The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL
GMYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANA
LGFLKKAPLPECPEVLKELDMYDVPGSVTQN
Sequence Info Allergen Name Length Opt Bits Score E Value
ADK22842 Sal k 5.0101 151 1006 236.5 2.4e-64
A0A0K1SC24 Aca f 1 150 730 173.6 2e-45
A0A0K1SC10 Ama r 1.0101 168 729 173.3 2.8e-45
AAL07319 Che a 1 168 728 173.1 3.3e-45
AKV72167 Pro j 1.0101 150 722 171.8 7.2e-45
A0A0K1SC44 Koc s 1.0101 167 655 156.4 3.3e-40
CAA33854 Lyc e LAT52 161 424 103.8 2.2e-24
AAN32987 Phl p 11.0101 143 422 103.4 2.6e-24
X76396 Ole e 1.0103 145 397 97.7 1.4e-22
Q7M1X5 Lol p 11.0101 134 393 96.9 2.3e-22
AAQ08947 Fra e 1.0101 145 386 95.2 7.7e-22
AAV74343 Fra e 1.0102 145 385 95.0 9.1e-22
O82015 Lig v 1 145 382 94.3 1.5e-21
CAA73037 Ole e 1.0106 146 381 94.1 1.7e-21
AAQ83588 Fra e 1.0201 146 380 93.8 2e-21
CAA73036 Ole e 1.0107 146 379 93.6 2.4e-21
P19963 Ole e 1 145 378 93.4 2.7e-21
X76397 Ole e 1.0104 145 377 93.2 3.2e-21
X76395 Ole e 1.0102 145 375 92.7 4.4e-21
CAA54819 Lig v 1.0102 145 373 92.3 6e-21
CAA73038 Ole e 1.0105 146 368 91.1 1.3e-20
AAB32652 Ole e 1.0101 130 354 88.0 1e-19
P82242 Pla l 1 131 249 64.1 1.7e-12
CAC41635 Pla l 1.0103 131 239 61.8 8.1e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 236.5 bits 1006,  Expect = 2e-64
 Identities = 151/151 100%, Positives = 151/151 100%, Gaps = 0/151 0%
Query  1    KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL 60
            KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL
Sbjct  1    KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL 60
Query  61   GMYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANA 120
            GMYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANA
Sbjct  61   GMYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANA 120
Query  121  LGFLKKAPLPECPEVLKELDMYDVPGSVTQN 151
            LGFLKKAPLPECPEVLKELDMYDVPGSVTQN
Sbjct  121  LGFLKKAPLPECPEVLKELDMYDVPGSVTQN 151

Sequence Alignment: 2. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 173.6 bits 730,  Expect = 2e-45
 Identities = 105/136 77%, Positives = 124/136 91%, Gaps = 1/136 0%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +HV+G+VYCDTCR  FIT  S +MEGATV L+CRN+TAGT+TFKAEAVTDK+G Y+I VD
Sbjct  11   FHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVD 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
            GDHEDDIC+I LVKSP  +CSEIP+DVY++Q+AKV+LTSNNGEASDVR+ANALGF++K P
Sbjct  71   GDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSANALGFMRKEP 130
Query  129  LPECPEVLKE-LDMYDV 144
            LPECPEVLKE LDMYDV
Sbjct  131  LPECPEVLKEKLDMYDV 147

Sequence Alignment: 3. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 173.3 bits 729,  Expect = 3e-45
 Identities = 101/136 74%, Positives = 126/136 92%, Gaps = 0/136 0%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G+VYCDTCRIQF+TR+ST+MEGATV L+CRN+TAGT+TFKAEAVTDK+G Y+I V+
Sbjct  30   FHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 89
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
            GD EDDIC+I LVKSP  ECSE+ +DVY++Q+AKV+LTSNNGEASD+R+ANALGF++K P
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP 149
Query  129  LPECPEVLKELDMYDV 144
            L ECPEVLKELD+YDV
Sbjct  150  LEECPEVLKELDLYDV 165

Sequence Alignment: 4. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 173.1 bits 728,  Expect = 3e-45
 Identities = 103/138 74%, Positives = 126/138 91%, Gaps = 0/138 0%
Query  7    NLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIK 66
            N + V+GMVYCDTCRIQF+TR+ST+MEGATV L+CRN+TAGT+TFKAEAVTDK+G Y+I 
Sbjct  28   NHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 87
Query  67   VDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKK 126
            V+GD EDDIC+I LVKSP  ECSE+ +DVY++Q+AKV+LTSNNGEASD+R+ANALGF++K
Sbjct  88   VNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  127  APLPECPEVLKELDMYDV 144
             PL ECPEVLKELD+YDV
Sbjct  148  EPLKECPEVLKELDLYDV 165

