The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG
VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF
QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG
NPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELR
VIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG
RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGN
RVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEV
LANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
Sequence Info Allergen Name Length Opt Bits Score E Value
AAN76862 Ana o 2 457 3099 581.0 4.2e-167
EU410073 Pis v 5.0101 473 2217 418.1 4.8e-118
DQ631676 Pis v 2.0101 496 1513 288.0 7.2e-79
DQ631677 Pis v 2.0201 472 1442 275.0 5.8e-75
Q9AUD2 Ses i 7.0101 497 1430 272.7 3e-74
P13744 Cuc ma 4.0101 480 1426 272.0 4.6e-74
AAO38859 Ber e 2 465 1351 258.2 6.5e-70
QYS16039 Zan b 2.03 389 1319 252.5 2.8e-68
QYU76044 Zan b 2.02 383 1276 244.6 6.6e-66
QYU76045 Zan b 2.0101 389 1258 241.3 6.8e-65
QYU76046 Zan b 2.0102 388 1251 240.0 1.7e-64
Q2TLW0 Sin a 2.0101 510 1114 214.3 1.2e-56
AAL73404 Cor a 9 515 984 190.3 2e-49
BAA21760 Fag e 1 504 923 179.1 4.7e-46
ABW86978 Car i 4.0101 505 920 178.5 6.9e-46
Q2TPW5 Jug r 4.0101 507 920 178.5 6.9e-46
A0A1L6K371 Jug n 4.0101 510 917 177.9 1e-45
P09802 Gos h 3 509 862 167.8 1.2e-42
3EHK_A Pru du 6 531 855 166.4 3.1e-42
Q9XHP0 Ses i 6.0101 459 851 165.9 3.9e-42
ADN39440 Pru du 6.0101 551 852 165.8 4.9e-42
P04405 Gly m 6.0201 485 789 154.4 1.2e-38
CAA68460 Gly m glycinin G2 485 789 154.4 1.2e-38
P11828 Gly m 6.0301 481 788 154.2 1.4e-38
Q9XFM4 Fag e 1 538 771 150.9 1.5e-37
AAA33966 Gly m glycinin G1 495 767 150.3 2.1e-37
P04776 Gly m 6.0101 495 767 150.3 2.1e-37
BAA21758 Fag e 1 565 764 149.6 4e-37
ADN39441 Pru du 6.0201 504 717 141.0 1.3e-34
P09800 Gos h 4 516 687 135.5 6.4e-33
O82580 Ara h 3 507 665 131.4 1e-31
AAC63045 Ara h 3 510 665 131.4 1.1e-31
Q9SB11 Gly m 6.0401 563 613 121.7 9.9e-29
AAD47382 Ara h 4 530 608 120.8 1.7e-28
Q7GC77 Gly m 6.0501 517 588 117.2 2.1e-27
A0A0S3B0K0 Coc n 1.0101 490 185 42.8 4.7e-05
AAF18269 Jug r 2 593 165 38.9 0.00088
AAM54366 Jug n 2 481 160 38.2 0.0011
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 581.0 bits 3099,  Expect = 4e-167
 Identities = 457/457 100%, Positives = 457/457 100%, Gaps = 0/457 0%
Query  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
            LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG
Sbjct  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
Query  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF 120
            VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF
Sbjct  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF 120
Query  121  QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG 180
            QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG
Sbjct  121  QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG 180
Query  181  NPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELR 240
            NPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELR
Sbjct  181  NPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELR 240
Query  241  VIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG 300
            VIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG
Sbjct  241  VIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG 300
Query  301  RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGN 360
            RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGN
Sbjct  301  RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGN 360
Query  361  RVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEV 420
            RVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEV
Sbjct  361  RVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEV 420
Query  421  LANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA 457
            LANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
Sbjct  421  LANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA 457

Sequence Alignment: 2. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 418.1 bits 2217,  Expect = 5e-118
 Identities = 368/455 80%, Positives = 418/455 91%, Gaps = 12/455 2%
Query  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
            LSVC+LILFHGCLASRQ+ QQQ+ECQID+LDALEPDNRVEYEAG VE WDPNHEQFRCAG
Sbjct  9    LSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAG 68
Query  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF 120
            VA+ RHTIQPNGL LP+YSNAP L+Y+V+GEGMTG   PGCPETYQAPQQG+Q+GQS RF
Sbjct  69   VAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHGQSSRF 128
Query  121  QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG 180
            QD+HQKI+RFR+GDIIA+PAGVA+WCYNEGNSPVVTVTLLDVSNSQNQLD  PRKF+LAG
Sbjct  129  QDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAG 188
Query  181  NPKDVFQQQQQHQSRGR---------NLFSGFDTELLAEAFQVDERLIKQLKSE-DNRGG 230
            NP+D FQQQQQ+QSRGR         N+F GFDT++LAE FQV++ L+KQL++E DNRG 
Sbjct  189  NPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGA 248
Query  231  IVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPA 290
            IVKVK D L+VIRP R QSERG ESEEESE E+ R G RDNG+EETICTM+LKENI+DP+
Sbjct  249  IVKVKGD-LQVIRPPRRQSERGFESEEESEYERGRRG-RDNGLEETICTMKLKENIHDPS 306
Query  291  RADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG 350
            R+DIYTPEVGR+T+LNSLNLPILKWLQLS E+GVL  NAL++PHWN+N+HSI+YGCKG  
Sbjct  307  RSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNA 366
Query  351  QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRT 410
            QVQVVDNFGN VFDGEV EGQ++VVPQNFAVVKRAR +RFEWISFKTNDRAM SPLAG T
Sbjct  367  QVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGST 426
Query  411  SVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA 457
            SVL  MPEEVLANAFQISREDARKIKFNN+Q TL+SG+SS++MRDDA
Sbjct  427  SVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA 473

Sequence Alignment: 3. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 288.0 bits 1513,  Expect = 7e-79
 Identities = 243/448 54%, Positives = 335/448 74%, Gaps = 35/448 7%
Query  1    LSVCFLILFHGCLA-------SRQEWQQQ---DECQIDRLDALEPDNRVEYEAGTVEAWD 50
            +S+ FL+LFH  +A       S+Q  QQQ    +CQI  L+ALEP  R+E EAG  E WD
Sbjct  9    FSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWD 68
Query  51   PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQ 110
             N EQ++CA VA+ RHTIQ  GLL+P Y NAP+L+YVVQG G+ G  +PGCPET+Q   Q
Sbjct  69   QNEEQLQCANVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCPETFQEESQ 128
Query  111  GRQQGQ-SGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQL 169
             R + + S +  ++HQK+R  + GD+IA+PAGVAHW YN G S +V V L DV NS+NQL
Sbjct  129  SRSRSERSQQSGEQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQL 188
Query  170  DRTPRKFHLAGNPKDVFQ--------QQQQHQSRGR------NLFSGFDTELLAEAFQVD 215
            D+  RKF L G+P+   Q         Q Q   RG+      N++S FD E+LA++F +D
Sbjct  189  DQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNILSAFDEEILAQSFNID 248
Query  216  ERLIKQLKSED-NRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIE 274
             +L ++L+ E   RG IV+V++D L V+ P R + E+  E EEE E   RR  QR NG+E
Sbjct  249  TQLARRLQKEKRQRGIIVRVQED-LEVLSPHRQEQEQ--EYEEERE---RR--QR-NGLE 299
Query  275  ETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPH 334
            ET CTM LK NINDP+RAD+Y P  GR++++N+LNLPIL++LQLS +KGVL+++A++ PH
Sbjct  300  ETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAKKGVLHRDAILAPH 359
Query  335  WNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWIS 394
            WN+N+HSI+Y  +G G++Q+V   G  VFD E+REGQ++VVPQNFAVVKRA  ++FEW+S
Sbjct  360  WNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDKFEWVS 419
Query  395  FKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMR 454
            FKTN  + TS LAGR SV+  +P +V+ N+F ISREDAR++K +  +TT+ +  SS + +
Sbjct  420  FKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARRLKESRSETTIFAPGSSSQRK 479
Query  455  DDA 457
              +
Sbjct  480  SQS 482

Sequence Alignment: 4. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 275.0 bits 1442,  Expect = 6e-75
 Identities = 243/437 55%, Positives = 326/437 74%, Gaps = 45/437 10%
Query  1    LSVCFLILFHGCLA-------SRQEWQQQ---DECQIDRLDALEPDNRVEYEAGTVEAWD 50
            +S+ FL+LFH  +A       S+Q  QQQ    +CQI  L+ALEP  R+E EAG  E WD
Sbjct  9    FSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWD 68
Query  51   PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQ 110
             N EQ++CA VA+ RHTIQ  GLL+P Y+NAP+L+YVVQG G+ G  +PGCPET+Q   Q
Sbjct  69   QNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCPETFQEESQ 128
Query  111  GRQQGQSGRFQ------DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSN 164
             + + Q  R +      ++HQK+R  R GDIIA+PAGVAHW YN G S +V V L DV N
Sbjct  129  SQSRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGN 188
Query  165  SQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGR---------NLFSGFDTELLAEAFQVD 215
            S+NQLD+  RKF L G+P+   Q   Q  S+ R         N++S FD E+LA++F +D
Sbjct  189  SENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQSFNID 248
Query  216  ERLIKQLKSEDN-RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIE 274
             +L+K+L+ E+  RG IV+VK+D L+V+ P R + E                   DNG+E
Sbjct  249  TQLVKKLQREEKQRGIIVRVKED-LQVLSPQRQEKEYS-----------------DNGLE 290
Query  275  ETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPH 334
            ET CTM LK NINDP+RAD+Y P  GR+T++N+LNLPIL++LQLSVEKGVLY+NA++ PH
Sbjct  291  ETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPH 350
Query  335  WNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWIS 394
            WN+N+HSI+Y  +G G++Q+V   G  VFD E+REGQ++VVPQNFAVVKRA  + FEW+S
Sbjct  351  WNMNAHSIVYITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGFEWVS 410
Query  395  FKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFN-NQQTTLTSGESSHHM 453
            FKTN  A  S LAGR SV+ G+P +V+ N+F ISREDA  +K + ++ T +  G  S+  
Sbjct  411  FKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQ 470
Query  454  RD 455
            R+
Sbjct  471  RN 472

