAEG 129
Query  119  SFQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYAR 167
            SFQL+ELYGR  DV  +I+ +F  +C++ GI E NI+D+T VDRCL AR
Sbjct  130  SFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQAR 178

Sequence Alignment: 9. Allergen Name: Can f 2 Sequence ID: O18874

 Score = 71.3 bits 282,  Expect = 2e-14
 Identities = 51/165 30%, Positives = 95/165 57%, Gaps = 6/165 3%
Query  2    LICAPKRGDAHSHSE----VSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSS 57
            LIC  +  + + H E    + ++SG W+SV LAS+  + I+  G  RVF+  +   K+ +
Sbjct  12   LICGLQAQEGN-HEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSA-KDGN 69
Query  58   LSFKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNG 117
            L      P +G+C ++ LT   T  ++ + +EY GHN + + ++ P  Y+I+++IN+ N 
Sbjct  70   LHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYND 129
Query  118  ESFQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARD 168
            ++  +  L  R L  + D    F  +C++ G+ ++ I+ L+  DRC  +RD
Sbjct  130  DTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD 180

Sequence Alignment: 10. Allergen Name: Bos d 2.0102 Sequence ID: A59225

 Score = 65.9 bits 258,  Expect = 6e-13
 Identities = 44/144 30%, Positives = 78/144 54%, Gaps = 3/144 2%
Query  18   SQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNS-SLSFKFHTPVNGKCTELFLT 76
            S+I GEW  +  A+D+++KI E G +R +   I    +  SLS  F+    G C  L+  
Sbjct  10   SKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCL-LLTE 68
Query  77   CDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRSDI 136
                ++ +VY +E+DG N + ++  V ++ ++ ++ N++     ++ E   +G     + 
Sbjct  69   VAKRQEGYVYVLEFDGTNTLEVIH-VSENMLVTYVENYDGERITKMTEGLAKGTSFTPEE 127
Query  137  REKFVQLCQERGIVEENILDLTKVDRC 163
             EK+ QL  ERG+  ENI +L K D C
Sbjct  128  LEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 11. Allergen Name: Mes a 1.0101 Sequence ID: Q9QXU1

 Score = 65.2 bits 255,  Expect = 1e-12
 Identities = 41/150 27%, Positives = 85/150 56%, Gaps = 5/150 3%
Query  12   HSHSEVS--QISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKN-SSLSFKFHTPVNG 68
            H + EVS  ++ G+W+S+ +A+D++ K+ E G +RV+V+++       +++ KF+T V  
Sbjct  18   HQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVEN 77
Query  69   KCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGR 128
             C E  +     +D   Y  ++ G+N F +++   DD + FH +N ++     ++ + G+
Sbjct  78   VCQEHRVVGRKGKDGK-YITDFSGQNYFHVVEKA-DDTMTFHNVNVDDSGKTNVILVVGK 135
Query  129  GLDVRSDIREKFVQLCQERGIVEENILDLTKVDRC 163
            G     + +++F +  ++  I +ENI  L   D C
Sbjct  136  GESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170

Sequence Alignment: 12. Allergen Name: Bos d 2.0101 Sequence ID: Q28133

 Score = 64.9 bits 254,  Expect = 1e-12
 Identities = 46/158 29%, Positives = 83/158 52%, Gaps = 5/158 3%
Query  2    LICAPKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNS-SLSF 60
            L+C  +   A    + S+I GEW  +  A+D+++KI E G +R +   I    +  SLS 
Sbjct  12   LVCTAQETPAEI--DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSI 69
Query  61   KFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESF 120
             F+    G C  L+      ++ +VY +E+ G N + ++  V ++ ++ ++ N++     
Sbjct  70   TFYLKDQGTCL-LLTEVAKRQEGYVYVLEFYGTNTLEVIH-VSENMLVTYVENYDGERIT 127
Query  121  QLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRC 163
            ++ E   +G     +  EK+ QL  ERG+  ENI +L K D C
Sbjct  128  KMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170

