The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

IPHNGVRRGLVGETIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVA
GEVVFQGPCTAPKPITIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKS
SWQFAGANNEGPLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPG
DSPNTDGMHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKR
PDETDVKGISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYD
SKKKPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLK
SVCANAKFVLKGKPIPPGC
Sequence Info Allergen Name Length Opt Bits Score E Value
W8PPL3 Ole e 14.0101 379 2520 580.8 3.4e-167
ABY21306 Pla or 2.0101 378 1089 254.6 5.2e-69
Q6H9K0 Pla a 2 377 1061 248.2 4.3e-67
A0A077B155 Sor h 13.0101 422 1034 242.1 3.5e-65
AHL24657 Sal k 6.0101 379 1028 240.7 8e-65
ARS33724 Sal k 6.0101 401 1028 240.7 8.6e-65
A0A077B569 Sor h 13.0201 410 1012 237.1 1.1e-63
CAB42886 Phl p 13 394 1003 235.0 4.4e-63
C9EA45 Cari p 1.0101 494 843 198.5 5.4e-52
BAA06172 Cry j 2 514 782 184.6 8.7e-48
P43212 Cry j 2 514 781 184.3 1e-47
Q7M1E7 Cha o 2.0101 514 779 183.9 1.4e-47
CAC05582 Jun a 2 507 760 179.6 2.8e-46
C0HKB1 Cup s 2.0101 164 132 36.9 0.00078
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 14.0101 Sequence ID: W8PPL3

 Score = 580.8 bits 2520,  Expect = 3e-167
 Identities = 379/379 100%, Positives = 379/379 100%, Gaps = 0/379 0%
Query  1    IPHNGVRRGLVGETIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVA 60
            IPHNGVRRGLVGETIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVA
Sbjct  1    IPHNGVRRGLVGETIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVA 60
Query  61   GEVVFQGPCTAPKPITIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKS 120
            GEVVFQGPCTAPKPITIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKS
Sbjct  61   GEVVFQGPCTAPKPITIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKS 120
Query  121  SWQFAGANNEGPLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPG 180
            SWQFAGANNEGPLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPG
Sbjct  121  SWQFAGANNEGPLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPG 180
Query  181  DSPNTDGMHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKR 240
            DSPNTDGMHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKR
Sbjct  181  DSPNTDGMHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKR 240
Query  241  PDETDVKGISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYD 300
            PDETDVKGISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYD
Sbjct  241  PDETDVKGISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYD 300
Query  301  SKKKPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLK 360
            SKKKPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLK
Sbjct  301  SKKKPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLK 360
Query  361  SVCANAKFVLKGKPIPPGC 379
            SVCANAKFVLKGKPIPPGC
Sbjct  361  SVCANAKFVLKGKPIPPGC 379

Sequence Alignment: 2. Allergen Name: Pla or 2.0101 Sequence ID: ABY21306

 Score = 254.6 bits 1089,  Expect = 5e-69
 Identities = 161/354 45%, Positives = 238/354 67%, Gaps = 16/354 4%
Query  16   FDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPI 75
            F+V  YGAK  G  D +QA +KAW+AAC S GP+ V+IP G+++ GEV+++GPC   K I
Sbjct  11   FNVNDYGAKGSG--DISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCKGSK-I 67
Query  76   TIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSWQFAGA----NNEG 131
              ++ G V A  DVSA+ S  W+++  +DGL ++G GT +G+G+ +W         N   
Sbjct  68   GFQLDGVVKAPADVSAFKSEGWVVFNHVDGLTVSGKGTFDGQGQKAWAANNCDKDENCNR 127
Query  132  PLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHIS 191
            P  P+++ F  +KN+ + D+  ++S  FH  V + +NI    + ISAPG S NTDG+HI 
Sbjct  128  P--PMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDGIHIG 185
Query  192  CSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGISV 251
             S  V +TD+ I TGDDCVSIG G+ ++ V+ + CGPGHGISVGSLGK  DE DV+GI+V
Sbjct  186  LSRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVRGITV 245
Query  252  INCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYD-----SKKKPE 306
              CT+TGT+NG R+KT+  SP   A+D+ ++D+ + +V+NP+++DQ Y      S K P 
Sbjct  246  TGCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCSLKAP- 304
Query  307  QSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLKSVCANA 366
             S+VK+S + F NI+GT+     + + CS   PC ++E+ +I+LA   A     S C NA
Sbjct  305  -SRVKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTCTNA 363
Query  367  KFVLKGKPIP 376
            K ++ GK +P
Sbjct  364  KPIFSGKQVP 373

