The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG
VNFNLASGLPGKCGVSIPYKISPSTDCSSVK
Sequence Info Allergen Name Length Opt Bits Score E Value
W0U0V5 Can s 3.0101 91 618 121.3 4.1e-30
P85894 Mor n 3.0101 91 501 99.9 1.1e-23
Q8VX12 Fra a 3.0101 117 462 92.9 1.9e-21
Q4PLU0 Fra a 3.0201 117 458 92.2 3.1e-21
Q4PLT6 Fra a 3.0202 117 455 91.6 4.5e-21
Q4PLT9 Fra a 3.0102 117 451 90.9 7.5e-21
A0A059STC4 Pun g 1.0101 120 446 90.0 1.4e-20
Q9M5X7 Mal d 3 115 444 89.6 1.8e-20
A0A059ST23 Pun g 1.0301 120 433 87.6 7.4e-20
Q0Z8V0 Rub i 3.0101 117 432 87.4 8.3e-20
Q9M5X8 Pru av 3 117 429 86.9 1.2e-19
CAB96876 Pru p 3 91 422 85.5 2.5e-19
P82534 Pru d 3 91 418 84.8 4.1e-19
Q9M5X6 Pyr c 3 115 417 84.7 5.5e-19
AAL25839 Hev b 12 116 416 84.5 6.3e-19
P81402 Pru p 3 91 412 83.7 8.8e-19
P93224 Sola l 3.0101 114 413 83.9 9e-19
AAB42069 Lyc e 3 114 413 83.9 9e-19
P81651 Pru ar 3 91 409 83.1 1.3e-18
ABX56711 Ara h 9.0101 116 406 82.7 2.2e-18
ADC80503 Pha v 3.0201 118 404 82.3 2.9e-18
ABX75045 Ara h 9.0201 92 401 81.7 3.6e-18
ABY21307 Pla or 3.0101 118 401 81.8 4.2e-18
AAK28533 Cor a 8 115 400 81.6 4.7e-18
ACV04796 Api g 2 118 398 81.2 6.2e-18
CAL07989 Pla a 3.0101 118 397 81.0 7e-18
ADC80502 Pha v 3.0101 115 394 80.5 1e-17
A0A059SSZ0 Pun g 1.0201 120 393 80.3 1.2e-17
XP_019446786 Lup an 3.0101 116 392 80.1 1.3e-17
P19656-1 Zea m 14.0101 120 382 78.3 4.8e-17
ACN11576 Pru du 3.0101 123 380 78.0 6.2e-17
P19656-2 Zea m 14.0102 128 378 77.6 8.3e-17
A0A510A9S3 Ara h 17.0101 93 375 76.9 9.7e-17
A0AT29 Len c 3.0101 118 367 75.6 3.1e-16
CAH69206 Tri tu 14.0101 115 362 74.6 5.8e-16
A0A161AT60 Pis s 3.0101 120 359 74.1 8.8e-16
ANC85027 Art si 3.0102 116 358 73.9 9.7e-16
ACE07187 Art v 3.0202 116 358 73.9 9.7e-16
ANC85020 Art ar 3.0102 116 358 73.9 9.7e-16
ANC85023 Art gm 3.0102 117 347 71.9 3.9e-15
ANC85026 Art si 3.0101 116 346 71.7 4.4e-15
QIN55516 Art ca 3.0102 117 345 71.5 5.1e-15
EU564845 Art v 3.0201 114 343 71.2 6.4e-15
ANC85025 Art la 3.0102 115 343 71.2 6.5e-15
ANC85019 Art ar 3.0101 116 343 71.2 6.5e-15
ANC85024 Art la 3.0101 116 343 71.2 6.5e-15
EU564847 Art v 3.0301 117 343 71.2 6.5e-15
ANC85022 Art gm 3.0101 117 342 71.0 7.4e-15
ANC85018 Art an 3.0102 117 331 69.0 3e-14
ANC85017 Art an 3.0101 117 329 68.6 3.8e-14
ANC85021 Art ca 3.0101 117 329 68.6 3.8e-14
AAA32970 Hor v 1 117 327 68.2 5e-14
ABU95411 Sin a 3.0101 92 324 67.6 6.1e-14
CAA42832 Hor v 1 134 324 67.8 8e-14
P82007 Hel a 3.0101 116 314 65.9 2.6e-13
19846220 Tri a 14.0101 90 308 64.7 4.6e-13
NP_001316123 Sola l 7.0101 115 282 60.0 1.5e-11
O04403 Par j 2 133 219 48.6 4.7e-08
Q40905 Par j 1 138 213 47.5 1e-07
P43217 Par j 1 139 212 47.3 1.2e-07
O04404 Par j 1 176 211 47.2 1.6e-07
P55958 Par j 2 133 208 46.6 1.9e-07
CAI94601 Par j 1.0103 139 208 46.6 2e-07
CAA54587 Par j 1.0101 133 187 42.7 2.7e-06
O04004 Amb a 6 118 181 41.6 5.3e-06
P80274 Vit v 1 37 148 35.0 0.00016
P0C088 Art v 3.0101 37 146 34.7 0.0002
10998016 Cas s 8 36 132 32.1 0.0012
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 121.3 bits 618,  Expect = 4e-30
 Identities = 91/91 100%, Positives = 91/91 100%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VNFNLASGLPGKCGVSIPYKISPSTDCSSVK
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 2. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 99.9 bits 501,  Expect = 1e-23
 Identities = 69/91 75%, Positives = 81/91 89%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV+SSLAPC++YL+ GG VP  CCN ++SL+ AAKT ADRQAAC CLKSA +SIKG
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N+NLA+GLPGKCGVS+PYKISPSTDC SVK
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 3. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 92.9 bits 462,  Expect = 2e-21
 Identities = 63/91 69%, Positives = 79/91 86%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQVAS+++PCL+Y+K GGAVP  CC+ I++L+G AKT ADRQAAC CLK AA  IKG
Sbjct  27   ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKG 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N NLA+GLPGKCGVS+PYKIS +T+C++VK
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 4. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 92.2 bits 458,  Expect = 3e-21
 Identities = 63/91 69%, Positives = 79/91 86%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQVASS++PC++Y+K GGAVP  CCN I+SL+ AAKT ADRQA C CLK A+ +IKG
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKG 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N +LA+GLPGKCGVS+PYKIS ST+C++VK
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 5. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 91.6 bits 455,  Expect = 5e-21
 Identities = 62/91 68%, Positives = 78/91 85%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQVASS++PC++Y+K GGAVP  CCN I+SL+ AAKT ADRQ  C CLK A+ +IKG