Sequence Alignment: 13. Allergen Name: Cav p 3.0101 Sequence ID: CAX62130

 Score = 63.6 bits 248,  Expect = 3e-12
 Identities = 46/160 28%, Positives = 94/160 58%, Gaps = 9/160 5%
Query  1    ILICAPKRGDAHSHSEV--SQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKN-SS 57
            IL+ A   G A++H  +  S+I+G+W+++ +A+D+ EKI E G +R +   +H +    +
Sbjct  3    ILLLALTIGLAYAHQTLDPSEINGQWHTISIAADNVEKIGEGGPLRGYFHNLHCYDGCKN 62
Query  58   LSFKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNN- 116
            + + F+  ++G C  + +     ED+ VY  +Y G N F ++    +D I F+  NHN  
Sbjct  63   IGLTFYVKLDGNCQRFDVLGAKQEDSDVYVAQYSGTNHFEVIGK-KEDAIAFY--NHNTD 119
Query  117  --GESFQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRC 163
              G+  +++ +  R   +  + ++K+ ++  E+GI ++NI  + + D C
Sbjct  120  ETGKETKMIVVVARRDSLTEEEQQKLQEVAGEKGIPKDNIRYFRERDTC 168

Sequence Alignment: 14. Allergen Name: Bos d 2.0103 Sequence ID: B59225

 Score = 62.7 bits 244,  Expect = 6e-12
 Identities = 43/144 29%, Positives = 76/144 52%, Gaps = 3/144 2%
Query  18   SQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNS-SLSFKFHTPVNGKCTELFLT 76
            S+I GEW  +  A+D+++KI E G +R +   I    +  SLS  F+    G C  L+  
Sbjct  10   SKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCL-LLTE 68
Query  77   CDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRSDI 136
                ++ +VY +E+ G N + ++  V ++ ++ +  N++     ++ E   +G     + 
Sbjct  69   VAKRQEGYVYVLEFYGTNTLEVIH-VSENMLVTYAENYDGERITKMTEGLAKGTSFTPEE 127
Query  137  REKFVQLCQERGIVEENILDLTKVDRC 163
             EK+ QL  ERG+  ENI +L K D C
Sbjct  128  LEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 15. Allergen Name: Phod s 1.0101 Sequence ID: S5ZYD3

 Score = 56.6 bits 217,  Expect = 4e-10
 Identities = 37/147 25%, Positives = 82/147 55%, Gaps = 4/147 2%
Query  15   SEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSS-LSFKFHTPVNGKCTEL 73
            ++ +++ G+W ++ +A+D+  KI+E G +R++V  ++  ++ S +   F+   N +C++ 
Sbjct  1    NDYAELEGKWDTIAIAADNDAKIKEEGPLRLYVRELYCNEDCSEMEVTFYVNANNQCSKT 60
Query  74   FLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNN-GESFQLMELYGRGLDV 132
             +      D   Y  +++G N F  +   P++ I+F   N +  G+   L+ + G+   +
Sbjct  61   TVIGYKQADG-TYRTQFEGDNRFQPVYATPEN-IVFTSKNVDRAGQETNLIFVVGKSQPL 118
Query  133  RSDIREKFVQLCQERGIVEENILDLTKVDRC 163
              +  EK+V++ +E  I EENI ++   D C
Sbjct  119  TPEQHEKLVEFAHENNIPEENIHNVLATDTC 149