Sequence Alignment: 3. Allergen Name: Pla a 2 Sequence ID: Q6H9K0

 Score = 248.2 bits 1061,  Expect = 4e-67
 Identities = 151/356 42%, Positives = 244/356 68%, Gaps = 16/356 4%
Query  14   TIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPK 73
            ++F+V  YGAK  G  D +QA +KAWKAAC S GP+ V+IPKG++  GEV  QGPC   K
Sbjct  8    SVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSK 65
Query  74   PITIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSWQFAGAN-NEGP 132
             I  +I G V A  D S + S  W+ +  IDGL ++G GT++G+G+++W  A  N ++ P
Sbjct  66   -IGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAW--AKNNCDKNP 122
Query  133  ---LLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMH 189
                  ++L F  +K++ + D+  ++S  FH  V + E+I    + ++APG S NTDG+H
Sbjct  123  NCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIH 182
Query  190  ISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGI 249
            +  S  V +T++ I TGDDC+SIG G+ ++ ++ + CGPGHGIS+GSLG+  +E +V+GI
Sbjct  183  VGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGI 242
Query  250  SVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYD-----SKKK 304
            +V  CT++GT NG R+KT+  SP   A+D+ ++D+ + +V+NP+++DQ Y      S++ 
Sbjct  243  TVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQA 302
Query  305  PEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLKSVCA 364
            P  S++K+S ++F NI+GT+  ++ V + CS  +PC ++++ +I+L+  GA G   S C+
Sbjct  303  P--SRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCS 360
Query  365  NAKFVLKGKPIP 376
            N K  + GK +P
Sbjct  361  NVKPTFSGKQVP 372

Sequence Alignment: 4. Allergen Name: Sor h 13.0101 Sequence ID: A0A077B155

 Score = 242.1 bits 1034,  Expect = 4e-65
 Identities = 158/348 45%, Positives = 226/348 64%, Gaps = 9/348 2%
Query  17   DVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPIT 76
            D+ K GAK DG+ D+ +A+ +AW AAC   GP  ++IPKGD++ G + F GPC     +T
Sbjct  56   DISKLGAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKGDYLTGPLNFSGPCKGS--VT 113
Query  77   IEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSWQFA--GANNEGPLL 134
            I++ GN+L +TD+SAY + +WI +E +D LVI+G GT++G+GK  W         +  +L
Sbjct  114  IQLDGNLLGTTDLSAYKT-NWIEIEHVDNLVISGKGTLDGQGKQVWDNNKCAQKYDCKIL 172
Query  135  PVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHISCST 194
            P SL +  V N E+  + ++++  FH  V   + + I  + ++APGDSPNTDG+HI  S+
Sbjct  173  PNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIHIGDSS 232
Query  195  NVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGISVINC 254
             V +T + IG GDDC+SIG G+T I V+G+TCGPGHGISVGSLG+  DE DV  I+V +C
Sbjct  233  KVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDINVKDC 292
Query  255  TLTGTTNGARIKTYH-ASPSIQASDILYKDIIVTDVKNPILIDQHYDSKK---KPEQSKV 310
            TL  T+NG RIK+Y  A+  I AS + Y++I + DV NPI+ID  Y   K       SKV
Sbjct  293  TLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTAKGDSKV 352
Query  311  KISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLKSVCANAK 367
             +  V F NI GT+ +   V+L CS+ +PC  V + +I +   G      +VC NAK
Sbjct  353  TVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVCQNAK 409