Sequence Alignment: 5. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 272.7 bits 1430,  Expect = 3e-74
 Identities = 233/421 55%, Positives = 321/421 76%, Gaps = 33/421 7%
Query  13   LASRQE--WQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQP 70
            L S+Q+   Q + +C+++RL A EP  R E EAG  E WD N++QF CAGVA VR+ IQP
Sbjct  35   LQSQQQHKLQARTDCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQP 94
Query  71   NGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRF 130
             GLLLP+Y+NAPQL+YVV+G G+ G   PGC ET++   Q RQ  +  RF DRHQK+R+F
Sbjct  95   RGLLLPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRR-RFMDRHQKVRQF 153
Query  131  RRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQ--- 187
            R+GDI+A+PAG+  W YN G  P++TV LLD  N+ NQLD+T R F LAGNP+   Q   
Sbjct  154  RQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGNPQGGRQSYF 213
Query  188  ---QQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDN-RGGIVKVKDDELRVIR 243
               Q +++Q   +N+F+GFD E+LA+AF VD +  ++LK +D+ RG IV+   + L ++ 
Sbjct  214  GRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRA--ERLDIVL 271
Query  244  PSRSQSERGSESEEESEDEKRRWGQRD-----NGIEETICTMRLKENINDPARADIYTPE 298
            P               E+E+ RW +RD     NG+EET+CT +L+EN+++PARAD+Y P 
Sbjct  272  P--------------GEEEEERW-ERDPYSGANGLEETLCTAKLRENLDEPARADVYNPH 316
Query  299  VGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNF 358
             GR+++LNSL LP+L WL+LS EKGVLY+N LV PHWNLN+HSIIY  +G G+ QVV + 
Sbjct  317  GGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHT 376
Query  359  GNRVFDGEVREGQMLVVPQNFAVVKRA-REERFEWISFKTNDRAMTSPLAGRTSVLGGMP 417
            G  VFDG VREGQ+++VPQN+ V KRA ++E +EWISFKTND AMTS LAGR S +  MP
Sbjct  377  GRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMP 436
Query  418  EEVLANAFQISREDARKIKFNNQQTTLTSGESSH 451
            EEV+  A+Q+SR++AR++K+N +++ + S  S +
Sbjct  437  EEVVMTAYQVSRDEARRLKYNREESRVFSSTSRY 470

Sequence Alignment: 6. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 272.0 bits 1426,  Expect = 5e-74
 Identities = 221/445 49%, Positives = 319/445 71%, Gaps = 34/445 7%
Query  3    VCFLILFHGCLASRQE-----------WQQQD-----ECQIDRLDALEPDNRVEYEAGTV 46
            +C+ ++ +GCL+  ++           WQQ+       C+++ L A +P  R E EA   
Sbjct  10   LCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACRLENLRAQDPVRRAEAEAIFT 69
Query  47   EAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQ 106
            E WD ++++F+CAGV ++RHTI+P GLLLP +SNAP+LI+V QG G+ GI+ PGC ETYQ
Sbjct  70   EVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKLIFVAQGFGIRGIAIPGCAETYQ 129
Query  107  APQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQ 166
               + R Q     F+D+HQKIR FR GD++ +PAGV+HW YN G S +V + + D  N  
Sbjct  130  TDLR-RSQSAGSAFKDQHQKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVA 188
Query  167  NQLDRTPRKFHLAGNPKDV------FQQQQQHQSRGR---NLFSGFDTELLAEAFQVDER 217
            NQ+D   RKF+LAG P+ V      +++  +  S G    N+FSGF  E+L EAFQ+D  
Sbjct  189  NQIDPYLRKFYLAGRPEQVERGVEEWERSSRKGSSGEKSGNIFSGFADEFLEEAFQIDGG 248
Query  218  LIKQLKSEDN-RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEET 276
            L+++LK ED+ R  IV+V D+++ V+ P + + ER      ESE E       +NG+EET
Sbjct  249  LVRKLKGEDDERDRIVQV-DEDFEVLLPEKDEEERSRGRYIESESES------ENGLEET 301
Query  277  ICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWN 336
            ICT+RLK+NI    RAD++ P  GR++T N   LPIL+ ++LS E+GVLY NA+V PH+ 
Sbjct  302  ICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYT 361
Query  337  LNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFK 396
            +NSHS++Y  +G  +VQVVDNFG  VFDGEVREGQ+L++PQNF V+KRA +  FEWI+FK
Sbjct  362  VNSHSVMYATRGNARVQVVDNFGQSVFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFK 421
Query  397  TNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRD 455
            TND A+T+ LAGR S +  +P  VL+N ++ISRE+A+++K+  Q+  + S   S+  R+
Sbjct  422  TNDNAITNLLAGRVSQMRMLPLGVLSNMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE 480

Sequence Alignment: 7. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 258.2 bits 1351,  Expect = 6e-70
 Identities = 230/445 51%, Positives = 317/445 71%, Gaps = 26/445 5%
Query  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
            LS+  ++LFH CLA   E ++  EC+I RL A EP  R+E EAG  E WD   +QFRCAG
Sbjct  7    LSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAG 66
Query  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQ--G--RQQGQ 116
            VA +R+TI+P GLLLP Y+NAP+L YV QG G+ G+  PGCPET+Q+  Q  G   Q+ +
Sbjct  67   VAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQEEE 126
Query  117  SGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKF 176
             GRFQD+HQK+  +++GDIIAIPAGVA WCYN+G+  +VTV +   ++  NQLD+ PR F
Sbjct  127  RGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHF 186
Query  177  HLAGNPKDVFQQQ-QQHQSRG------RNLFSGFDTELLAEA--FQVDERLIKQLKSEDN 227
             LAGN +   +Q+ +++  RG       N+F GF+ E LA+   F +D    ++++ ED+
Sbjct  187  FLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDD 246
Query  228  -RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENI 286
             RG IV+V+   L+VIRP R +        EE E ++   G   NG+EETIC+  + +NI
Sbjct  247  QRGHIVRVEQG-LKVIRPPRIR--------EELEQQE---GGGYNGLEETICSATFIQNI 294
Query  287  NDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGC 346
            ++PA AD Y P  GRLTT+NSL +PIL +LQLS  KGVLY+NA++ P W LN++S++Y  
Sbjct  295  DNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAV 354
Query  347  KGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPL 406
            +G+ +VQ+VD+ G  VFD  +REGQM+VVPQNF VVK+A    FEW+ F TND A+ S  
Sbjct  355  RGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTA 414
Query  407  AGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA 457
            AGRTS L G+P  VLANA+++S+E+AR+IK+N  +  L    S    R  A
Sbjct  415  AGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465

Sequence Alignment: 8. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 252.5 bits 1319,  Expect = 3e-68
 Identities = 218/371 58%, Positives = 275/371 74%, Gaps = 29/371 7%
Query  42   EAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGC 101
            EAG  E WD N++Q++CA VA+ RH IQ NGLL+P Y+N P+L YVVQG G+ G   PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  102  PETYQAPQQGRQQ----GQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTV 157
            PETYQ  QQ +Q      +  R QD+HQK+R+ R GDIIA+P G AHW YN G S +V V
Sbjct  61   PETYQDEQQQQQSFSYPSEGSRSQDQHQKVRQIREGDIIALPTGSAHWIYNNGQSQLVLV 120
Query  158  TLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQS--------------RGRNLFSGF 203
             L+DV NS NQLD+  RKF+L GNP+  +Q   Q Q               R  N+F+GF
Sbjct  121  ALVDVGNSDNQLDQYFRKFYLGGNPQPQLQGTSQSQGGRYQERLGGGDSSRRSANIFNGF 180
Query  204  DTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEK 263
            D  LLAEAF V+  LI++L+    + GI+   ++E+RV+ P     +RG ES E      
Sbjct  181  DERLLAEAFNVNPELIRRLQRPQMQRGIIIRVEEEFRVLTP-----QRGQESYESDP--- 232
Query  264  RRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKG 323
              +G R NG+EET+CTMRL+ NINDP+RAD+Y P  GR+TT+N LNLP+L+WLQLS EKG
Sbjct  233  --YG-RYNGVEETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKG 289
Query  324  VLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVK 383
             LYKNAL  PHWNLN+HSI+Y  +G G+VQ+V   GN VFDGE+REGQ++VVPQ FAVVK
Sbjct  290  NLYKNALTAPHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVK 349
Query  384  RAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLAN 423
            RA    +EWISFKTND AMT+ LAGR SVL  +P +V+ N
Sbjct  350  RASNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLDVIQN 389