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKG 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N NLA+GLPGKCGV++PYKIS ST+C++VK
Sbjct  87   LNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 6. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 90.9 bits 451,  Expect = 7e-21
 Identities = 61/91 67%, Positives = 78/91 85%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQVAS+++PC++Y+K GGAVP  CC+ I++L+G AKT ADRQA C CLK AA  IKG
Sbjct  27   ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKG 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N NLA+GLPGKCGVS+PYKIS +T+C++VK
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 7. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 90.0 bits 446,  Expect = 1e-20
 Identities = 61/91 67%, Positives = 74/91 81%, Gaps = 1/91 1%
Query  1    ITCGQVASSLAPCLSYLK-VGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            +TCGQVASSLAPC+ Y +  GGAVP  CC+ IK+L G A+T  DRQA CKCLKSA++SI 
Sbjct  29   VTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSIS 88
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            G+N+ L + LP KCGV+IPYKISPSTDC+ VK
Sbjct  89   GINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 8. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 89.6 bits 444,  Expect = 2e-20
 Identities = 60/91 65%, Positives = 75/91 82%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV SSLAPC+ Y++ GGAVP  CCN I++++G A+T ADRQ AC CLK+ A SI G
Sbjct  25   ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG 84
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VN N A+GLPGKCGV++PYKIS ST+C++VK
Sbjct  85   VNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 9. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 87.6 bits 433,  Expect = 7e-20
 Identities = 62/91 68%, Positives = 74/91 81%, Gaps = 2/91 2%
Query  1    ITCGQVASSLAPCLSYLKVGGA--VPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSI 58
            ITCGQV+SSLA C+ Y +  GA  VP  CCN I+SL+ AAKT  DRQAAC+CLKS ASSI
Sbjct  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
Query  59   KGVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
             G+N+ L +G PGKCGVSIPYKI+PST+C +VK
Sbjct  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 10. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 87.4 bits 432,  Expect = 8e-20
 Identities = 58/91 63%, Positives = 75/91 82%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV  ++APC++Y+K GGAVP  CCN +++L+  AKT ADRQ  C CLK+AA SI G
Sbjct  27   ITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPG 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N +LA+GLPGKCGVS+PYKIS ST+C++VK
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 11. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 86.9 bits 429,  Expect = 1e-19
 Identities = 56/91 61%, Positives = 76/91 83%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TCGQV+S+LAPC++Y++ GGAVP  CCN I++++  AKT ADRQ AC CLK  ++S+ G
Sbjct  27   LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPG 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VN N A+ LPGKCGV++PYKISPST+C++VK
Sbjct  87   VNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 12. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 85.5 bits 422,  Expect = 2e-19
 Identities = 58/91 63%, Positives = 74/91 81%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV+SSLAPC+ Y++ GGAVP  CCN I++++  A+T  DRQAAC CLK  ++S+ G
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VN N A+ LPGKCGVSIPYKIS ST+C++VK
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 13. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 84.8 bits 418,  Expect = 4e-19
 Identities = 57/91 62%, Positives = 75/91 82%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV+S+LAPC++Y+K GGAVP  CCN I++++  A+T ADR+AAC CLK  + SI G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VN N A+ LPGKCGV++PYKIS ST+C++VK
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 14. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 84.7 bits 417,  Expect = 5e-19
 Identities = 56/91 61%, Positives = 73/91 80%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITC QV+++LAPC++Y++ GGAVP  CCN IK+++G AKT  DRQAAC CLK+ A S+ G
Sbjct  25   ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSG 84
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VN   A  LPGKCGV++PYKIS ST+C++VK
Sbjct  85   VNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 15. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 84.5 bits 416,  Expect = 6e-19
 Identities = 58/91 63%, Positives = 73/91 80%, Gaps = 1/91 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            ITCGQV S+L PCLSYLK  G  P   CCN +++++ AAKT ADR+ AC+CLKSAA S+K
Sbjct  25   ITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVK 84
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            G+N    +GLPGKCGV+IPYKIS ST+C++VK