Sequence Alignment: 5. Allergen Name: Sal k 6.0101 Sequence ID: AHL24657

 Score = 240.7 bits 1028,  Expect = 8e-65
 Identities = 166/356 46%, Positives = 228/356 64%, Gaps = 17/356 4%
Query  17   DVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPIT 76
            D+ K+GAK +   D   A++ AWK AC +  PAK+V+P G+F+   V +QGPC AP  +T
Sbjct  5    DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAP--LT 60
Query  77   IEIQGNVLASTDVSAYTS-GSWIMLEEIDGLVIN---GGGTINGRGKSSWQFAGANNEGP 132
            IEI GN  A  DV+      +W+ +E + GL I     GGT +G+G+++W+       G 
Sbjct  61   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 120
Query  133  L--LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHI 190
               LP ++ F  + N+++  +  ++S  +H  V   +NI ++ L I AP DS NTDGMHI
Sbjct  121  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 180
Query  191  SCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGIS 250
              S  V+ T+S IGTGDDC+S+G G  D+ V GITCGPGHGIS+GS+GK  +E    GI 
Sbjct  181  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 240
Query  251  VINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSKKKPEQ 307
            V NC++T T NG RIK++  S    ASD+ ++DI VT+V NP++IDQ Y   +  K+   
Sbjct  241  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 300
Query  308  SKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKSVCANA 366
            SKVK+S + F N+ G   S   V L CS AVPC+ VELADIDL  P GAA    S C N 
Sbjct  301  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAA---VSQCKNV 357
Query  367  KFVLKGKPIPPGC 379
            K ++ GK  P  C
Sbjct  358  KPIVTGKQNPVAC 370

Sequence Alignment: 6. Allergen Name: Sal k 6.0101 Sequence ID: ARS33724

 Score = 240.7 bits 1028,  Expect = 9e-65
 Identities = 166/356 46%, Positives = 228/356 64%, Gaps = 17/356 4%
Query  17   DVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPIT 76
            D+ K+GAK +   D   A++ AWK AC +  PAK+V+P G+F+   V +QGPC AP  +T
Sbjct  27   DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAP--LT 82
Query  77   IEIQGNVLASTDVSAYTS-GSWIMLEEIDGLVIN---GGGTINGRGKSSWQFAGANNEGP 132
            IEI GN  A  DV+      +W+ +E + GL I     GGT +G+G+++W+       G 
Sbjct  83   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 142
Query  133  L--LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHI 190
               LP ++ F  + N+++  +  ++S  +H  V   +NI ++ L I AP DS NTDGMHI
Sbjct  143  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 202
Query  191  SCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGIS 250
              S  V+ T+S IGTGDDC+S+G G  D+ V GITCGPGHGIS+GS+GK  +E    GI 
Sbjct  203  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 262
Query  251  VINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSKKKPEQ 307
            V NC++T T NG RIK++  S    ASD+ ++DI VT+V NP++IDQ Y   +  K+   
Sbjct  263  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 322
Query  308  SKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKSVCANA 366
            SKVK+S + F N+ G   S   V L CS AVPC+ VELADIDL  P GAA    S C N 
Sbjct  323  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAA---VSQCKNV 379
Query  367  KFVLKGKPIPPGC 379
            K ++ GK  P  C
Sbjct  380  KPIVTGKQNPVAC 392

Sequence Alignment: 7. Allergen Name: Sor h 13.0201 Sequence ID: A0A077B569

 Score = 237.1 bits 1012,  Expect = 1e-63
 Identities = 155/349 44%, Positives = 222/349 63%, Gaps = 9/349 2%
Query  16   FDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPI 75
            FD+ K GA  DG+ D+ +A  +AW +AC  TG   ++IPKGD++ G + F GPC     +
Sbjct  43   FDISKLGASGDGKKDSTKAVQEAWTSACGGTGKQTILIPKGDYLVGPLNFTGPCKGD--V 100
Query  76   TIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSWQFAGANN--EGPL 133
            TI++ GN+LA+TD+S Y  G+WI +  +D LVI G G ++G+G + W         +  +
Sbjct  101  TIQVDGNLLATTDLSQY-KGNWIEILRVDNLVITGKGKLDGQGPAVWSKNSCAKKYDCKI 159
Query  134  LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHISCS 193
            LP SL +  V N E+  + ++++  FH  V   + + I  + ++APGDSPNTDG+HI  S
Sbjct  160  LPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIHIGDS 219
Query  194  TNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGISVIN 253
            + V +T + IG GDDC+SIG G+T I V+G+TCGPGHGISVGSLG+  DE DV  I+V +
Sbjct  220  SKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDINVKD 279
Query  254  CTLTGTTNGARIKTYH-ASPSIQASDILYKDIIVTDVKNPILIDQHYDSKK---KPEQSK 309
            CTL  T+NG RIK+Y  A+  I AS + Y++I + DV NPI+ID  Y   K       SK
Sbjct  280  CTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTAKGDSK 339
Query  310  VKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLKSVCANAK 367
            V +  V F NI GT+ +   V+L CS+ +PC  V + +I +   G      +VC NAK
Sbjct  340  VTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVCQNAK 397

