The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGD
GFISFEEFTEFARANRGLIKDVAKIF
Sequence Info Allergen Name Length Opt Bits Score E Value
ALE34025 Sal k 7.0101 86 547 92.9 1.3e-21
AAL92871 Che a 3 86 516 88.2 3.3e-20
CAA73147 Bet v 4 85 457 79.3 1.6e-17
Q39419 Bet v 4 85 452 78.6 2.6e-17
O81701 Aln g 4 85 451 78.4 2.9e-17
O81092 Ole e 3 84 449 78.1 3.6e-17
P58171 Syr v 3 81 416 73.1 1.1e-15
CAP05019 Par j 4.0101 84 411 72.4 1.9e-15
BAA09633 Bra n 2 82 398 70.4 7.4e-15
Q39406 Bra n 2 83 398 70.4 7.4e-15
O82040 Phl p 7 78 373 66.6 9.7e-14
CAA62634 Cyn d 7 82 372 66.5 1.1e-13
P94092 Cyn d 7 80 371 66.3 1.2e-13
P69197 Bra r 5.0101 79 369 66.0 1.5e-13
AY904434 Art v 5.0101 82 330 60.1 9.1e-12
Q2KN25 Amb a 10.0101 160 254 48.9 4.4e-08
O64943 Jun o 4 165 244 47.4 1.3e-07
AAF31152 Ole e 8 171 243 47.2 1.5e-07
ABP87672 Cup a 4.0101 177 241 46.9 1.8e-07
Q9M7R0 Ole e 8 171 232 45.6 4.6e-07
ACL36923 Tyr p 24.0101 153 169 36.0 0.00031
D2DGW3 Tyr p 34.0101 153 169 36.0 0.00031
QBF67841 Der f 39.0101 153 166 35.6 0.00043
QXY82447 Der p 39.0101 153 166 35.6 0.00043
ABB89298 Bla g 6.0301 154 152 33.4 0.0019
ABB89296 Bla g 6.0101 151 149 33.0 0.0025
ADV17344 Pen m 6.0101 150 148 32.8 0.0028
Q1M0Y3 Per a 6.0101 151 145 32.4 0.0038
P43187 Bet v 3 205 145 32.5 0.0048
ABB89297 Bla g 6.0201 151 138 31.3 0.0079
P29291 Hom a 6.0101 150 137 31.2 0.0087
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 92.9 bits 547,  Expect = 1e-21
 Identities = 86/86 100%, Positives = 86/86 100%, Gaps = 0/86 0%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGD 60
            MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGD
Sbjct  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGD 60
Query  61   GFISFEEFTEFARANRGLIKDVAKIF 86
            GFISFEEFTEFARANRGLIKDVAKIF
Sbjct  61   GFISFEEFTEFARANRGLIKDVAKIF 86

Sequence Alignment: 2. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 88.2 bits 516,  Expect = 3e-20
 Identities = 78/86 90%, Positives = 84/86 97%, Gaps = 0/86 0%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGD 60
            MAAEDTPQD+ADRERIFKRFDTNGDGKISSSELGDALKTLGSVT DE+ RMMAEIDTDGD
Sbjct  1    MAAEDTPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGD 60
Query  61   GFISFEEFTEFARANRGLIKDVAKIF 86
            GFISF+EFT+FARANRGL+KDV+KIF
Sbjct  61   GFISFDEFTDFARANRGLVKDVSKIF 86

Sequence Alignment: 3. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 79.3 bits 457,  Expect = 2e-17
 Identities = 68/84 80%, Positives = 78/84 92%, Gaps = 0/84 0%
Query  3    AEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGF 62
            A+D PQD A+RERIFKRFD NGDGKIS++ELG+ALKTLGS+T DE+  MMAEIDTDGDGF
Sbjct  2    ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGF 61
Query  63   ISFEEFTEFARANRGLIKDVAKIF 86
            ISF+EFT+FARANRGL+KDVAKIF
Sbjct  62   ISFQEFTDFARANRGLLKDVAKIF 85