Sequence Alignment: 16. Allergen Name: Can f 1 Sequence ID: O18873

 Score = 42.1 bits 154,  Expect = 1e-05
 Identities = 35/139 25%, Positives = 69/139 49%, Gaps = 5/139 3%
Query  20   ISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTELFLTCDP 79
            +SG+WY   + +D+ E  E+  S+   +  +   K  +L  K     NG+C  + +    
Sbjct  31   VSGKWYLKAMTADQ-EVPEKPDSVTPMI--LKAQKGGNLEAKITMLTNGQCQNITVVLHK 87
Query  80   TEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRSDIREK 139
            T +   YT  Y+G+ V  I      D+ I++     +G   ++ +L GR  +   +  E 
Sbjct  88   TSEPGKYTA-YEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALED 146
Query  140  FVQLCQERGIVEENILDLTKVDRC 163
            F ++ + +G+ +E IL+L + + C
Sbjct  147  FREFSRAKGLNQE-ILELAQSETC 169

Sequence Alignment: 17. Allergen Name: Fel d 7.0101 Sequence ID: ADK56160

 Score = 40.5 bits 147,  Expect = 3e-05
 Identities = 38/147 25%, Positives = 67/147 45%, Gaps = 4/147 2%
Query  13   SHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTE 72
            S  +   +SG+WY   + +D RE   +   + V    + V +  +L  +     NG+C E
Sbjct  24   SGEDTMAMSGKWYLKAMITD-RETSWKKPEL-VTPMTLTVLEGGNLKAETTLLTNGQCKE 81
Query  73   LFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDV 132
            + L  + T +   YT  Y G  V  I      D+ IF+      GE  ++ +L GR  + 
Sbjct  82   VELILEKTSEPKKYTT-YGGKRVVYIEPTEVKDHYIFYCEGEMQGEQARMAKLVGRDPES 140
Query  133  RSDIREKFVQLCQERGIVEENILDLTKVDRC 163
              +  E F ++ + +G  +E I+   + D C
Sbjct  141  NEEALENFREFLRAKGFNQE-IFSPKQSDTC 170

Sequence Alignment: 18. Allergen Name: Bos d 5 Sequence ID: P02754

 Score = 37.3 bits 133,  Expect = 0.0003
 Identities = 29/125 23%, Positives = 58/125 46%, Gaps = 1/125 0%
Query  16   EVSQISGEWYSVLLA-SDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTELF 74
            ++ +++G WYS+ +A SD      ++  +RV+VE +       L   ++   NG+C +  
Sbjct  27   DIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKK 86
Query  75   LTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRS 134
            +  + T+   V+ ++    N   +LD     Y++F + N    E     +   R  +V  
Sbjct  87   IIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDD 146
Query  135  DIREKF 140
            +  EKF
Sbjct  147  EALEKF 152

Sequence Alignment: 19. Allergen Name: Bos d 5 Sequence ID: AAA30411

 Score = 35.6 bits 125,  Expect = 0.0008
 Identities = 28/124 22%, Positives = 57/124 45%, Gaps = 1/124 0%
Query  17   VSQISGEWYSVLLA-SDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTELFL 75
            + +++G WYS+ +A SD      ++  +RV+VE +       L   ++   N +C +  +
Sbjct  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
Query  76   TCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRSD 135
              + T+   V+ ++    N   +LD     Y++F + N    E   + +   R  +V  +
Sbjct  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
Query  136  IREKF 140
              EKF
Sbjct  121  ALEKF 125

Sequence Alignment: 20. Allergen Name: Bos d 5 Sequence ID: CAA32835

 Score = 33.9 bits 118,  Expect = 0.003
 Identities = 27/125 21%, Positives = 57/125 45%, Gaps = 1/125 0%
Query  16   EVSQISGEWYSVLLA-SDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTELF 74
            ++ +++G WYS+ +A SD      ++  +RV+VE +       L   ++   N +C +  
Sbjct  27   DIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKK 86
Query  75   LTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRS 134
            +  + T+   V+ ++    N   +LD     Y++  + N    E   + +   R  +V  
Sbjct  87   IIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLVCMENSAEPEQSLVCQCLVRTPEVDD 146
Query  135  DIREKF 140
            +  EKF
Sbjct  147  EALEKF 152

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.