Sequence Alignment: 9. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 244.6 bits 1276,  Expect = 7e-66
 Identities = 211/367 57%, Positives = 274/367 74%, Gaps = 28/367 7%
Query  42   EAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGC 101
            EAG  E WD N+ Q++CA VA+ RH IQ NGLL+P Y+N  +L YVVQG G+ G  +PGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  102  PETYQAPQQGRQ-QGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLL 160
            PETYQ  QQ +  Q Q  R QD+HQK+R+ R GDIIA+P G AHW YN G S +V V L+
Sbjct  61   PETYQDQQQQQSYQSQGSRSQDQHQKVRQIREGDIIALPTGAAHWIYNNGGSQLVLVALV 120
Query  161  DVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQ--------------SRGRNLFSGFDTE 206
            DV NS NQLD+  RKF+L GNP+  +Q   Q Q              SR  N+F+GFD  
Sbjct  121  DVGNSDNQLDQYFRKFYLGGNPQPELQGTSQRQQGGGYQGSQGGGGGSRRGNMFNGFDER 180
Query  207  LLAEAFQVDERLIKQLKSED-NRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRR 265
            LLA+AF V+  LI++L+     RG IV+V ++E+RV+ P     +RG E E+E E +   
Sbjct  181  LLADAFNVNPELIRRLQRPQMQRGIIVRV-EEEFRVLSP-----QRGQEQEQEQEQDC-- 232
Query  266  WGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVL 325
                DNG+EET CTM+L+ NINDP+RAD+Y P  GR+TT+N +NLP+L+WLQLS EKG L
Sbjct  233  ----DNGVEETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNL 288
Query  326  YKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRA 385
            Y+NAL  PHWNLN HSI+Y  +G G++Q+V   GN VF+GE+REGQ++V+PQ FAVVK+A
Sbjct  289  YQNALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKA 348
Query  386  REERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEV 420
                +EWI+FKTND AMT+ LAGR SV+  +P +V
Sbjct  349  SNRGLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 10. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 241.3 bits 1258,  Expect = 7e-65
 Identities = 209/371 56%, Positives = 281/371 75%, Gaps = 29/371 7%
Query  42   EAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGC 101
            EAG  E WD N+EQ++CA VA+ RH IQ  GLL+P Y+N  +L YVVQG G+ G  +PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  102  PETYQAPQQGR-QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLL 160
            PETYQ  QQ + +Q +  R QD+HQK+R++R GDI+A+P G AHW YN G S +V V L+
Sbjct  61   PETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAVPTGSAHWIYNNGQSQLVLVALV 120
Query  161  DVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQ----------------SRGRNLFSGFD 204
            DV NS NQLD+  RKF++ GNP+  +Q   Q Q                S G N+F+GFD
Sbjct  121  DVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGSSRRSSGGNIFNGFD 180
Query  205  TELLAEAFQVDERLIKQL-KSEDNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEK 263
              LLA+AF V+  +I++L K +  RG IV+V ++EL V+RP R Q       E+E E E 
Sbjct  181  ERLLADAFNVNPEIIRRLQKPQLPRGIIVRV-EEELEVLRPQRGQ-------EQEQEQEF 232
Query  264  RRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKG 323
            R  G RDNG+EET CT++LK NIN+P+ AD+Y P  GR++T+NS+NLP+L+W+QLS EKG
Sbjct  233  R--G-RDNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKG 289
Query  324  VLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVK 383
             LY+NA + PHWNLNSHS++Y  +G G+VQ+V   GN V+DG+++EGQ++VVPQ +AV+K
Sbjct  290  NLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLK 349
Query  384  RAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLAN 423
            RA  + +EWISFKTND A TS LAGR SV+  +P +V+ N
Sbjct  350  RASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 11. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 240.0 bits 1251,  Expect = 2e-64
 Identities = 208/370 56%, Positives = 282/370 76%, Gaps = 30/370 8%
Query  42   EAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGC 101
            EAG  E WD N+EQ++CA VA+ RH IQ  GLL+P Y+N  +L YVVQG G+ G  +PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  102  PETYQAPQQGR-QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLL 160
            PETYQ  QQ + +Q +  R QD+HQK+R++R GDI+A+P G AHW YN G S +V V L+
Sbjct  61   PETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAMPTGSAHWIYNNGQSQLVLVALV 120
Query  161  DVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQ----------------SRGRNLFSGFD 204
            DV NS NQLD+  RKF++ GNP+  +Q   Q Q                S G N+F+GFD
Sbjct  121  DVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGGSRRSSGGNIFNGFD 180
Query  205  TELLAEAFQVDERLIKQL-KSEDNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEK 263
              LLA+AF V+  +I++L K +  RG IV+V ++EL V+RP     +RG   E+E E E 
Sbjct  181  ERLLADAFNVNPEIIRRLQKPQLPRGIIVRV-EEELEVLRP-----QRG---EQEQEQEF 231
Query  264  RRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKG 323
            R  G RDNG+EET CT++LK NIN+P+ AD+Y P  GR++T+NS+NLP+L+W+QLS EKG
Sbjct  232  R--G-RDNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKG 288
Query  324  VLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVK 383
             LY+NA + PHWNLNSHS++Y  +G G+VQ+V   GN V+DG+++EGQ++VVPQ +AV+K
Sbjct  289  NLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLK 348
Query  384  RAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLAN 423
            +A  + +EWISFKTND A TS LAGR SV+  +P +V+ N
Sbjct  349  KASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 12. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 214.3 bits 1114,  Expect = 1e-56
 Identities = 223/443 50%, Positives = 321/443 72%, Gaps = 55/443 12%
Query  2    SVCFLILFHGCLASRQEW----QQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFR 57
            +V  L++++GCLA RQ      Q +D C +D LD L+P   ++ EAG VE WD NH Q R
Sbjct  11   TVGVLLVLNGCLA-RQSLGVPPQVKDACNLDNLDVLQPTEVIKSEAGQVEYWDHNHPQIR 69
Query  58   CAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQ--AP---QQGR 112
            CAGV++ R  IQ  GL LP + ++P + YVVQG G++G   PGC ET+    P   QQG+
Sbjct  70   CAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQGQ 129
Query  113  QQGQSGR-------------------------------------FQDRHQKIRRFRRGDI 135
            QQGQ G+                                     F+D HQK+   R GD 
Sbjct  130  QQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDA 189
Query  136  IAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSR 195
            IA+  G A+W YN G+ P++ V+L+D++N QNQLDR PR F LAGN +    QQQQ+Q +
Sbjct  190  IAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGSSQQQQQQQQ 249
Query  196  GRNLFSGFDTELLAEAFQVDERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE 254
              N++SGFD ++LA+A+++D RL ++L+++ D RG IV+VK   ++V+RP   Q+    E
Sbjct  250  --NILSGFDPQVLAQALKIDVRLAQELQNQQDKRGNIVRVKGP-FQVVRPPLRQAY---E 303
Query  255  SEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILK 314
            SE+           +DNG+EETIC+MR  ENI+DPARADIY P +GR+T++NS  LPIL+
Sbjct  304  SEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRVTSVNSYTLPILQ 363
Query  315  WLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLV 374
            +++LS  +G+L  +A+VLP +N+N++ I+Y  +G+ ++QVV++ G  V+D +V++GQ++V
Sbjct  364  YIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQLVV 423
Query  375  VPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARK 434
            +PQ FA V +++   FEWISFKTN  AM S LAGRTS L  +P EV+ NA+QIS E+ARK
Sbjct  424  IPQGFAYVVQSQNN-FEWISFKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEARK 482
Query  435  IKFNNQQTTLTSGESSHH 452
            IKFN  +TTLT     ++
Sbjct  483  IKFNTLETTLTRARGGQQ 500

Sequence Alignment: 13. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 190.3 bits 984,  Expect = 2e-49
 Identities = 276/453 60%, Positives = 354/453 78%, Gaps = 43/453 9%
Query  1    LSVCFLILFHGCLA-----SRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQ 55
            +S+C+L+LF+GCL       RQ+ +   EC +DRL+ALEP NR+E EA  +E+WD N +Q
Sbjct  9    FSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQ 68
Query  56   FRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQG 115
            F+CAGVA++R TI+PNGLLLPQYSNAP+LIY+ +G G+TG+ +PGCPET++ PQQ  QQG
Sbjct  69   FQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQG 128
Query  116  Q------SGRF-QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQ 168
            Q      S R  QDRHQKIR FR GDIIA+PAGVAHWCYN+G+SPVVTV+LL  +N  NQ
Sbjct  129  QRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQ 188
Query  169  LDRTPRKFHLAGNPKDVFQQQ-----------QQH----------QSRGRNLFSGFDTEL 207
            LD  PR F+LAGNP D  Q+Q           QQH          Q  G N+FSGFD E+
Sbjct  189  LDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEF 248
Query  208  LAEAFQVDERLIKQLKS-EDNRGGIVKVKDDELRVIRPSRSQSE--RGSESEEESEDEK- 263
            LA+AF VD    ++L+S +D R  IVKV +  L+V+RP RS+ E  R    E ESE E+ 
Sbjct  249  LADAFNVDVDTARRLQSNQDKRRNIVKV-EGRLQVVRPERSRQEWERQERQERESEQERE 307
Query  264  --RRWGQRD---NGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQL 318
              RR G R    NG EETIC++RL+ENI   +RADIYT +VGR+ T+NS  LP+L+WLQL
Sbjct  308  RQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQL 367
Query  319  SVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQN 378
            S E+G L +  L +PHWNLN+HS++Y  +G+ +VQVVD+ GN VFD E+R+GQ+L +PQN
Sbjct  368  SAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQN 427
Query  379  FAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFN 438
            FAV KRA  E FEW++FKTND A  SPLAGRTS +  +P++VLANAFQISRE+AR++K+N
Sbjct  428  FAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYN 487
Query  439  NQQTTLTSGESSHHMR 454
             Q+TTL     S   R
Sbjct  488  RQETTLVRSSRSSSER 503

Sequence Alignment: 14. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 179.1 bits 923,  Expect = 5e-46
 Identities = 207/418 49%, Positives = 285/418 68%, Gaps = 37/418 8%
Query  16   RQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLL 75
            RQ+ Q Q +C I RL A EP  RV  EAG  E WD +  +FRC G   VR  IQP GLLL
Sbjct  37   RQQHQFQHQCDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLL 96
Query  76   PQYSNAPQLIYVVQGEGMTGISYPGCPETYQA------PQ--QGRQQGQSGRFQ-----D 122
            P YSNAP + +V QG G+ G+  PGCPET+Q+      PQ  +GR+  QS   +     D
Sbjct  97   PSYSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEEESSRGD 156
Query  123  RHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG-N 181
            +HQKI R R GD+I  PAGV +W +N+GN  +++VTLLD ++ + QLD   R F LAG +
Sbjct  157  QHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQS 216
Query  182  PKDVFQQQQQHQSR---------GRNLFSGFDTELLAEAFQ-VDERLIKQLKSE-DNRGG 230
             ++  ++    QSR         G N++SGF  E+L E F+ VD   I +L+ E D RG 
Sbjct  217  QRETREEGSDRQSRESDDDEALLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGF 276
Query  231  IVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQ----RDNGIEETICTMRLKENI 286
            IV+ +D +LRV  P      +  E E E E   RR GQ    R NG+E+  C ++++ N 
Sbjct  277  IVQAQDLKLRV--P------QDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNF 328
Query  287  NDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGC 346
            N P    ++ P  GR+ T+NS +LPIL++LQLS +  VLYKNA++ P WNLN+HS +Y  
Sbjct  329  NTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVT 388
Query  347  KGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPL 406
            +G+G+VQVV + G  VFD +V+ GQ+LVVPQ FAVV +A  E +EW+ +K +  A+TSP+
Sbjct  389  RGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPI 448
Query  407  AGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQ 441
             GRTSVL  +P EVLAN++ IS ++A K+K   Q+
Sbjct  449  GGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQE 483