Sequence Alignment: 4. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 78.6 bits 452,  Expect = 3e-17
 Identities = 67/84 79%, Positives = 77/84 91%, Gaps = 0/84 0%
Query  3    AEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGF 62
            A+D PQD A+RERIFKRFD NGDGKIS++ELG+ALKTLGS+T DE+  MMAEIDTDGDGF
Sbjct  2    ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGF 61
Query  63   ISFEEFTEFARANRGLIKDVAKIF 86
            ISF+EFT+F RANRGL+KDVAKIF
Sbjct  62   ISFQEFTDFGRANRGLLKDVAKIF 85

Sequence Alignment: 5. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 78.4 bits 451,  Expect = 3e-17
 Identities = 69/84 82%, Positives = 75/84 89%, Gaps = 0/84 0%
Query  3    AEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGF 62
            A+D PQD A+ ERIFK FD NGDGKIS+SELGDALKTLGSVT DE+  MMAEIDTDGDGF
Sbjct  2    ADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDGF 61
Query  63   ISFEEFTEFARANRGLIKDVAKIF 86
            ISF+EFT FARANRGL+KDVAKIF
Sbjct  62   ISFQEFTNFARANRGLVKDVAKIF 85

Sequence Alignment: 6. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 78.1 bits 449,  Expect = 4e-17
 Identities = 69/82 84%, Positives = 75/82 91%, Gaps = 0/82 0%
Query  5    DTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFIS 64
            D PQ++A+ ERIFKRFD NGDGKISSSELG+ LKTLGSVT +EI RMMAEIDTDGDGFIS
Sbjct  3    DDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFIS 62
Query  65   FEEFTEFARANRGLIKDVAKIF 86
            FEEFT FARANRGL+KDVAKIF
Sbjct  63   FEEFTVFARANRGLVKDVAKIF 84

Sequence Alignment: 7. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 73.1 bits 416,  Expect = 1e-15
 Identities = 65/79 82%, Positives = 72/79 91%, Gaps = 0/79 0%
Query  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEE 67
            +++A+ ERIFKRFD NGDGKISSSELG+ LKTLGSVT +EI RMMAEIDTDGDGFISFEE
Sbjct  3    EEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEE 62
Query  68   FTEFARANRGLIKDVAKIF 86
            F +FARAN GLIKDVAKIF
Sbjct  63   FKDFARANSGLIKDVAKIF 81

Sequence Alignment: 8. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 72.4 bits 411,  Expect = 2e-15
 Identities = 64/82 78%, Positives = 73/82 89%, Gaps = 0/82 0%
Query  5    DTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFIS 64
            D   D A++ERIFKRFD+NGDGKISSSELG+ALK LGSVT+DE+ RMMAEIDTDGDG IS
Sbjct  3    DKQIDRAEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGAIS 62
Query  65   FEEFTEFARANRGLIKDVAKIF 86
            +EEF+ FA ANRGLIKD+AKIF
Sbjct  63   LEEFSSFADANRGLIKDIAKIF 84

Sequence Alignment: 9. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 70.4 bits 398,  Expect = 7e-15
 Identities = 59/76 77%, Positives = 70/76 92%, Gaps = 0/76 0%
Query  11   ADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEFTE 70
            A+ +RIFK+FD NGDGKIS+SELGDALK LGSVT D+I RMMAEIDTDGDG+IS++EF++
Sbjct  7    AEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSD 66
Query  71   FARANRGLIKDVAKIF 86
            FA ANRGL+KDVAKIF
Sbjct  67   FASANRGLMKDVAKIF 82

Sequence Alignment: 10. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 70.4 bits 398,  Expect = 7e-15
 Identities = 59/76 77%, Positives = 70/76 92%, Gaps = 0/76 0%
Query  11   ADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEFTE 70
            A+ +RIFK+FD NGDGKIS+SELGDALK LGSVT D+I RMMAEIDTDGDG+IS++EF++
Sbjct  8    AEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSD 67
Query  71   FARANRGLIKDVAKIF 86
            FA ANRGL+KDVAKIF
Sbjct  68   FASANRGLMKDVAKIF 83