Sequence Alignment: 5. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 171.8 bits 722,  Expect = 7e-45
 Identities = 103/136 75%, Positives = 126/136 92%, Gaps = 1/136 0%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G+VYCDTCRIQF+TRVST+MEGATV L+CRN+TAGT+TFKAEAVTDK+G Y+I V+
Sbjct  11   FHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
            GD EDDIC+I LVKSP  +CSEIP+DVY++Q+AKV+LTSNNGEASD+R+ANALGF++K P
Sbjct  71   GDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP 130
Query  129  LPECPEVLKE-LDMYDV 144
            L ECPEV KE LDMYDV
Sbjct  131  LKECPEVSKEPLDMYDV 147

Sequence Alignment: 6. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 156.4 bits 655,  Expect = 3e-40
 Identities = 94/135 69%, Positives = 118/135 87%, Gaps = 1/135 0%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G+VYCDTC     + V  M+EGATV L+CRN+TAGT+TFKAEAVTDK+G Y+I VD
Sbjct  30   FHIQGLVYCDTCPYPS-SYVLPMLEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVD 88
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
            GD EDDIC+I L+KSP  +CSE+ +DVY++Q+AKV+LTSNNGEASDVR+ANALGF++K P
Sbjct  89   GDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDVRSANALGFMRKEP 148
Query  129  LPECPEVLKELDMYDV 144
            L ECPEVLKELD+YDV
Sbjct  149  LEECPEVLKELDLYDV 164

Sequence Alignment: 7. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 103.8 bits 424,  Expect = 2e-24
 Identities = 63/132 47%, Positives = 89/132 67%, Gaps = 3/132 2%
Query  8    LYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKV 67
            ++ V+G VYCDTCR+QF T++S  +EGATV LQCRN++   ETF  E VTDK G Y + V
Sbjct  26   VFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTV 85
Query  68   DGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKA 127
            +GDHE+DIC++ +VKSP ++C E    V   + A++  + N G  + VR AN L F+K  
Sbjct  86   NGDHENDICEVTVVKSPREDCKE---SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAE 142
Query  128  PLPECPEVLKELDMY 142
             +  C E L EL ++
Sbjct  143  SVQGCKEALDELGLF 157

Sequence Alignment: 8. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 103.4 bits 422,  Expect = 3e-24
 Identities = 67/138 48%, Positives = 94/138 68%, Gaps = 8/138 5%
Query  1    KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL 60
            KG G    + V G VYCD CR  F T VS  ++GATV++ CR +  G   +KAEA TD L
Sbjct  2    KGPG----FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGL 57
Query  61   GMYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNG-EASDVRNAN 119
            G Y I++D DH+++IC++VL KSP   CSEI  + + ++A +V LTSNNG +   +R AN
Sbjct  58   GWYKIEIDQDHQEEICEVVLAKSPDTTCSEI--EEFRDRA-RVPLTSNNGIKQQGIRYAN 114
Query  120  ALGFLKKAPLPECPEVLKELDMYDVP 145
             + F++K PL EC  +L+  D+ D P
Sbjct  115  PIAFFRKEPLKECGGILQAYDLRDAP 140

Sequence Alignment: 9. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 97.7 bits 397,  Expect = 1e-22
 Identities = 55/131 41%, Positives = 86/131 65%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G VYCDTCR +FIT +S  + GA+V LQC++   G+ TF     T   G+Y++ ++
Sbjct  11   FHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIE 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+D+ C+I L+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  71   RDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTINPLGFFKKEA 127
Query  129  LPECPEVLKELDMY 142
            LP+CP+V+ +L MY
Sbjct  128  LPKCPQVFNKLGMY 141