Sbjct  85   GLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 16. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 83.7 bits 412,  Expect = 9e-19
 Identities = 56/91 61%, Positives = 73/91 80%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV+S+LAPC+ Y++ GGAVP  CCN I++++  A+T  DRQAAC CLK  ++S+ G
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VN N A+ LPGKCGV IPYKIS ST+C++VK
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 17. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 83.9 bits 413,  Expect = 9e-19
 Identities = 58/90 64%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ++CG+V S LAPCL YL+  G +  GCC  +K L GAAKTP DR+ AC CLKSAA+SIKG
Sbjct  25   LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            ++   A+GLPG CGV+IPYKISPSTDCS+V+
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 18. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 83.9 bits 413,  Expect = 9e-19
 Identities = 58/90 64%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ++CG+V S LAPCL YL+  G +  GCC  +K L GAAKTP DR+ AC CLKSAA+SIKG
Sbjct  25   LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            ++   A+GLPG CGV+IPYKISPSTDCS+V+
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 19. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 83.1 bits 409,  Expect = 1e-18
 Identities = 56/91 61%, Positives = 72/91 79%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV+SSLAPC+ Y++ GGAVP  CCN I++++  A+T  DR+ AC CLK  + SI G
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            VN N A+ LPGKCGV+IPYKIS ST+C++VK
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 20. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 82.7 bits 406,  Expect = 2e-18
 Identities = 54/91 59%, Positives = 72/91 79%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            I+CGQV S+LAPC+ +L  GGA P  CC+ ++ L GA +T ADRQAAC CLK+AA S++G
Sbjct  25   ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG 84
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N   A+ LPG+CGVSIPYKIS ST+C+++K
Sbjct  85   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 21. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 82.3 bits 404,  Expect = 3e-18
 Identities = 57/91 62%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            I+CGQV SSLA C+ +L  GG VP  CC+ ++SL+ AAKT  DRQA C CLKSAA +I G
Sbjct  27   ISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPG 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
             N N A  LPGKCGVSIPYKIS ST+C+++K
Sbjct  87   FNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 22. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 81.7 bits 401,  Expect = 4e-18
 Identities = 56/90 62%, Positives = 74/90 82%, Gaps = 2/90 2%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            ++CGQV S+LAPC+++L  GG VP G CC+ ++ L GAAKT ADRQAAC CLK+AA S+ 
Sbjct  1    LSCGQVNSALAPCITFLTKGG-VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            G+N   A+ LPG+CGVSIPYKIS ST+C+++K
Sbjct  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 23. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 81.8 bits 401,  Expect = 4e-18
 Identities = 54/91 59%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCG V + L PCL+YL+ GGAV   CCN +K+L+  AKT  DRQAAC CLK+A++SI G
Sbjct  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            + +  A+ L GKCGV++PYKISP+ DCS VK
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 24. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 81.6 bits 400,  Expect = 5e-18
 Identities = 51/91 56%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC Q+  +L PC+ YLK GG +P  CC  +++++ A++T +DRQ+AC CLK  A  I G
Sbjct  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N NLA+GLPGKCGV+IPYKISPST+C++VK
Sbjct  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 25. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 81.2 bits 398,  Expect = 6e-18
 Identities = 54/90 60%, Positives = 63/90 70%, Gaps = 0/90 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TCGQV   L  CL YLK GG     CC  +K L+  AKTPADR+ AC CLK+ A S+KG
Sbjct  28   LTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKG 87
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSV 90
            +N+  AS LPGKCG+ IPY ISPSTDCS V
Sbjct  88   INYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 26. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 81.0 bits 397,  Expect = 7e-18
 Identities = 53/91 58%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCG V + L PCL++L+ GGAV   CCN +K+L+  AKT  DRQAAC CLK+A++SI G
Sbjct  28   ITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            + +  A+ L GKCGV++PYKISP+ DCS VK