Sequence Alignment: 8. Allergen Name: Phl p 13 Sequence ID: CAB42886

 Score = 235.0 bits 1003,  Expect = 4e-63
 Identities = 150/355 42%, Positives = 224/355 63%, Gaps = 9/355 2%
Query  16   FDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPI 75
            +D+ K GAK DG+ D  +   +AW +AC  TG   +VIPKGDF+ G + F GPC     +
Sbjct  24   YDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDS-V 82
Query  76   TIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSW--QFAGANNEGPL 133
            TI++ GN+L+S D++ Y   +WI +  I  L I G GT++G+GK+ W       N    +
Sbjct  83   TIKLDGNLLSSNDLAKY-KANWIEIMRIKKLTITGKGTLDGQGKAVWGKNSCAKNYNCKI 141
Query  134  LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHISCS 193
            LP +L +    ++ +  + ++++  FH  + + + + +  + I+APGDSPNTDG+HI  S
Sbjct  142  LPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTDGIHIGDS 201
Query  194  TNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGISVIN 253
            + V +TD+ IGTGDDC+SIG G+T + ++G+TCGPGHGISVGSLG+  DE DV  I+V N
Sbjct  202  SKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDVTDITVKN 261
Query  254  CTLTGTTNGARIKTYHASPS-IQASDILYKDIIVTDVKNPILIDQHYDSKK----KPEQS 308
            C L  +TNG RIK+Y  + S + AS + Y+++ + DV  PI+IDQ Y   K    K + +
Sbjct  262  CVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKICTSKGDSA 321
Query  309  KVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLKSVCANAKF 368
            +V +  V F NI GT+ +   V+L CS+  PC  V + D+ +  SG      +VC NAK 
Sbjct  322  RVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTMAVCTNAKV 381
Query  369  VLKG 372
              KG
Sbjct  382  TAKG 385

Sequence Alignment: 9. Allergen Name: Cari p 1.0101 Sequence ID: C9EA45

 Score = 198.5 bits 843,  Expect = 5e-52
 Identities = 135/358 37%, Positives = 223/358 62%, Gaps = 18/358 5%
Query  15   IFDVMKYGAKADGRFDNAQ-AFIKAWKAACESTGPAKVVIP-KGDFVAGEVVFQGPCTAP 72
            IF+V  +GA+ DG  D+ Q  F +AW+ AC   GPA  ++P +  ++ G + F GPC + 
Sbjct  116  IFNVDDFGAEGDGIHDDTQQVFEEAWEKACSYKGPALFLVPERRTYLIGPIRFLGPCKSN 175
Query  73   KPITIEIQGNVLASTDVSAYTSGS--WIMLEEIDGLVINGGGTINGRGKSSWQFA--GAN 128
              I ++I G +LAS + S Y      WI+++ +D L++ GGGTI+G G+  W+ +     
Sbjct  176  LVIQVQISGTILASDNRSDYRKDPRHWIVIDSVDNLLVEGGGTIHGNGQIWWRNSCKAPC 235
Query  129  NEGPLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGM 188
             E P    ++TF K KN  + +V   D+   +        +  S L ++AP  SPNTDG+
Sbjct  236  KEAP----TVTFYKCKNLMVRNVKVQDAQQMQVSFEKCSEVTASDLTVTAPEKSPNTDGI 291
Query  189  HISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKG 248
            H++ + N+ +T++ IG GDDC+SI  G+ ++ +  +TCGPGHGI+V SLG    +  V  
Sbjct  292  HVTNTQNILITNTFIG-GDDCISIESGSHNVQIEELTCGPGHGINVDSLGDNNSKAFVSF 350
Query  249  ISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYDSKKKP--- 305
            ++V    L+GTTNG RIKTY+   S  AS+I ++++ + +VKNPI+IDQ+Y  +KKP   
Sbjct  351  VTVNGAKLSGTTNGVRIKTYQGG-SGSASNIKFQNVDMENVKNPIIIDQNYCDQKKPCKK 409
Query  306  -EQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGS-LKSVC 363
             ++S V++  V + NI+G + S++ + ++CSE  PC  V+L ++ L  +       K++C
Sbjct  410  QQKSAVQVKDVLYQNIQGNSASDVAIDFDCSENYPCLGVKLQNVRLQRADRVDEEAKAIC 469
Query  364  ANAKFVLKGKPIPPGC 379
             + ++   G  + P C
Sbjct  470  NHVELTETGV-VFPRC 484