Sequence Alignment: 15. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 178.5 bits 920,  Expect = 7e-46
 Identities = 290/447 64%, Positives = 366/447 81%, Gaps = 37/447 8%
Query  3    VCFLI--LFHGCLASRQEWQQQD--ECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
            +C++I  LF+GCLA     QQ+   +CQ++RLDALEP NR+E EAG +E+WDPNH+Q++C
Sbjct  11   LCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIESWDPNHQQLQC 70
Query  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSG 118
            AGVA+VR TI+PNGLLLP+YSNAPQL+Y+ +G G+TG+ +PGCPET++  Q+  QQGQ  
Sbjct  71   AGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQSQQGQRR 130
Query  119  RFQ-DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFH 177
             FQ DRHQKIR FR GDIIA PAGVAHWCYN+G+SPVV + LLD  N+ NQLD+ PR F+
Sbjct  131  EFQQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRNFY 190
Query  178  LAGNPKDVF----QQ-------QQQHQSR-----------GRNLFSGFDTELLAEAFQVD 215
            LAGNP D F    QQ       QQQHQ R           G N+FSGFD E+LA+AF VD
Sbjct  191  LAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSGFDAEFLADAFNVD 250
Query  216  ERLIKQLKSE-DNRGGIVKVKDDELRVIRP--SRSQSE----RGSESEEESEDEKR---R 265
                ++L+SE D+RG IV+V+  +L+VIRP  SR + E    +  E E ESE E+R   R
Sbjct  251  TETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEERKERERERESESERRQSRR 310
Query  266  WGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVL 325
             G+ DNG+EETICT+ L+ENI DP+RADIYT E GR++T+NS NLPIL+WLQLS E+G L
Sbjct  311  GGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSHNLPILRWLQLSAERGAL 370
Query  326  YKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRA 385
            Y +AL +PHWNLN+HS++Y  +G+ +VQVVDNFG  VFD E+REGQ+L +PQNFAVVKRA
Sbjct  371  YSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRA 430
Query  386  REERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLT 445
            R+E FEW+SFKTN+ AM SPLAGRTS +  +PEEVL NAFQI REDAR++KFN Q++TL 
Sbjct  431  RDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRLKFNRQESTLV 490
Query  446  SGES 449
               S
Sbjct  491  RSRS 494

Sequence Alignment: 16. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 178.5 bits 920,  Expect = 7e-46
 Identities = 289/446 64%, Positives = 363/446 81%, Gaps = 37/446 8%
Query  5    FLI--LFHGCLASRQEWQQQD--ECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
            FLI  LF+GCLA     QQQ   +CQ++RLDALEP NR+E EAG +E+WDPN++QF+CAG
Sbjct  12   FLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRIEAEAGVIESWDPNNQQFQCAG 71
Query  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF 120
            VA+VR TI+PNGLLLPQYSNAPQL+Y+ +G G+TG+ +PGCPET++  Q+  QQGQS  F
Sbjct  72   VAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQSQQGQSREF 131
Query  121  Q-DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLA 179
            Q DRHQKIR FR GDIIA PAGVAHW YN+G++PVV ++LLD +N+ NQLD+ PR F+LA
Sbjct  132  QQDRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYLA 191
Query  180  GNPKDVF----QQ-------QQQHQSR-----------GRNLFSGFDTELLAEAFQVDER 217
            GNP D F    QQ       QQQ Q R           G N+FSGFD ++LA+AF VD  
Sbjct  192  GNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGFDADFLADAFNVDTE 251
Query  218  LIKQLKSE-DNRGGIVKVKDDELRVIRP--SRSQSERGS----ESEEESEDEKR---RWG 267
              ++L+SE D+R  IV+V+  +L+VIRP  SR + ER      E E ESE E+R   R G
Sbjct  252  TARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERERESESERRQSRRGG 311
Query  268  QRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYK 327
            + DNG+EETICT+RL+ENI DP+RADIYT E GR++T+NS  LP+L+WLQLS E+G LY 
Sbjct  312  RDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLPVLRWLQLSAERGALYS 371
Query  328  NALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRARE 387
            +AL +PHWNLN+HS++Y  +G+ +VQVVDNFG  VFD E+REGQ+L +PQNFAVVKRAR 
Sbjct  372  DALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARN 431
Query  388  ERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSG 447
            E FEW+SFKTN+ AM SPLAGRTS +  +PEEVLA AFQI REDAR++KFN Q++TL   
Sbjct  432  EGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLKFNRQESTLVRS 491
Query  448  ESS 450
              S
Sbjct  492  RPS 494

Sequence Alignment: 17. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 177.9 bits 917,  Expect = 1e-45
 Identities = 286/450 63%, Positives = 363/450 80%, Gaps = 39/450 8%
Query  1    LSVCFLILFHGCLASRQEWQQQ--DECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
            +S+C++ L +GCLA     QQ    EC++ RL ALEP NR+E EAG +E+WDPN++QF+C
Sbjct  9    ISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESWDPNNQQFQC 68
Query  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQG----RQQ 114
            AGVA+VR TI+PNGLLLPQYSNAPQL+Y+V+G G+TG+ +PGCPET++  QQG    R  
Sbjct  69   AGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQQGQSRIRPS 128
Query  115  GQSGRFQ-DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTP 173
             +S  FQ DRHQKIR FR GD+IA PAGVAHWCYN+G++PVV V L+D +N+ NQLD+ P
Sbjct  129  LRSASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLDQNP 188
Query  174  RKFHLAGNPKDVF----QQ-------QQQHQSR-----------GRNLFSGFDTELLAEA 211
            R F+LAGNP D F    QQ       QQQHQ R           G N+FSGFD ++LA+A
Sbjct  189  RNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGNNVFSGFDADFLADA 248
Query  212  FQVDERLIKQLKSE-DNRGGIVKVKDDELRVIRP--SRSQSERGS----ESEEESEDEKR 264
            F VD    ++L+SE D+R  IV+V+  +L+VIRP  SR + ER      E E ESE E+R
Sbjct  249  FNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERERESESERR 308
Query  265  ---RWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVE 321
               R G+ DNG+EETICT+RL+ENI DP+RADIYT E GR++T NS  LP+L+WLQLS E
Sbjct  309  QSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTANSHTLPVLRWLQLSAE 368
Query  322  KGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAV 381
            +G LY +AL +PHWNLN+HS++Y  +G+ +VQVVDNFG  VFD E+REGQ+L +PQNFAV
Sbjct  369  RGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAV 428
Query  382  VKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQ 441
            VKRAR E FEW+SFKTN+ AM SPLAGRTS +  +PEEVLANA+QI REDAR++KFN Q+
Sbjct  429  VKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANALQIPREDARRLKFNRQE 488
Query  442  TTLTSGESS 450
            +TL     S
Sbjct  489  STLVRSRPS 497

Sequence Alignment: 18. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 167.8 bits 862,  Expect = 1e-42
 Identities = 246/453 54%, Positives = 337/453 74%, Gaps = 53/453 11%
Query  1    LSVCFLILFHGCLASRQEW---QQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFR 57
            L + +L LF+GCLA RQ +   Q Q+ECQI+RL A  P  R+  EAGT E W+PN +Q+R
Sbjct  8    LFLSLLFLFNGCLA-RQTFSSQQSQNECQINRLRASAPQTRIRSEAGTTEWWNPNCQQLR 66
Query  58   CAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQS 117
            CAGV+++R+TI+PNGL+LP ++NAPQL+Y+VQG G+ GI  PGC ET+Q  QQ ++Q + 
Sbjct  67   CAGVSVMRQTIEPNGLVLPSFTNAPQLLYIVQGRGIQGIVMPGCAETFQDSQQWQHQSR- 125
Query  118  GRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFH 177
            GRFQD+HQK+RRFR+GDIIA+P GV HW YN+GN  VVT+ LLD  NS NQLD  PR+FH
Sbjct  126  GRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLLDTGNSANQLDNIPRRFH 185
Query  178  LAGNPKDVFQQ----QQQHQSR-----------------------------------GR- 197
            LAGNP++  +Q     QQ Q R                                   GR 
Sbjct  186  LAGNPEEEQRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRHQEEEEQGRE 245
Query  198  -----NLFSGFDTELLAEAFQVDERLIKQLKS-EDNRGGIVKVKDDELRVIRPSRSQSER 251
                 NL+  FD  +LA+AF VD  +I++++    NRG I++V+D  L+V+ P R + E 
Sbjct  246  SSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRVRGNRGTIIRVRD-RLQVVTPPRMEEEE 304
Query  252  GSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLP 311
              E ++E      R G +DNG+EET C+MR+KEN+ DP RADI+ P+ GR++TLN +NLP
Sbjct  305  REERQQEQRYRHTRGGSQDNGLEETFCSMRIKENLADPERADIFNPQAGRISTLNRFNLP 364
Query  312  ILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQ 371
            IL+ L+LS E+GVLY  A ++P+WN+N+H I+Y  +G  +VQVV++ G+ VFD  V +GQ
Sbjct  365  ILQRLELSAERGVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDDNVEQGQ 424
Query  372  MLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISRED 431
            +L VPQNFA +K+A  E  EWISF TN  A  +P+AG  S +  +PEEV+A ++Q+SRED
Sbjct  425  LLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTPMAGSVSFMRALPEEVVAASYQVSRED 484
Query  432  ARKIKFNNQQTTLTSGESSHHMRDDA 457
            AR+IKFNN+ T + +   S   R DA
Sbjct  485  ARRIKFNNKNTFFFTPSQSER-RADA 509

Sequence Alignment: 19. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 166.4 bits 855,  Expect = 3e-42
 Identities = 232/438 52%, Positives = 334/438 76%, Gaps = 93/438 21%
Query  14   ASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGL 73
            A + +   Q++CQ+++L A EPDNR++ EAG +E W+ N+  F+CAGVA  R TIQ NGL
Sbjct  1    ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGL 60
Query  74   LLPQYSNAPQLIYVVQGEGMTGISYPGCPETY----QAPQQGRQQ--------------- 114
             LP YSNAPQLIY+VQG G+ G  + GCPET+    Q+ QQGRQQ               
Sbjct  61   HLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQG 120
Query  115  --------------------------------GQSGRFQ--------DRHQKIRRFRRGD 134
                                            GQ GR Q        DRHQK RR R GD
Sbjct  121  RQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD 180
Query  135  IIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQS 194
            ++AIPAGVA+W YN+G+  +V V L+ VS+ +NQLD+ PRKF+LAGNP++ F QQ Q Q 
Sbjct  181  VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQP 240
Query  195  R--------------------------GRNLFSGFDTELLAEAFQVDERLIKQLKSE-DN 227
            R                          G N+FSGF+T+LLA+A+ V+E   + L+ + DN
Sbjct  241  RQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN 300
Query  228  RGGIVKVKDDELRVIRPSRSQSERGSE--SEEESEDEKRRWGQR--DNGIEETICTMRLK 283
            R  I++V+ + L  ++P R + ER  E   +E+ + E+++ G++   NG+EET C++RLK
Sbjct  301  RNQIIQVRGN-LDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLK 359
Query  284  ENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSII 343
            ENI +P RADI++P  GR++TLNS NLPIL++L+LS E+G +Y+N +  PHWN+N+HS++
Sbjct  360  ENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVV 419
Query  344  YGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMT 403
            Y  +G  +VQVV+  G+ ++D EV++GQ+++VPQN  V+++A  + FE+ +FKT + A  
Sbjct  420  YVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI 479
Query  404  SPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMR 454
            + LAGRTS L  +P+EVLANA+QISRE AR++K+N Q+T   S  SS++ R
Sbjct  480  NTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALS--SSQQRR 528