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 27. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 80.5 bits 394,  Expect = 1e-17
 Identities = 49/90 54%, Positives = 72/90 80%, Gaps = 0/90 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TCGQV S+L PC+++L+ GG VP GCCN ++++  +A++ ADR+  C CLK+AA +++G
Sbjct  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSV 90
            +N N A  LPGKCGV+IPYKIS ST+C+S+
Sbjct  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 28. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 80.3 bits 393,  Expect = 1e-17
 Identities = 56/91 61%, Positives = 65/91 71%, Gaps = 1/91 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            +TCGQV SSL PC+ Y +   A P   CC+ ++SL+ AAKT  DRQ AC CLK  A SI 
Sbjct  29   VTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSIT 88
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            G+N+     LPGKCGVSIPYKISPSTDCS VK
Sbjct  89   GINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 29. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 80.1 bits 392,  Expect = 1e-17
 Identities = 55/91 60%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV ++LA CL+YL+ GGAVP  CCN IK++   AKT  DR+ AC CLK+AA++  G
Sbjct  26   ITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N + A  LPGKCGV+IPYKIS ST+C+S+K
Sbjct  86   LNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 30. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 78.3 bits 382,  Expect = 5e-17
 Identities = 53/90 58%, Positives = 71/90 78%, Gaps = 1/90 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            I+CGQVAS++APC+SY +  G+ P  GCC+ ++SL+ AA+T ADR+AAC CLK+AA+ + 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSV 90
            G+N   A+ +P KCGVSIPY IS STDCS V
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 31. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 78.0 bits 380,  Expect = 6e-17
 Identities = 51/91 56%, Positives = 68/91 74%, Gaps = 2/91 2%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ++CGQV ++L PC++Y+  GGA+   CC  ++SL   A+T ADRQ+ C CLK A + I  
Sbjct  31   VSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPY 90
Query  61   VNFN--LASGLPGKCGVSIPYKISPSTDCSSVK 91
             N N  LA+GLPGKCGV+IPYKISPSTDC ++K
Sbjct  91   TNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 32. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 77.6 bits 378,  Expect = 8e-17
 Identities = 52/88 59%, Positives = 70/88 79%, Gaps = 1/88 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            I+CGQVAS++APC+SY +  G+ P  GCC+ ++SL+ AA+T ADR+AAC CLK+AA+ + 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCS 88
            G+N   A+ +P KCGVSIPY IS STDCS
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 33. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 76.9 bits 375,  Expect = 1e-16
 Identities = 54/91 59%, Positives = 68/91 74%, Gaps = 1/91 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            I C  V  S+APC+ YLK GG V   CC+ I++++G AKT +DRQA C CLKSAA+S+  
Sbjct  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
Query  61   -VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
             +N N A+ LPGKCGVSIPYKIS S +CSS+K
Sbjct  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 34. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 75.6 bits 367,  Expect = 3e-16
 Identities = 55/90 61%, Positives = 66/90 73%, Gaps = 2/90 2%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            I+CG V S L+PCL+YL  GG  P   CC  +K L  AA T  DRQAAC CLKSAA SI 
Sbjct  27   ISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSIT 85
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
             +N N A+ LPGKCGV+IPYKIS +T+C++VK
Sbjct  86   KLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 35. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 74.6 bits 362,  Expect = 6e-16
 Identities = 48/88 54%, Positives = 71/88 80%, Gaps = 4/88 4%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            ++CGQV+S+L+PC+SY +  GA P   CC+ ++SL+ +A++ AD+QAACKC+KSAA+   
Sbjct  27   VSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--- 83
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            G+N   A+G+P KCGVS+PY IS S DCS ++
Sbjct  84   GLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 36. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 74.1 bits 359,  Expect = 9e-16
 Identities = 51/91 56%, Positives = 67/91 73%, Gaps = 2/91 2%
Query  1    ITCGQVASSLAPCLSYLKV--GGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSI 58
            ++CG V++ +APC++YL+     + P  CC  +K L  AA T  DRQAAC CLKSAA SI
Sbjct  27   LSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSI 86
Query  59   KGVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
              +N N A+ LPGKCGVSIPYKIS ST+C++V+