Sequence Alignment: 10. Allergen Name: Cry j 2 Sequence ID: BAA06172

 Score = 184.6 bits 782,  Expect = 9e-48
 Identities = 133/359 37%, Positives = 213/359 59%, Gaps = 17/359 4%
Query  15   IFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKP 74
            IF+V KYGA  DG+ D  +AF  AW+AAC++     +V     FV   + F GPC  P  
Sbjct  58   IFNVEKYGAVGDGKHDCTEAFSTAWQAACKNPSAMLLVPGSKKFVVNNLFFNGPCQ-PH- 115
Query  75   ITIEIQGNVLASTDVSAYTSGS-WIMLEEIDGLVINGGGTINGRGKSSWQFAGANNEGPL 133
             T ++ G + A  + +++ +   W+ + ++ G+ + G G I+G+GK  W        G  
Sbjct  116  FTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGRE 175
Query  134  L------PVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDG 187
            +      P ++ F       ++ + +++S  FH    + E +KI  + I+AP DSPNTDG
Sbjct  176  ICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDG 235
Query  188  MHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVK 247
            + I  S N ++  + IGTGDDCV+IG G+++I++  + CGPGHGIS+GSLG+     +V 
Sbjct  236  IDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVS 295
Query  248  GISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSKKK 304
             + V    +  T NG RIKT++   S  AS I+Y+++ + + +NPILI+Q Y    S  +
Sbjct  296  YVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASACQ 354
Query  305  PEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKSVC 363
             ++S V+I  V + NI+GT+ +   + L CS+++PC+D++L+DI L   SG   S  +  
Sbjct  355  NQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDN 414
Query  364  ANAKFVLKGKPIPPGC 379
            AN  F   G  IP  C
Sbjct  415  ANGYF--SGHVIP-AC 427

Sequence Alignment: 11. Allergen Name: Cry j 2 Sequence ID: P43212

 Score = 184.3 bits 781,  Expect = 1e-47
 Identities = 134/357 37%, Positives = 217/357 60%, Gaps = 21/357 5%
Query  15   IFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGD--FVAGEVVFQGPCTAP 72
            IF+V KYGA  DG+ D  +AF  AW+AAC+   P+ +++  G+  FV   + F GPC  P
Sbjct  58   IFNVEKYGAVGDGKHDCTEAFSTAWQAACKK--PSAMLLVPGNKKFVVNNLFFNGPCQ-P 114
Query  73   KPITIEIQGNVLASTDVSAYTSGS-WIMLEEIDGLVINGGGTINGRGKSSWQFAGANNEG 131
               T ++ G + A  + +++ +   W+ + ++ G+ + G G I+G+GK  W        G
Sbjct  115  H-FTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNG 173
Query  132  PLL------PVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNT 185
              +      P ++ F       ++ + +++S  FH    + E +KI  + I+AP DSPNT
Sbjct  174  REICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNT 233
Query  186  DGMHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETD 245
            DG+ I  S N ++  + IGTGDDCV+IG G+++I++  + CGPGHGIS+GSLG+     +
Sbjct  234  DGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAE 293
Query  246  VKGISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSK 302
            V  + V    +  T NG RIKT++   S  AS I+Y+++ + + +NPILI+Q Y    S 
Sbjct  294  VSYVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASA 352
Query  303  KKPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKS 361
             + ++S V+I  V + NI+GT+ +   + L CS+++PC+D++L+DI L   SG   S  +
Sbjct  353  CQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLN 412
Query  362  VCANAKFVLKGKPIPPGC 379
              AN  F   G  IP  C
Sbjct  413  DNANGYF--SGHVIP-AC 427