Sequence Alignment: 20. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 165.9 bits 851,  Expect = 4e-42
 Identities = 190/435 43%, Positives = 285/435 65%, Gaps = 25/435 5%
Query  1    LSVCFLILFHGCLASRQEWQ--QQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
            L++ + +L    +A  +E +  Q  +C+  R+   +P  R++ E GT E WD  +EQF+C
Sbjct  8    LALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQC 67
Query  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGR------ 112
            AG+  +R TI+PNGL LP Y  +P+L+Y+ +G+G+  I  PGC ETYQ  +  R      
Sbjct  68   AGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTE 127
Query  113  --QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLD 170
              +Q   G  +D HQK+ R+R+GDI+AIP+G AHWCYN+G+  +V V++ DV++  NQLD
Sbjct  128  ASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLD 187
Query  171  RTPRKFHLAGN-PKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRG 229
            +  R F+LAG  P+   Q+QQ  Q+   N+F  FD ELL+EAF V +  I++++SE+   
Sbjct  188  QKFRAFYLAGGVPRSGEQEQQARQTF-HNIFRAFDAELLSEAFNVPQETIRRMQSEEEER 246
Query  230  GIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDP 289
            G++ +  + +  +RP           EEE E E R   Q DNG+EET CTM+++ N+   
Sbjct  247  GLIVMARERMTFVRPD----------EEEGEQEHRGR-QLDNGLEETFCTMKFRTNVESR 295
Query  290  ARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGK 349
              ADI++ + GR+  ++   LPILK++ LS EKG LY NALV P W++  H+I+Y  +G 
Sbjct  296  READIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGD 355
Query  350  GQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGR 409
             QVQVVD+ G  + +  V +G+M+VVPQ +    RA    FEW++FKT    M SPLAG 
Sbjct  356  AQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGY 415
Query  410  TSVLGGMPEEVLANAFQISREDARKIKFN--NQQTTLTSG 447
            TSV+  MP +V+ N++QIS   A+ +K N  +Q   L+ G
Sbjct  416  TSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPG 455

Sequence Alignment: 21. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 165.8 bits 852,  Expect = 5e-42
 Identities = 242/451 53%, Positives = 349/451 77%, Gaps = 94/451 20%
Query  1    LSVCFLILFHGCLASRQ-EWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCA 59
            +S+C+L++F+GCLA+RQ +   Q++CQ+++L A EPDNR++ EAG +E W+ N+E F+CA
Sbjct  7    FSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQEDFQCA 66
Query  60   GVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETY----QAPQQGRQQ- 114
            GVA  R TIQ NGL LP YSNAPQLIY+VQG G+ G  + GCPET+    Q+ QQGRQQ 
Sbjct  67   GVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQE 126
Query  115  ----------------------------------------------GQSGRFQ------- 121
                                                          GQ GR Q       
Sbjct  127  QEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQ 186
Query  122  -DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG 180
             DRHQK RR R GD++AIPAGVA+W YN+G+  +V V L+ VS+ +NQLD+ PRKF+LAG
Sbjct  187  FDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAG 246
Query  181  NPKDVFQQQQQHQSR--------------------------GRNLFSGFDTELLAEAFQV 214
            NP++ F QQ Q Q R                          G N+FSGF+T+LLA+A+ V
Sbjct  247  NPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLLAQALNV 306
Query  215  DERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE--SEEESEDEKRRWGQR-- 269
            +E   + L+ + DNR  I++V+ + L  ++P R + ER  E   +E+ + E+++ G +  
Sbjct  307  NEETARNLQGQNDNRNQIIRVRGN-LDFVQPPRGRQEREHEERQQEQLQQERQQQGGQLM 365
Query  270  DNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNA 329
             NG+EET C++RLKENI +P RADI++P  GR++TLNS NLPIL++L+LS E+G +Y+N 
Sbjct  366  ANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNG 425
Query  330  LVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREER 389
            +  PHWN+N+HS++Y  +G  +VQVV+  G+ ++D EV++GQ+++VPQN  V+++A  + 
Sbjct  426  IYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQG 485
Query  390  FEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGES 449
            FE+ +FKT + A  + LAGRTS L  +P+EVLANA+QISRE AR++K+N Q+T   S  S
Sbjct  486  FEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALS--S 543
Query  450  SHHMR 454
            S++ R
Sbjct  544  SQQRR 548

Sequence Alignment: 22. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 154.4 bits 789,  Expect = 1e-38
 Identities = 228/448 50%, Positives = 322/448 71%, Gaps = 30/448 6%
Query  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
            LS+CFL LF GC+A R E  QQ+ECQI +L+AL+PDNR+E E G +E W+PN++ F+CAG
Sbjct  6    LSLCFL-LFSGCFALR-EQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAG 63
Query  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF 120
            VAL R T+  N L  P Y+N PQ IY+ QG G+ G+ +PGCP TYQ PQ+ +Q+G+S R 
Sbjct  64   VALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRP 123
Query  121  QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG 180
            QDRHQK+ RFR GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD+ PR+F+LAG
Sbjct  124  QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAG 183
Query  181  NPKDVF---QQQQQ------------HQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSE 225
            N +  F   QQQQQ             ++ G N++SGF  E+L EAF V+ ++++ L+ E
Sbjct  184  NQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGE 243
Query  226  D---NRGGIVKVKDDELRVIRPS--RSQSERGSESEEES----EDEK--RRWGQRD-NGI 273
            +   + G IV VK   LRV  P+  + Q E   + EEE     E +K  +R  +R  NGI
Sbjct  244  NEEEDSGAIVTVKGG-LRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGI 302
Query  274  EETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLP 333
            +ETICTMRL++NI   +  DIY P+ G +TT  SL++P L  L+LS + G L KNA+ +P
Sbjct  303  DETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVP 362
Query  334  HWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWI 393
            H+ LN++SIIY   G+  VQVV+  G RVFDGE++EG +L+VPQNFAV  +++ + FE++
Sbjct  363  HYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYV 422
Query  394  SFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSH 451
            SFKTNDR     LAG  S+L  +PEEV+ + F +  + AR++K NN  + L   + S+
Sbjct  423  SFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQ 480

Sequence Alignment: 23. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 154.4 bits 789,  Expect = 1e-38
 Identities = 228/448 50%, Positives = 322/448 71%, Gaps = 30/448 6%
Query  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
            LS+CFL LF GC+A R E  QQ+ECQI +L+AL+PDNR+E E G +E W+PN++ F+CAG
Sbjct  6    LSLCFL-LFSGCFALR-EQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAG 63
Query  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRF 120
            VAL R T+  N L  P Y+N PQ IY+ QG G+ G+ +PGCP TYQ PQ+ +Q+G+S R 
Sbjct  64   VALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRP 123
Query  121  QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG 180
            QDRHQK+ RFR GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD+ PR+F+LAG
Sbjct  124  QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAG 183
Query  181  NPKDVF---QQQQQ------------HQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSE 225
            N +  F   QQQQQ             ++ G N++SGF  E+L EAF V+ ++++ L+ E
Sbjct  184  NQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGE 243
Query  226  D---NRGGIVKVKDDELRVIRPS--RSQSERGSESEEES----EDEK--RRWGQRD-NGI 273
            +   + G IV VK   LRV  P+  + Q E   + EEE     E +K  +R  +R  NGI
Sbjct  244  NEEEDSGAIVTVKGG-LRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGI 302
Query  274  EETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLP 333
            +ETICTMRL++NI   +  DIY P+ G +TT  SL++P L  L+LS + G L KNA+ +P
Sbjct  303  DETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVP 362
Query  334  HWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWI 393
            H+ LN++SIIY   G+  VQVV+  G RVFDGE++EG +L+VPQNFAV  +++ + FE++
Sbjct  363  HYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYV 422
Query  394  SFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSH 451
            SFKTNDR     LAG  S+L  +PEEV+ + F +  + AR++K NN  + L   + S+
Sbjct  423  SFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQ 480

Sequence Alignment: 24. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 154.2 bits 788,  Expect = 1e-38
 Identities = 230/446 51%, Positives = 319/446 71%, Gaps = 30/446 6%
Query  1    LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
            LS+CFL LF GC +A S +E  QQ+ECQI RL+AL+PDNR+E E G +E W+PN++ F+C
Sbjct  6    LSLCFL-LFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQC 64
Query  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSG 118
            AGVAL R T+  N L  P Y+NAPQ IY+ QG G+ G+ +PGCP T++ PQ   Q+GQS 
Sbjct  65   AGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQ---QKGQSS 121
Query  119  RFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHL 178
            R QDRHQKI  FR GD+IA+P G A+W YN  ++PVV V+L+D ++ QNQLD+ PR+F+L
Sbjct  122  RPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYL 181
Query  179  AGNPKDVFQQ-----------------QQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQ 221
            AGN +  F Q                 QQ+ ++ G +++SGF  E+L  AF VD +++++
Sbjct  182  AGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVDRQIVRK 241
Query  222  LKSEDN---RGGIVKVKDDELRVIRP-SRSQSERGSESEEESEDEKRR--WGQRDNGIEE 275
            L+ E+    +G IV VK   L VI P +  Q +R  E E+   DEK +    Q  NGI+E
Sbjct  242  LQGENEEEEKGAIVTVKGG-LSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSRNGIDE 300
Query  276  TICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHW 335
            TICTMRL+ NI   +  DI+ P+ G +TT  SL++P L WL+LS + G L KNA+ +PH+
Sbjct  301  TICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPHY 360
Query  336  NLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISF 395
            NLN++SIIY   G+  VQVV+  G RVFDGE++EGQ+L+VPQNFAV  R++ + FE++SF
Sbjct  361  NLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYVSF 420
Query  396  KTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSH 451
            KTNDR     LAG  S+L  +PEEV+   F + R+ AR++K NN  + L   + S+
Sbjct  421  KTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQ 476