Sbjct  87   PKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 37. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 73.9 bits 358,  Expect = 1e-15
 Identities = 49/91 53%, Positives = 64/91 70%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ + PCL+YLK GG VP  CC  +K L+ AAKT  DRQ AC CLK++  S K 
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  ++A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 38. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 73.9 bits 358,  Expect = 1e-15
 Identities = 49/91 53%, Positives = 64/91 70%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ + PCL+YLK GG VP  CC  +K L+ AAKT  DRQ AC CLK++  S K 
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  ++A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 39. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 73.9 bits 358,  Expect = 1e-15
 Identities = 49/91 53%, Positives = 64/91 70%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ + PCL+YLK GG VP  CC  +K L+ AAKT  DRQ AC CLK++  S K 
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  ++A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 40. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 71.9 bits 347,  Expect = 4e-15
 Identities = 49/91 53%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ ++PCLS+LK GG VP  CC  +K L+ AAKT  DRQ AC CLK++  S K 
Sbjct  27   LTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  + A  LP KCGV+IPYKIS  TDC+ VK
Sbjct  87   LKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 41. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 71.7 bits 346,  Expect = 4e-15
 Identities = 47/91 51%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ ++PCL+YLK GG VP  CC  +K L+ AAKT  DRQ AC CLK++  + K 
Sbjct  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  + A  LP KCGV+IPYK+S  TDC+ VK
Sbjct  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 42. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 71.5 bits 345,  Expect = 5e-15
 Identities = 49/91 53%, Positives = 62/91 68%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ + PCLS+LK GG VP  CC  +K L+ AAKT  DRQ AC CLK+   S K 
Sbjct  27   LTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKD 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  + A  LP KCGV+IPYKIS  TDC++VK
Sbjct  87   LKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 43. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 71.2 bits 343,  Expect = 6e-15
 Identities = 48/91 52%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            + C  V++ ++ CLSYLK GG VP  CC  +K L+ AAKT  DRQ AC CLK+   S K 
Sbjct  24   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 83
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
               ++A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  84   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 44. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 71.2 bits 343,  Expect = 6e-15
 Identities = 46/91 50%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ ++PCLSYLK GG VP  CC  +K L+ A KT  DRQ AC CLK++  S K 
Sbjct  25   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 84
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  ++A  LP KCG+++PYK+S  TDC+ VK
Sbjct  85   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 45. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 71.2 bits 343,  Expect = 6e-15
 Identities = 48/91 52%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            + C  V++ ++ CLSYLK GG VP  CC  +K L+ AAKT  DRQ AC CLK+   S K 
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
               ++A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  86   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 46. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 71.2 bits 343,  Expect = 6e-15
 Identities = 48/91 52%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            + C  V++ ++ CLSYLK GG VP  CC  +K L+ AAKT  DRQ AC CLK+   S K 
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
               ++A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  86   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 47. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 71.2 bits 343,  Expect = 7e-15
 Identities = 46/91 50%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ ++PCLSYLK GG VP  CC  +K L+ A KT  DRQ AC CLK++  S K 
Sbjct  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +  ++A  LP KCG+++PYK+S  TDC+ VK
Sbjct  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 48. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 71.0 bits 342,  Expect = 7e-15
 Identities = 48/91 52%, Positives = 62/91 68%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ ++PC S+LK GG VP  CC  +K L+ AAKT  DRQ AC CLK++  S K 
Sbjct  27   LTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