Sequence Alignment: 12. Allergen Name: Cha o 2.0101 Sequence ID: Q7M1E7

 Score = 183.9 bits 779,  Expect = 1e-47
 Identities = 126/358 35%, Positives = 209/358 58%, Gaps = 16/358 4%
Query  14   TIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPK 73
            T+F+V +YGA  DG+ D+ +AF   W AAC+      +V     F    +VF+GPC  P 
Sbjct  57   TVFNVEQYGAVGDGKHDSTEAFATTWNAACKKASAVLLVPANKKFFVNNLVFRGPCQ-PH 115
Query  74   PITIEIQGNVLASTDVSAYTSGS-WIMLEEIDGLVINGGGTINGRGKSSWQFAGANNEGP 132
             ++ ++ G ++A  D + + +   W+ + ++  + + G G I+G+G+  W        G 
Sbjct  116  -LSFKVDGTIVAQPDPARWKNSKIWLQFAQLTDFNLMGTGVIDGQGQQWWAGQCKVVNGR 174
Query  133  LL------PVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTD 186
             +      P ++     K+  + ++ +++S  FH    + E +KI  LKI AP DSPNTD
Sbjct  175  TVCNDRNRPTAIKIDYSKSVTVKELTLMNSPEFHLVFGECEGVKIQGLKIKAPRDSPNTD 234
Query  187  GMHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDV 246
            G+ I  S   ++   +IGTGDDC++IG G+++I +  + CGPGHGIS+GSLG+     +V
Sbjct  235  GIDIFASKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDNSRAEV 294
Query  247  KGISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSKK 303
              + V    +  T NG RIKT++    + AS I Y+++ + + +NPILI+Q Y    S  
Sbjct  295  SHVHVNRAKFIDTQNGLRIKTWQGGSGL-ASYITYENVEMINSENPILINQFYCTSASAC 353
Query  304  KPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKSV 362
            + ++S V+I GV + NI GT+ +   + L CS++VPC  ++L+++ L   SG   S   V
Sbjct  354  QNQRSAVQIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVSLKLTSGKPAS--CV 411
Query  363  CANAKFVLKGKPIP 376
              NA+    G+ IP
Sbjct  412  DKNARGFYSGRLIP 425

Sequence Alignment: 13. Allergen Name: Jun a 2 Sequence ID: CAC05582

 Score = 179.6 bits 760,  Expect = 3e-46
 Identities = 126/357 35%, Positives = 204/357 57%, Gaps = 21/357 5%
Query  15   IFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKP 74
            +F+V  YGA  DG+ D+  AF K W AAC       +V     FV   +VF GPC  P  
Sbjct  59   VFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANKKFVVNNLVFYGPCQ-PH- 116
Query  75   ITIEIQGNVLASTDVSAYTSGS-WIMLEEIDGLVINGGGTINGRGKSSWQ-----FAG-- 126
             + ++ G + A  D + + +   W+ +  +  + + G G I+G+G   W        G  
Sbjct  117  FSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFNLMGTGVIDGQGNRWWSDQCKTINGRT 176
Query  127  -ANNEGPLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNT 185
              N++G    + + F K  +  + ++ + +S  FH    + + +KI  +KI AP DSPNT
Sbjct  177  VCNDKGRPTAIKIDFSK--SVTVKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNT 234
Query  186  DGMHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETD 245
            DG+ I  S    +    IGTGDDCV++G G+++I +  +TCGPGHG+S+GSLGK    ++
Sbjct  235  DGIDIFASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSE 294
Query  246  VKGISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYDSKK-- 303
            V  + +    +  T NG RIKT++    + AS I Y+++ + + +NPILI+Q Y +    
Sbjct  295  VSFVHLDGAKFIDTQNGLRIKTWQGGSGL-ASHITYENVEMINAENPILINQFYCTSAAA 353
Query  304  -KPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKS 361
             K ++S VKI  V F NI GT+ +   + L CS++VPC +++L+++ L   SG   +  +
Sbjct  354  CKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKLTSGKVATCVN 413
Query  362  VCANAKFVLKGKPIPPGC 379
              AN  +     P+ P C
Sbjct  414  KNANGYYT---NPLNPSC 428

Sequence Alignment: 14. Allergen Name: Cup s 2.0101 Sequence ID: C0HKB1

 Score = 36.9 bits 132,  Expect = 0.0008
 Identities = 23/62 37%, Positives = 38/62 61%, Gaps = 9/62 14%
Query  224  ITCGPGHGISVGSLGKRPDETDVKGISVINCTLTGTTNGARIKTYHASPSIQASDILYKD 283
            +TCGPGHG+S+GSLGK    ++V  + +    +  T NG R        +++  D+ +K+
Sbjct  98   LTCGPGHGMSIGSLGKGNSRSEVSFVHLDGAKFIDTQNGLR-------SAVKIEDVTFKN 150
Query  284  I--IVTDVKNP 292
                 T+  NP
Sbjct  151  ANGYYTNPLNP 161

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.