Sequence Alignment: 25. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 150.9 bits 771,  Expect = 1e-37
 Identities = 215/433 49%, Positives = 301/433 69%, Gaps = 84/433 19%
Query  1    LSVCFLILFHGCLASRQEWQQ-------------QDECQIDRLDALEPDNRVEYEAGTVE 47
            +S+C+++L   C A    WQ+             Q +C I RL A EP  RV  EAG  E
Sbjct  9    FSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLTASEPSRRVRSEAGVTE 66
Query  48   AWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQA 107
             WD +  +FRCAG   VR  IQP GLLLP YSNAP + +V QG G+ G+  PGCPET+Q+
Sbjct  67   IWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGCPETFQS 126
Query  108  ------PQQGRQQ-------GQSGR---------------------------FQ--DRHQ 125
                  P+  R Q       G+S R                           F   D+HQ
Sbjct  127  GSEFEYPRSQRDQRSRQSESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQ 186
Query  126  KIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPK-- 183
            KI R R GD+I  PAGV +W +N G++ ++++TL D ++ QNQLD   R F LAG  K  
Sbjct  187  KIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQS 246
Query  184  --DVFQQQQ------QHQSRGR---------NLFSGFDTELLAEAFQ-VDERLIKQLKSE 225
              D   Q+Q        QSR           N++SGF+ E+L E F+ VD+  I +L+ E
Sbjct  247  REDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETISKLRGE 306
Query  226  -DNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKE 284
             D RG IV+ +D +LRV  P     E   E + E  D KR    R NG+E+  C +++++
Sbjct  307  NDQRGFIVQARDLKLRV--PE----EYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFRQ 360
Query  285  NINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIY 344
            N+N P+RAD++ P  GR+ T++S NLPIL+++QLS +  VLYKNA++ P WNLN+HS +Y
Sbjct  361  NVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALY 420
Query  345  GCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTS 404
              +G+G+VQVV + G  VFD  V+ GQ+LVVPQ FAVV +A  E +EW+ +K +D A+TS
Sbjct  421  VTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITS 480
Query  405  PLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQ 441
            P+AG+TSVL  +P EVLAN++ IS ++A ++K   Q+
Sbjct  481  PIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQE 517

Sequence Alignment: 26. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 150.3 bits 767,  Expect = 2e-37
 Identities = 235/449 52%, Positives = 324/449 72%, Gaps = 38/449 8%
Query  1    LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
            +S+CFL LF GC +A S +E  QQ+ECQI +L+AL+PDNR+E E G +E W+PN++ F+C
Sbjct  6    FSLCFL-LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQC 64
Query  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSG 118
            AGVAL R T+  N L  P Y+N PQ IY+ QG+G+ G+ YPGCP T++ PQQ +Q+GQS 
Sbjct  65   AGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSS 124
Query  119  RFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHL 178
            R QDRHQKI  FR GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD+ PR+F+L
Sbjct  125  RPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL 184
Query  179  AGNPKDVFQQQQQ----HQSR-----------GRNLFSGFDTELLAEAFQVDERLIKQLK 223
            AGN +  F + QQ    HQS+           G +++SGF  E+L  AF VD+++ K L+
Sbjct  185  AGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQ 244
Query  224  SED---NRGGIVKVKDDELRVIRP-SRSQSERGSESEEESEDEK-----------RRWGQ 268
             E+   ++G IV VK   L VI+P +  Q +R  E EEE EDEK           R  G 
Sbjct  245  GENEGEDKGAIVTVKGG-LSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGS 303
Query  269  ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGV 324
                R NGI+ETICTMRL+ NI   +  DIY P+ G +TT  SL++P L WL+LS E G 
Sbjct  304  QSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGS 363
Query  325  LYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKR 384
            L KNA+ +PH+NLN++SIIY   G+  +QVV+  G RVFDGE++EG++L+VPQNF V  R
Sbjct  364  LRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAAR 423
Query  385  AREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTL 444
            ++ + FE++SFKTND  M   LAG  S+L  +PEEV+ + F +  + AR+IK NN    L
Sbjct  424  SQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFL 483
Query  445  TSGESSH 451
               + S+
Sbjct  484  VPPQESQ 490

Sequence Alignment: 27. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 150.3 bits 767,  Expect = 2e-37
 Identities = 235/449 52%, Positives = 324/449 72%, Gaps = 38/449 8%
Query  1    LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
            +S+CFL LF GC +A S +E  QQ+ECQI +L+AL+PDNR+E E G +E W+PN++ F+C
Sbjct  6    FSLCFL-LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQC 64
Query  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSG 118
            AGVAL R T+  N L  P Y+N PQ IY+ QG+G+ G+ YPGCP T++ PQQ +Q+GQS 
Sbjct  65   AGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSS 124
Query  119  RFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHL 178
            R QDRHQKI  FR GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD+ PR+F+L
Sbjct  125  RPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL 184
Query  179  AGNPKDVFQQQQQ----HQSR-----------GRNLFSGFDTELLAEAFQVDERLIKQLK 223
            AGN +  F + QQ    HQS+           G +++SGF  E+L  AF VD+++ K L+
Sbjct  185  AGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQ 244
Query  224  SED---NRGGIVKVKDDELRVIRP-SRSQSERGSESEEESEDEK-----------RRWGQ 268
             E+   ++G IV VK   L VI+P +  Q +R  E EEE EDEK           R  G 
Sbjct  245  GENEGEDKGAIVTVKGG-LSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGS 303
Query  269  ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGV 324
                R NGI+ETICTMRL+ NI   +  DIY P+ G +TT  SL++P L WL+LS E G 
Sbjct  304  QSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGS 363
Query  325  LYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKR 384
            L KNA+ +PH+NLN++SIIY   G+  +QVV+  G RVFDGE++EG++L+VPQNF V  R
Sbjct  364  LRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAAR 423
Query  385  AREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTL 444
            ++ + FE++SFKTND  M   LAG  S+L  +PEEV+ + F +  + AR+IK NN    L
Sbjct  424  SQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFL 483
Query  445  TSGESSH 451
               + S+
Sbjct  484  VPPQESQ 490

Sequence Alignment: 28. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 149.6 bits 764,  Expect = 4e-37
 Identities = 213/433 49%, Positives = 300/433 69%, Gaps = 114/433 26%
Query  1    LSVCFLILFHGCLASRQEWQ-----------QQ--DECQIDRLDALEPDNRVEYEAGTVE 47
            +S+C+++L   C A    W+           QQ   +C + RL A EP  RV  EAG  E
Sbjct  9    FSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLTASEPSRRVRSEAGVTE 66
Query  48   AWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQA 107
             WD +  +FRCAG   VR  IQP GLLLP YSNAP + +V QG G+ G+  PGCPET+Q+
Sbjct  67   IWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGCPETFQS 126
Query  108  ------PQQGR-------------------QQGQSGRFQ--------------------- 121
                  PQ  R                   +Q +S  F                      
Sbjct  127  ESEFEYPQSQRDQRSRQSESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRT 186
Query  122  --------------------------DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVV 155
                                      D+HQKI R R GD+I  PAGV +W +N+G++ ++
Sbjct  187  RQSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLI 246
Query  156  TVTLLDVSNSQNQLDRTPRKFHLAGNPK----DVFQQQQ------QHQSRGR-------- 197
            ++TL D ++ QNQLD   R F LAG  K    D   Q+Q        QSR          
Sbjct  247  SITLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDDDEALLE 306
Query  198  -NLFSGFDTELLAEAFQ-VDERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE 254
             N+++GF  E+L E F+ VD+  I +L+ + D RG IV+ +D +LRV  P     E   E
Sbjct  307  ANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARDLKLRV--PE----EYEEE 360
Query  255  SEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILK 314
             + E  D KR    R NG+E+  C +++K+N+N P+RAD++ P  GR+ T+NS NLPIL+
Sbjct  361  LQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILE 420
Query  315  WLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLV 374
            ++QLS +  VLYKNA++ P WNLN+HS +Y  +G+G+VQVV + G  VFD  V+ GQ+LV
Sbjct  421  FIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILV 480
Query  375  VPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARK 434
            VPQ FAVV +A  E +EW+ +K +D A+TSP+AG+TSVL  +P EVLAN++ IS ++A +
Sbjct  481  VPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFR 540
Query  435  IKFNNQQ 441
            +K   Q+
Sbjct  541  LKNGRQE 547

Sequence Alignment: 29. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 141.0 bits 717,  Expect = 1e-34
 Identities = 244/450 54%, Positives = 343/450 76%, Gaps = 48/450 10%
Query  4    CFLILFHGCLASRQE-WQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVA 62
            C+L+LF+GCLASRQ  + Q  E Q+++L+A EPDN ++ EAG  E+W+P+  QF+ AGVA
Sbjct  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
Query  63   LVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQ--APQQGRQQGQSGRF 120
            +VR TI+PNGL LP Y NAPQLIY+V+G G+ G  +PGC ET++   PQQ +QQ Q  +F
Sbjct  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
Query  121  -------------------QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLD 161
                               QDRHQKIR  R GDIIA+PAGVA+W YN G  P+V V+LLD
Sbjct  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
Query  162  VSNSQNQLDRTPRKFHLAGNPKDVF-------QQQQQHQSR---GRNLFSGFDTELLAEA 211
            ++N QNQLD+ PR+F+LAGNP+D F       QQQQQ+Q +   G N+FSGFDT+LLA+A
Sbjct  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
Query  212  FQVDERLIKQLKSED-NRGGIVKVKDDELRVIRP-SRSQSERGSE--------SEEESED 261
            + V+    + L+ +D NR  IV+V+  +L  + P SRS   RG +        S+ E E+
Sbjct  241  LNVNPETARNLQGQDDNRNEIVRVQG-QLDFVSPFSRSAGGRGDQERQQEEQQSQREREE 299
Query  262  EKRRW-----GQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWL 316
            ++R       G +DNG+EET C+ RL +NI DP+RAD Y P+ GR++ +N  +LPIL++L
Sbjct  300  KQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYL 359
Query  317  QLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVP 376
            +LS EKGVLY NA+  PHW+ N+++++Y  +G  +VQVV+  G+ ++D EVREGQ++++P
Sbjct  360  RLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIP 419
Query  377  QNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIK 436
            QN AV+ +A  E FE+ISF+T++   T+ LAGRTSVL  +P+EVL NAF+ISR++AR +K
Sbjct  420  QNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLK 479
Query  437  FNNQQTTLTSGESSHHMR 454
            +N Q++ L S  S    R
Sbjct  480  YNRQESRLLSATSPPRGR 497