               + A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  87   FKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 49. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 69.0 bits 331,  Expect = 3e-14
 Identities = 47/91 51%, Positives = 59/91 64%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V   ++PC S+L+ GG VP  CC  +K L+ AAKT  DRQAAC CLK++  S   
Sbjct  27   LTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNN 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
                 A+ LP KCGV+IPYKIS  TDC+ VK
Sbjct  87   FKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 50. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 68.6 bits 329,  Expect = 4e-14
 Identities = 48/91 52%, Positives = 59/91 64%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ + PC S+LK GG V   CC  +K L+ AAKT  DRQAAC CLK+   S K 
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
               + A  LP KCGV+IPYKIS  TDC+ VK
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 51. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 68.6 bits 329,  Expect = 4e-14
 Identities = 48/91 52%, Positives = 59/91 64%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            +TC  V++ + PC S+LK GG V   CC  +K L+ AAKT  DRQAAC CLK+   S K 
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
               + A  LP KCGV+IPYKIS  TDC+ VK
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 52. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 68.2 bits 327,  Expect = 5e-14
 Identities = 42/89 47%, Positives = 58/89 65%, Gaps = 2/89 2%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            + CGQV S + PCL+Y++ GG  P G CCN ++ L   A++  DRQ  C CLK  A  I 
Sbjct  27   LNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIH 85
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSV 90
             +N+N A+ +P KC V++PY ISP  DCS +
Sbjct  86   NLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 53. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 67.6 bits 324,  Expect = 6e-14
 Identities = 44/91 48%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ++CG V S+LA C+ YL     +P GCC  + +L+  A+T  DRQ AC+CL  AA+S   
Sbjct  2    LSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPS 61
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91
            +N   A+ LP  CGV+IPYKIS ST+C+SV+
Sbjct  62   LNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 54. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 67.8 bits 324,  Expect = 8e-14
 Identities = 42/87 48%, Positives = 57/87 65%, Gaps = 2/87 2%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            + CGQV S + PCL+Y++ GG  P G CCN ++ L   A++  DRQ  C CLK  A  I 
Sbjct  27   LNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIH 85
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCS 88
             +N+N A+ +P KC V++PY ISP  DCS
Sbjct  86   NLNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 55. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 65.9 bits 314,  Expect = 3e-13
 Identities = 43/89 48%, Positives = 58/89 65%, Gaps = 1/89 1%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITC  V  +L PCL YL+ GG     CC   K L GA +T ADR+ ACKC K+AA  +K 
Sbjct  27   ITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK- 85
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSV 90
            V  ++AS LPGKCG+S    I+P+ +C+++
Sbjct  86   VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 56. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 64.7 bits 308,  Expect = 5e-13
 Identities = 44/89 49%, Positives = 61/89 68%, Gaps = 2/89 2%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
            I CG+V S + PCLSY++ GG  P G CC+ +K+L   A++ +DRQ+AC CLK  A  I 
Sbjct  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
Query  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSV 90
             +N + A  +P KCGV++PY IS + DCS V
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 57. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 60.0 bits 282,  Expect = 1e-11
 Identities = 35/90 38%, Positives = 58/90 64%, Gaps = 0/90 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            ITCGQV ++LAPC+ +L  GG     CC+ +++L+G  ++  DR+ AC C+K+AA+    
Sbjct  25   ITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPN 84
Query  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSV 90
            +  + A  LP KCG+S+   IS + +C ++
Sbjct  85   LKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 58. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 48.6 bits 219,  Expect = 5e-08
 Identities = 32/88 36%, Positives = 50/88 56%, Gaps = 4/88 4%
Query  3    CGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGV 61
            CG+V   + PCL ++K     P   CC+  K LS   KT   ++ ACKC+ +A   I G+