Sequence Alignment: 11. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 66.6 bits 373,  Expect = 1e-13
 Identities = 57/75 76%, Positives = 63/75 84%, Gaps = 0/75 0%
Query  12   DRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEFTEF 71
            D ERIFKRFDTNGDGKIS SEL DAL+TLGS ++DE+ RMMAEIDTDGDGFI F EF  F
Sbjct  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
Query  72   ARANRGLIKDVAKIF 86
              AN GL+KDVAK+F
Sbjct  64   CNANPGLMKDVAKVF 78

Sequence Alignment: 12. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 66.5 bits 372,  Expect = 1e-13
 Identities = 57/81 70%, Positives = 65/81 80%, Gaps = 0/81 0%
Query  6    TPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISF 65
            T  D  D E IFKRFDTNGDGKIS +EL DAL+TLGS ++DE+ RMMAEIDTDGDGFI F
Sbjct  2    TMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF 61
Query  66   EEFTEFARANRGLIKDVAKIF 86
            +EF  F  AN GL+KDVAK+F
Sbjct  62   DEFISFCNANPGLMKDVAKVF 82

Sequence Alignment: 13. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 66.3 bits 371,  Expect = 1e-13
 Identities = 56/78 71%, Positives = 64/78 82%, Gaps = 0/78 0%
Query  9    DLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEF 68
            D  D E IFKRFDTNGDGKIS +EL DAL+TLGS ++DE+ RMMAEIDTDGDGFI F+EF
Sbjct  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
Query  69   TEFARANRGLIKDVAKIF 86
              F  AN GL+KDVAK+F
Sbjct  63   ISFCNANPGLMKDVAKVF 80

Sequence Alignment: 14. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 66.0 bits 369,  Expect = 1e-13
 Identities = 56/76 73%, Positives = 68/76 89%, Gaps = 0/76 0%
Query  11   ADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEFTE 70
            A+ ERIFK+FDT+GDGKIS++EL +ALK LGSVT D++ RMMA+IDTDGDG ISF+EFTE
Sbjct  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
Query  71   FARANRGLIKDVAKIF 86
            FA AN GL+KDVAK+F
Sbjct  64   FASANPGLMKDVAKVF 79

Sequence Alignment: 15. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 60.1 bits 330,  Expect = 9e-12
 Identities = 49/79 62%, Positives = 64/79 81%, Gaps = 0/79 0%
Query  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEE 67
            +D A+ +RIF  FD NGDGKIS++ELG++L  LGSV+ +E+  MM E+DTDGDG+IS++E
Sbjct  4    EDKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGYISYDE 63
Query  68   FTEFARANRGLIKDVAKIF 86
            F EF  ANRGL+KDV KIF
Sbjct  64   FAEFFNANRGLMKDVGKIF 82

Sequence Alignment: 16. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 48.9 bits 254,  Expect = 4e-08
 Identities = 45/80 56%, Positives = 57/80 71%, Gaps = 4/80 5%
Query  7    PQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTS-DEIVRMMAEIDTDGDGFISF 65
            P D  +  +IF RFDTNGDG+IS  EL   LK+LGS TS DE+ R+MAEID DGDGFIS+
Sbjct  12   PTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISL 71
Query  66   EEFTEFARA--NRG-LIKDVAKIF 86
            +EF  F +   + G  I D+ + F
Sbjct  72   DEFILFCKGIESEGDEINDLKEAF 95

Sequence Alignment: 17. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 47.4 bits 244,  Expect = 1e-07
 Identities = 39/77 50%, Positives = 55/77 71%, Gaps = 4/77 5%
Query  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDGDGFISFE 66
            Q + + E +FK+FD NGDGKIS SEL D L++LGS V   E+  MM E D DGDG++S++
Sbjct  22   QSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQ 81
Query  67   EFTEFARANRGL-IKDVAKIF 86
            EF ++   N+G  +KD+   F
Sbjct  82   EFVDL--NNKGASVKDLKNAF 100