Sequence Alignment: 30. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 135.5 bits 687,  Expect = 6e-33
 Identities = 236/442 53%, Positives = 324/442 73%, Gaps = 63/442 14%
Query  1    LSVCFLILFHGCLAS-------RQE--WQQ--------QDECQIDRLDALEPDNRVEYEA 43
            +SVC+L+LFHGC A         Q+  W Q        Q +CQ+  L+AL+P +R   EA
Sbjct  9    FSVCLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQCQLQNLNALQPKHRFRSEA 68
Query  44   GTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPE 103
            G  E WD N +QF+CAGVA++RH IQ  GLLLP +++AP L YV QGEG+ G  +PGCPE
Sbjct  69   GETEFWDQNEDQFQCAGVAFLRHKIQRKGLLLPSFTSAPMLFYVEQGEGIHGAVFPGCPE 128
Query  104  TYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVS 163
            TYQ+  Q   Q +  R  D+HQK+RR++ GD++A+PAGVAHW +N G S +V V L+DV 
Sbjct  129  TYQSQSQQNIQDRPQR--DQHQKLRRLKEGDVVALPAGVAHWIFNNGRSQLVLVALVDVG 186
Query  164  NSQNQLDRTPRKFHLAGNP----------KDVFQQQQQHQ-----------SRGRNLFSG 202
            N  NQLD   RKF LAG+P          +D  Q+Q + Q           S G N++SG
Sbjct  187  NDANQLDENFRKFFLAGSPQGGVVRGGQSRDRNQRQSRTQRGEREEEESQESGGNNVLSG 246
Query  203  FDTELLAEAFQVDERLIKQLKSE-DNRGGIVKVK-------DDELRVIRPSRSQSERG-- 252
            F   LLA+AF +D RL ++L++E DNRG IV+++       + + R  R    + ER   
Sbjct  247  FRDNLLAQAFGIDTRLARKLQNERDNRGAIVRMEHGFEWPEEGQRRQGREEEGEEEREPK 306
Query  253  ----SESEEE-SEDEKRRW---GQR--DNGIEETICTMRLKENINDPAR-ADIYTPEVGR 301
                 ES+EE SE+E+R     G+R   NG+EET C+MRLK     PA  AD++ P  GR
Sbjct  307  WQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHRT--PASSADVFNPRGGR 364
Query  302  LTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNR 361
            +TT+NS+NLPIL++LQLS E+GVLY NA+  PHWN+N+HSI+Y  +G G++Q+V   G  
Sbjct  365  ITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEA 424
Query  362  VFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVL 421
            +FD +V  GQ++ VPQN AVVK+A    FEWI+FKTN  A  S +AGR S++ G+P +VL
Sbjct  425  IFDEQVERGQVITVPQNHAVVKKAGRRGFEWIAFKTNANAKISQIAGRVSIMRGLPVDVL 484
Query  422  ANAFQISREDARKIKFNNQQTTLTS 446
            AN+F ISRE+A ++K N Q+ ++ S
Sbjct  485  ANSFGISREEAMRLKHNRQEVSVFS 509

Sequence Alignment: 31. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 131.4 bits 665,  Expect = 1e-31
 Identities = 218/422 51%, Positives = 301/422 71%, Gaps = 70/422 16%
Query  16   RQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLL 75
            RQ+  +++ CQ  RL+A  PDNR+E E G +E W+PN+++F CAGVAL R  ++ N L  
Sbjct  1    RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR 59
Query  76   PQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQ-QGRQ----------QG--QSGRFQD 122
            P YSNAPQ I++ QG G  G+ +PGCP  Y+ P+ QGR+          QG  QS + +D
Sbjct  60   PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 119
Query  123  RHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNP 182
             HQK+ RF  GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD+ PR+F+LAGN 
Sbjct  120  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 179
Query  183  KDVF--QQQQQHQSR-----------------------------------------GRNL 199
            +  F   QQQ  QSR                                         G N+
Sbjct  180  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 239
Query  200  FSGFDTELLAEAFQVDER-LIKQLKSE---DNRGGIVKVKDDELRVIRPSRS----QSER 251
            FSGF  E+L +AFQVD+R +++ L+ E   +  G IV V+   LR++ P R     + E 
Sbjct  240  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG-LRILSPDRKRRADEEEE 298
Query  252  GSESEEESEDEKRRWGQ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNS 307
              E E E ++E RR G+    R NGIEETICT   K+NI      DIY P+ G L T N 
Sbjct  299  YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 358
Query  308  LNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEV 367
            LNL IL+WL  S E G LY+NAL + H+N N+HSIIY  +G+ +VQVVD+ GNRV+D E+
Sbjct  359  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 418
Query  368  REGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQI 427
            +EG++LVVPQNFAV  +++ E FE+++FKT+ R   + LAG  SV+  +PEEV+AN++ +
Sbjct  419  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 478
Query  428  SREDARKIKFNN 439
             RE AR++K NN
Sbjct  479  QREQARQLKNNN 490

Sequence Alignment: 32. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 131.4 bits 665,  Expect = 1e-31
 Identities = 218/422 51%, Positives = 301/422 71%, Gaps = 70/422 16%
Query  16   RQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLL 75
            RQ+  +++ CQ  RL+A  PDNR+E E G +E W+PN+++F CAGVAL R  ++ N L  
Sbjct  4    RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRR 62
Query  76   PQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQ-QGRQ----------QG--QSGRFQD 122
            P YSNAPQ I++ QG G  G+ +PGCP  Y+ P+ QGR+          QG  QS + +D
Sbjct  63   PFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRD 122
Query  123  RHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNP 182
             HQK+ RF  GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD+ PR+F+LAGN 
Sbjct  123  SHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNT 182
Query  183  KDVF--QQQQQHQSR-----------------------------------------GRNL 199
            +  F   QQQ  QSR                                         G N+
Sbjct  183  EQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNI 242
Query  200  FSGFDTELLAEAFQVDER-LIKQLKSE---DNRGGIVKVKDDELRVIRPSRS----QSER 251
            FSGF  E+L +AFQVD+R +++ L+ E   +  G IV V+   LR++ P R     + E 
Sbjct  243  FSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG-LRILSPDRKRRADEEEE 301
Query  252  GSESEEESEDEKRRWGQ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNS 307
              E E E ++E RR G+    R NGIEETICT   K+NI      DIY P+ G L T N 
Sbjct  302  YDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND 361
Query  308  LNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEV 367
            LNL IL+WL  S E G LY+NAL + H+N N+HSIIY  +G+ +VQVVD+ GNRV+D E+
Sbjct  362  LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEEL 421
Query  368  REGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQI 427
            +EG++LVVPQNFAV  +++ E FE+++FKT+ R   + LAG  SV+  +PEEV+AN++ +
Sbjct  422  QEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGL 481
Query  428  SREDARKIKFNN 439
             RE AR++K NN
Sbjct  482  QREQARQLKNNN 493

Sequence Alignment: 33. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 121.7 bits 613,  Expect = 1e-28
 Identities = 218/445 48%, Positives = 317/445 71%, Gaps = 105/445 23%
Query  2    SVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGV 61
            S+C+L+L   C+A      + +ECQ++ L+ALEPD+RVE E G ++ W+  H +++CAGV
Sbjct  11   SLCLLLLSSACFAISS--SKLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGV 68
Query  62   ALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQ-QGRQQG---QS 117
             + + T+  NGL LP YS  P++I + QG+G  G++ PGCPET++ PQ Q  ++G   Q 
Sbjct  69   TVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQK 128
Query  118  GRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFH 177
             ++QD HQKIR F  GD++ IP GV +W YN G+ PVV ++LLD SN  NQLD+TPR F+
Sbjct  129  QQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFY 188
Query  178  LAGNPK----DVFQQQQQHQSRGR---------------NLFSGFDTELLAEAFQVDERL 218
            LAGNP     +  QQQQQ++S G                +++SGF   +LA++F  +E +
Sbjct  189  LAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDI 248
Query  219  IKQLKS-EDNRGGIVKVK----------------------DDELRVI------------- 242
             ++L+S +D R  IV V+                      DDE   I             
Sbjct  249  AEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKR 308
Query  243  -------------RPSR-SQSER-----GSESEEESEDEKRR---WGQRD---------- 270
                         RPSR SQ +R       E E+E ED+ R+   W  +           
Sbjct  309  EQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEE 368
Query  271  ---------NGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVE 321
                     NG+EE ICT++L ENI  P+RAD Y P+ GR++TLNSL LP L+ +QLS +
Sbjct  369  PRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQ 428
Query  322  KGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAV 381
              VLYKN +  PHWNLN++S+IY  +G+G+V+VV+  GN VFDGE+R GQ+LVVPQNF V
Sbjct  429  YVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVV 488
Query  382  VKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQ 441
             ++A E+ FE+I FKT+  A+TS L     V+  +P EVLA+++ + +    ++K+    
Sbjct  489  AEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQVSELKYEGNW 545
Query  442  TTLTSGESSH 451
              L + ES +
Sbjct  546  GPLVNPESQQ 555