Sequence Alignment: 10. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 96.9 bits 393,  Expect = 2e-22
 Identities = 64/130 49%, Positives = 89/130 68%, Gaps = 8/130 6%
Query  1    KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL 60
            KG G    + V G VYCD CR  F T VS  +EGATV++ CR +  G   +KAEA TDK 
Sbjct  2    KGPG----FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKD 57
Query  61   GMYTIKVDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNG-EASDVRNAN 119
            G Y I++D DH+++IC++VL KSP + CSEI    + ++A +V LTSN G +   +R AN
Sbjct  58   GWYKIEIDQDHQEEICEVVLAKSPDKSCSEIEE--FRDRA-RVPLTSNXGIKQQGIRYAN 114
Query  120  ALGFLKKAPLPECPEVLK 137
             + F++K PL EC  +L+
Sbjct  115  PIAFFRKEPLKECGGILQ 132

Sequence Alignment: 11. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 95.2 bits 386,  Expect = 8e-22
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 3/133 2%
Query  7    NLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIK 66
            +L++V+G VYCDTCR  FIT +S  ++GA V LQC++   G  TF     T   G+Y++ 
Sbjct  9    SLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMV 68
Query  67   VDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKK 126
            ++ DH+++ C+IVL+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK
Sbjct  69   IERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTINPLGFFKK 125
Query  127  APLPECPEVLKELDMY 142
              LP+CP+V  +L MY
Sbjct  126  EVLPKCPQVYNKLGMY 141

Sequence Alignment: 12. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 95.0 bits 385,  Expect = 9e-22
 Identities = 56/133 42%, Positives = 85/133 63%, Gaps = 3/133 2%
Query  7    NLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIK 66
            +L++V+G VYCDTCR  FIT +S  ++GA V LQC+    G  TF     T   G+Y++ 
Sbjct  9    SLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEGLYSMV 68
Query  67   VDGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKK 126
            ++ DH+++ C+IVL+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK
Sbjct  69   IERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTT---RTINPLGFFKK 125
Query  127  APLPECPEVLKELDMY 142
              LP+CP+V  +L MY
Sbjct  126  EALPKCPQVYNKLGMY 141

Sequence Alignment: 13. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 94.3 bits 382,  Expect = 1e-21
 Identities = 54/131 41%, Positives = 83/131 63%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            ++++G VYCDTCR +FIT +S  + GA V LQC++   G  TF     T   G+Y + ++
Sbjct  11   FYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEGLYNMLIE 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C EIP + + + + K  L + NG     R  N LGFLKK  
Sbjct  71   RDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTT---RTINPLGFLKKEV 127
Query  129  LPECPEVLKELDMY 142
            LP+CP+V+ +L MY
Sbjct  128  LPKCPQVFNKLGMY 141

Sequence Alignment: 14. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 94.1 bits 381,  Expect = 2e-21
 Identities = 54/131 41%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G VYCDTCR  FIT +S  + GA+V LQC++   G  TF     T   G+Y++ V+
Sbjct  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE 71
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C+EIP + +++ + K  L++ NG     R  N LGF KK  
Sbjct  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RTVNPLGFYKKEA 128
Query  129  LPECPEVLKELDMY 142
            LP+C +V  +L MY
Sbjct  129  LPKCAQVYNKLGMY 142

Sequence Alignment: 15. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 93.8 bits 380,  Expect = 2e-21
 Identities = 55/131 41%, Positives = 85/131 64%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G VYCDTCR +FIT++S  + GA+V LQCR+   G  TF     T   G+Y++ V+
Sbjct  12   FHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVE 71
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C+EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  72   RDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RTINPLGFFKKEA 128
Query  129  LPECPEVLKELDMY 142
            LP+C +V  +L MY
Sbjct  129  LPQCAQVYNKLGMY 142

Sequence Alignment: 16. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 93.6 bits 379,  Expect = 2e-21
 Identities = 55/131 41%, Positives = 83/131 63%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G VYCDTCR +FIT +S  + GA+V LQCR    G  TF     T   G+Y++ V+
Sbjct  12   FHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLVE 71
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C EIP + +++ + K  L + NG     R  N LGF+KK  
Sbjct  72   RDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEA 128
Query  129  LPECPEVLKELDMY 142
            LP+C +V  +L MY
Sbjct  129  LPKCAQVYNKLGMY 142

Sequence Alignment: 17. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 93.4 bits 378,  Expect = 3e-21
 Identities = 53/131 40%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G VYCDTCR  FIT +S  + GA++ LQC++   G  TF     T   G+Y++ V+
Sbjct  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C+EIP + +++ + K  L + NG     R  N LGF+KK  
Sbjct  71   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTVNPLGFFKKEA 127
Query  129  LPECPEVLKELDMY 142
            LP+C +V  +L MY
Sbjct  128  LPKCAQVYNKLGMY 141