Sbjct  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
Query  62   NFNLASGLPGKCGVS--IPYKISPSTDCSSVK 91
               L + +P KCG++  +P  I+   DCS ++
Sbjct  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 59. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 47.5 bits 213,  Expect = 1e-07
 Identities = 31/88 35%, Positives = 50/88 56%, Gaps = 5/88 5%
Query  2    TCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            TCG V  +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   
Sbjct  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
Query  61   VNFNLASGLPGKCGVSIPYKISP---STDCSSV 90
            ++  L S +P  CG+ +  K+ P   + DC ++
Sbjct  99   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 130

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 47.3 bits 212,  Expect = 1e-07
 Identities = 31/88 35%, Positives = 50/88 56%, Gaps = 5/88 5%
Query  2    TCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            TCG +  +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  61   VNFNLASGLPGKCGVSIPYKISP---STDCSSV 90
            ++  L S +P  CG+ +  K+ P   + DC +V
Sbjct  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 47.2 bits 211,  Expect = 2e-07
 Identities = 31/88 35%, Positives = 50/88 56%, Gaps = 5/88 5%
Query  2    TCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            TCG V  +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   
Sbjct  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
Query  61   VNFNLASGLPGKCGVSIPYKISP---STDCSSV 90
            ++  L S +P  CG+ +  K+ P   + DC ++
Sbjct  100  IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 131

Sequence Alignment: 62. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 46.6 bits 208,  Expect = 2e-07
 Identities = 31/88 35%, Positives = 48/88 54%, Gaps = 4/88 4%
Query  3    CGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGV 61
            CG+V   + PCL ++K     P   CC+  K LS   KT   ++ ACKC+  A   I G+
Sbjct  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
Query  62   NFNLASGLPGKCGV--SIPYKISPSTDCSSVK 91
               L + +P KC +  ++P  I+   DCS ++
Sbjct  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 63. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 46.6 bits 208,  Expect = 2e-07
 Identities = 30/88 34%, Positives = 50/88 56%, Gaps = 5/88 5%
Query  2    TCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
            TCG +  +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  61   VNFNLASGLPGKCGVSIPYKISP---STDCSSV 90
            ++  L S +P  CG+ +  K+ P   + DC ++
Sbjct  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 94

Sequence Alignment: 64. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 42.7 bits 187,  Expect = 3e-06
 Identities = 28/81 34%, Positives = 46/81 56%, Gaps = 5/81 6%
Query  9    SLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLAS 67
            +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   ++  L S
Sbjct  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
Query  68   GLPGKCGVSIPYKISP---STDCSSV 90
             +P  CG+ +  K+ P   + DC +V
Sbjct  64   EVPKHCGI-VDSKLPPIDVNMDCKTV 88

Sequence Alignment: 65. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 41.6 bits 181,  Expect = 5e-06
 Identities = 31/87 35%, Positives = 43/87 49%, Gaps = 3/87 3%
Query  2    TCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGV 61
            TC  V + LAPC  +L  G      CC  + +L+ + KT ADR A C C+K    SI   
Sbjct  29   TCDTVQNILAPCAGFL-TGQEPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AY 86
Query  62   NFNLASGLPGKCGVSIPYK-ISPSTDCSSV 90
            +      L  KCGV   +  +  + DCS +
Sbjct  87   DPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 66. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 35.0 bits 148,  Expect = 0.0002
 Identities = 23/35 65%, Positives = 28/35 80%, Gaps = 3/35 8%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGA 37
            +TCGQVAS+L+PC+ YL+  GAVP G CC   K LS A
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCCX--KXLSSA 37

Sequence Alignment: 67. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 34.7 bits 146,  Expect = 0.0002
 Identities = 18/35 51%, Positives = 25/35 71%, Gaps = 0/35 0%
Query  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLS 35
            +TC  V++ ++PCLSYLK GG VP  CC  +K L+
Sbjct  2    LTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLN 36

Sequence Alignment: 68. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 32.1 bits 132,  Expect = 0.001
 Identities = 20/32 62%, Positives = 24/32 75%, Gaps = 2/32 6%
Query  1    ITCGQVASSLAPCLSYLKV-GGAVPDG-CCNDIK 32
            ITC QV+ SL PCL+YLK  GG+ P G CC  +K
Sbjct  2    ITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.