Sequence Alignment: 34. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 120.8 bits 608,  Expect = 2e-28
 Identities = 214/431 49%, Positives = 306/431 70%, Gaps = 76/431 17%
Query  4    CFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVAL 63
            CFL+L    ++ RQ+  +++ CQ  RL+A  PDNR+E E G +E W+PN+++F CAGVAL
Sbjct  12   CFLVLGASSISFRQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL 70
Query  64   VRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAP-QQGR---------- 112
             R  ++ N L  P YSNAPQ I++ QG G  G+ +PGCP TY+ P QQGR          
Sbjct  71   SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRR 130
Query  113  --QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLD 170
              ++ QS + QD HQK+ RF  GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD
Sbjct  131  LQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLD 190
Query  171  RTPRKFHLAGNPKDVF--QQQQQHQSR--------------------------------- 195
            + PR+F+LAGN +  F   QQQ  QSR                                 
Sbjct  191  QFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER 250
Query  196  --------GRNLFSGFDTELLAEAFQVDER-LIKQLKSEDN---RGGIVKVKDDELRVIR 243
                    G N+FSGF  E+L +AFQVD+R +++ L  E+     G IV V+   LR++ 
Sbjct  251  AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGG-LRILS 309
Query  244  PSRSQSERGSESEEESEDEKRRWGQRD-----------NGIEETICTMRLKENINDPARA 292
            P      RG++ EEE ++++  + ++D           NGIEETICT  +K+NI      
Sbjct  310  PD---GTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSP 366
Query  293  DIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQV 352
             IY P+       + LNL IL+WL LS E G LY+NAL +PH+N N+HSIIY  +G+ +V
Sbjct  367  HIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHV 426
Query  353  QVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSV 412
            QVVD+ GNRV+D E++EG++LVVPQNFAV  +++ E FE+++FKT+ R   + +AG  S 
Sbjct  427  QVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSF 486
Query  413  LGGMPEEVLANAFQISREDARKIKFNN 439
            +  +PEEV+AN++ + RE AR++K NN
Sbjct  487  IDNLPEEVVANSYGLPREQARQLKNNN 513

Sequence Alignment: 35. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 117.2 bits 588,  Expect = 2e-27
 Identities = 211/439 48%, Positives = 307/439 69%, Gaps = 72/439 16%
Query  2    SVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGV 61
            S+C+L+L   C+A      + +ECQ++ L+ALEPD+RVE E G +E W+  H +++CAGV
Sbjct  12   SLCLLLLSSACFAITS--SKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGV 69
Query  62   ALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQ--GRQQGQSGR 119
             + + T+  NGL LP YS  PQ+I VVQG+G  G ++PGCPET++ PQQ   R+  +S +
Sbjct  70   TVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQ 129
Query  120  -FQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHL 178
             +QD HQKIR F  GD++ IP GV +W YN G+ PVV ++LLD SN  NQLD+ PR F+L
Sbjct  130  QLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYL 189
Query  179  AGNPK----DVFQQQQQHQSRGR--------------NLFSGFDTELLAEAFQVDERLIK 220
            AGNP     +  QQQQQ++S G               +++SGF   +LA++F  +E   +
Sbjct  190  AGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQSFNTNEDTAE 249
Query  221  QLKS-EDNRGGIVKVK--------------------DDELRVI------RPSRSQSERGS 253
            +L+S +D R  IV V+                    D+E          RPS  + E   
Sbjct  250  KLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHE-DD 308
Query  254  ESEEESEDEKR------------------RWGQRDNGIEETICTMRLKENINDPARADIY 295
            E E+E ED+ R                  R  Q  NG+EE ICTM+L ENI  P+RAD Y
Sbjct  309  EDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFY 368
Query  296  TPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVV 355
             P+ GR++TLNSL LP L+ + LS +  VLY+N +  PHWNLN++S+IY  +GKG+V+VV
Sbjct  369  NPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVV 428
Query  356  DNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGG 415
            +  GN VFDGE+R GQ+LVVPQNF V ++  E+ +E++ FKT+  A++S +     V+  
Sbjct  429  NCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIK---DVFRA 485
Query  416  MPEEVLANAFQISREDARKIKFNNQQTTLTS 446
            +P EVL+N++ + +   R++K+      L +
Sbjct  486  IPSEVLSNSYNLGQSQVRQLKYQGNSGPLVN 516

Sequence Alignment: 36. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 42.8 bits 185,  Expect = 5e-05
 Identities = 98/345 28%, Positives = 178/345 51%, Gaps = 68/345 19%
Query  67   TIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQK 126
            T++PN L +PQY +A  +++V +GE   G  Y                        +++ 
Sbjct  93   TMEPNTLYIPQYIDASLILFVRRGEAKVGYIY------------------------KNKL 128
Query  127  I-RRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTL-LDVSNSQNQLDRTPRKFHLAGNPKD 184
            + +R++ G + AIPAG + +  N   S  + +   +D   S       P+ F++ G    
Sbjct  129  VEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGG--- 185
Query  185  VFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKV------KDDE 238
            V+          R+++SGFD   L+ AF V    ++ + +    G I+++      + D 
Sbjct  186  VLP---------RSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDY 236
Query  239  LRVIRPSR----SQSERGSESEEESEDEKRR-WGQR---DNGIEETICTMRLKENI-NDP 289
            L  I   +     + E  S+ ++E+E E+   W  R    + + +  C ++ K  + + P
Sbjct  237  LSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSP 296
Query  290  ARADIYTPE------VGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSII 343
               ++Y  E       G    ++  +   LK   L V    L   A++ PH  +N  +  
Sbjct  297  GSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPH--VNPTATE 354
Query  344  YGC--KGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRARE-ERFEWISFKTNDR 400
            YG   +G G +QVV   G    + +V EG ++ +P+ F   + A +   +E+  F T+ R
Sbjct  355  YGIILRGSGTIQVVFPNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSAR 414
Query  401  AMTSP--LAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSH 451
                P  L G++S+L  M    LA AF +S E   +I    Q+  +    S H
Sbjct  415  K-NRPQFLVGKSSLLHSMRGPELAAAFGVSEEQLERI-VKAQREAVILPTSPH 465

Sequence Alignment: 37. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 38.9 bits 165,  Expect = 0.0009
 Identities = 94/361 26%, Positives = 190/361 52%, Gaps = 100/361 27%
Query  16   RQEWQQQDECQIDRLDALEPDNRVEYEAGTV---EAWDPNHEQFRCAGVALVRHTI---Q 69
            R+E QQ+         ++   +R E E G V   E +    E +R  G+   R  I    
Sbjct  172  REEEQQRHNPYYFHSQSIR--SRHESEEGEVKYLERFTERTELLR--GIENYRVVILDAN 227
Query  70   PNGLLLPQYSNAPQLIYVVQGEG-MTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIR 128
            PN  +LP++ +A  +  V +G   +T +S           Q+ R+      F        
Sbjct  228  PNTSMLPHHKDAESVAVVTRGRATLTLVS-----------QETRES-----FN------- 264
Query  129  RFRRGDIIAIPAGVAHWCYNE-GNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQ 187
             +  GD+I +PAG   +  N+  N  +  V LL   N+  Q+    R+++ AG       
Sbjct  265  -LECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNPGQF----REYYAAGA------ 313
Query  188  QQQQHQSRGRNLFSGFDTELLAEAFQVD-ERLIKQLKSEDNRGG-IVKVKDDELRVIRPS 245
             +   QS  R     F  ++L  A+    +RL + +  ++ R G I++   ++LR +   
Sbjct  314  -KSPDQSYLRV----FSNDILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRAL--- 365
Query  246  RSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTL 305
                     S+      +R WG+R +G       + LK     P+    Y+ + G++   
Sbjct  366  ---------SQHAMSAGQRPWGRRSSG-----GPISLKSE--SPS----YSNQFGQFFEA 405
Query  306  NSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVV-DNFGNRVFD 364
                   L+ + + V    + + A+++PH+N  +  ++Y  +G G+ ++   +  ++ ++
Sbjct  406  CPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYE 465
Query  365  GEVRE--------------------GQMLVVPQNFAV-VKRAREERFEWISFKTN-DRAM 402
            G+ R                     G ++V+P    + +  ++ E +  + F  N +   
Sbjct  466  GQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQ 525
Query  403  TSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTT 443
               LAG+ +++  +  E    +F + RE+  +I F +Q  +
Sbjct  526  RDFLAGQNNIINQLEREAKELSFNMPREEIEEI-FESQMES 565

Sequence Alignment: 38. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 38.2 bits 160,  Expect = 0.001
 Identities = 95/361 26%, Positives = 193/361 53%, Gaps = 100/361 27%
Query  16   RQEWQQQDECQIDRLDALEPDNRVEYEAGTV---EAWDPNHEQFRCAGVALVRHTI---Q 69
            R+E QQ+         ++   +R E E G V   E +    E +R  G+   R  I    
Sbjct  60   REEEQQRHNPYYFHSQSIR--SRHESEEGEVKYLERFAERTELLR--GIENYRVVILDAN 115
Query  70   PNGLLLPQYSNAPQLIYVVQGEG-MTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIR 128
            PN ++LP++ +A  +I V +G   +T +S           Q+ R+      F        
Sbjct  116  PNTFMLPHHKDAESVIVVTRGRATLTLVS-----------QETRES-----FN------- 152
Query  129  RFRRGDIIAIPAGVAHWCYNE-GNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQ 187
             +  GD+I +PAG   +  N+  N  +  V LL   N+  Q+    R+++ AG       
Sbjct  153  -LECGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPGQV----REYYAAGA------ 201
Query  188  QQQQHQSRGRNLFSGFDTELLAEAFQVD-ERLIKQLKSEDNRGG-IVKVKDDELRVIRPS 245
             +   QS  R     F  ++L  A+    +RL + +  ++ R G I++   ++LR +   
Sbjct  202  -KSPDQSYLRV----FSNDILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRAL--- 253
Query  246  RSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTL 305
                     S+      +R WG+R +G   ++ + R       P+    Y+ + G++   
Sbjct  254  ---------SQHAMSAGQRPWGRRSSGGPISLKSER-------PS----YSNQFGQFFEA 293
Query  306  NSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVV-DNFGNRVFD 364
                   L+ + + V    + + A+++PH+N  +  ++Y  +G G+ ++   +  ++ F+
Sbjct  294  CPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFE 353
Query  365  GEVRE--------------------GQMLVVPQNFAV-VKRAREERFEWISFKTN-DRAM 402
             + R                     G ++V+P    + +  ++ E +  + F  N +   
Sbjct  354  DQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQ 413
Query  403  TSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTT 443
             + LAG+ S++  +  E    +F + RE+  +I F +Q  +
Sbjct  414  RNFLAGQNSIINQLEREAKELSFNMPREEIEEI-FESQMES 453

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.