Sequence Alignment: 18. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 93.2 bits 377,  Expect = 3e-21
 Identities = 54/131 41%, Positives = 83/131 63%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            ++V+G VYCDTCR +FIT  S  + GA V LQC++   G  TF     T   G+Y++ ++
Sbjct  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTINPLGFFKKEA 127
Query  129  LPECPEVLKELDMY 142
            LP+CP+V+ +L MY
Sbjct  128  LPKCPQVFNKLGMY 141

Sequence Alignment: 19. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 92.7 bits 375,  Expect = 4e-21
 Identities = 53/131 40%, Positives = 83/131 63%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G VYCDTCR  FIT +S  + GA++ LQC++   G  TF     T   G+Y++ V+
Sbjct  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C+EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  71   RDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTT---RTVNPLGFFKKEA 127
Query  129  LPECPEVLKELDMY 142
            LP+C +V  +L MY
Sbjct  128  LPKCAQVYNKLGMY 141

Sequence Alignment: 20. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 92.3 bits 373,  Expect = 6e-21
 Identities = 53/131 40%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            ++++G VYCDTCR +FIT +S  + GA V LQC++   G  TF     T   G+Y++ ++
Sbjct  11   FYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  71   RDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTT---RTINPLGFFKKEA 127
Query  129  LPECPEVLKELDMY 142
            LP+CP+V+ +L MY
Sbjct  128  LPKCPQVFNKLGMY 141

Sequence Alignment: 21. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 91.1 bits 368,  Expect = 1e-20
 Identities = 53/131 40%, Positives = 82/131 62%, Gaps = 3/131 2%
Query  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
            +H++G VYCDTCR  FIT +S  + GA+V LQC++   G  TF     T   G+Y++ V+
Sbjct  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE 71
Query  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
             DH+++ C+I L+ S  ++C+EIP + +++ + K  L + NG     R  N L F KK  
Sbjct  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLRFYKKEA 128
Query  129  LPECPEVLKELDMY 142
            LP+C +V  +L MY
Sbjct  129  LPKCAQVYNKLGMY 142

Sequence Alignment: 22. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 88.0 bits 354,  Expect = 1e-19
 Identities = 52/125 41%, Positives = 78/125 62%, Gaps = 3/125 2%
Query  15   VYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVDGDHEDD 74
            VYCDTCR  FIT +S  + GA+V LQC+    G  TF     T   G+Y++ V+ DH+++
Sbjct  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
Query  75   ICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAPLPECPE 134
             C+I L+ S  ++C+EIP + +++ + K  L + NG     R  N LGF+KK  LP+C +
Sbjct  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQ 118
Query  135  VLKELDMY 142
            V  +L MY
Sbjct  119  VYNKLGMY 126

Sequence Alignment: 23. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 64.1 bits 249,  Expect = 2e-12
 Identities = 46/121 38%, Positives = 64/121 52%, Gaps = 5/121 4%
Query  9    YHVKGMVYCDTCRIQ-FITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKV 67
            +HV+G VYC+ C  + +I  +S  M GA V L C++ +     +     TD+ G+Y + V
Sbjct  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETDQDGVYRLPV 67
Query  68   DGDHEDDICQIVLVKSPGQECSEIPNDVYSE-QAAKVTLTSNNGEASDVRNANALGFLKK 126
             G HED  C+I LVKS   +CSEIP       Q +KV L+ N       R+   L F  K
Sbjct  68   VGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAK 125
Query  127  APLPEC 132
               P C
Sbjct  126  TDAPGC 131

Sequence Alignment: 24. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 61.8 bits 239,  Expect = 8e-12
 Identities = 45/121 37%, Positives = 63/121 52%, Gaps = 5/121 4%
Query  9    YHVKGMVYCDTCRIQ-FITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKV 67
            +HV+G VYC+ C  + +I  +S  M GA V L C++ +     +     T + G+Y + V
Sbjct  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRLPV 67
Query  68   DGDHEDDICQIVLVKSPGQECSEIPNDVYSE-QAAKVTLTSNNGEASDVRNANALGFLKK 126
             G HED  C+I LVKS   +CSEIP       Q +KV L+ N       R+   L F  K
Sbjct  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAK 125
Query  127  APLPEC 132
               P C
Sbjct  126  TDAPGC 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.