Sequence Alignment: 18. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 47.2 bits 243,  Expect = 1e-07
 Identities = 40/67 59%, Positives = 48/67 71%, Gaps = 1/67 1%
Query  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTS-DEIVRMMAEIDTDGDGFISFE 66
            Q+  + + +F RFD NGDGKIS  EL  ALK LGS TS +EI RMM EIDTD DGFI+ +
Sbjct  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
Query  67   EFTEFARA 74
            EF  F +A
Sbjct  76   EFAAFVKA 83

Sequence Alignment: 19. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 46.9 bits 241,  Expect = 2e-07
 Identities = 37/78 47%, Positives = 53/78 67%, Gaps = 2/78 2%
Query  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDGDGFISFE 66
            Q + + E +FK+FD NGDGKIS SEL D L+++GS V   E+  MM E DTDGDG++S++
Sbjct  34   QSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQ 93
Query  67   EFTEFARANRGLIKDVAKIF 86
            EF ++       +KD+   F
Sbjct  94   EFVDLN-IKGATVKDLKNAF 112

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 45.6 bits 232,  Expect = 5e-07
 Identities = 38/67 56%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTS-DEIVRMMAEIDTDGDGFISFE 66
            Q+  + + +F RFD NGDGKIS  EL   LK LGS TS +EI R+M EIDTD DGFI+ +
Sbjct  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
Query  67   EFTEFARA 74
            EF  F +A
Sbjct  76   EFAAFVKA 83

Sequence Alignment: 21. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 36.0 bits 169,  Expect = 0.0003
 Identities = 28/70 40%, Positives = 41/70 58%, Gaps = 1/70 1%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDG 59
            +  EDT     +    F+ +D  G+G I +S L + L+ L   +T DE+  M+AEIDTDG
Sbjct  78   LVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDG 137
Query  60   DGFISFEEFTE 70
             G + F+EF E
Sbjct  138  SGTVDFDEFME 148

Sequence Alignment: 22. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 36.0 bits 169,  Expect = 0.0003
 Identities = 28/70 40%, Positives = 41/70 58%, Gaps = 1/70 1%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDG 59
            +  EDT     +    F+ +D  G+G I +S L + L+ L   +T DE+  M+AEIDTDG
Sbjct  78   LVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDG 137
Query  60   DGFISFEEFTE 70
             G + F+EF E
Sbjct  138  SGTVDFDEFME 148

Sequence Alignment: 23. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 35.6 bits 166,  Expect = 0.0004
 Identities = 27/70 38%, Positives = 41/70 58%, Gaps = 1/70 1%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDG 59
            +  ED      +    F+ +D  G+G I +S L + L+ L   +T+DE+  M+AEIDTDG
Sbjct  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
Query  60   DGFISFEEFTE 70
             G + F+EF E
Sbjct  138  SGTVDFDEFME 148

Sequence Alignment: 24. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 35.6 bits 166,  Expect = 0.0004
 Identities = 27/70 38%, Positives = 41/70 58%, Gaps = 1/70 1%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDG 59
            +  ED      +    F+ +D  G+G I +S L + L+ L   +T+DE+  M+AEIDTDG
Sbjct  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
Query  60   DGFISFEEFTE 70
             G + F+EF E
Sbjct  138  SGTVDFDEFME 148

Sequence Alignment: 25. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 33.4 bits 152,  Expect = 0.002
 Identities = 26/67 38%, Positives = 39/67 58%, Gaps = 1/67 1%
Query  4    EDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLG-SVTSDEIVRMMAEIDTDGDGF 62
            ED+     +    F+ +D  G+G I +S L + L+ L   +TSDE+  M+ EID DG G 
Sbjct  83   EDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGT 142
Query  63   ISFEEFTE 70
            + F+EF E
Sbjct  143  VDFDEFME 150

Sequence Alignment: 26. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 33.0 bits 149,  Expect = 0.003
 Identities = 27/79 34%, Positives = 48/79 60%, Gaps = 3/79 3%
Query  4    EDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVR-MMAEIDTDGDGF 62
            E  P+ +   ++ F  FD    G IS+  +G  L+ LG    D++++ ++AE+D DG G 
Sbjct  3    ELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGE 62
Query  63   ISFEEFTEFARANRGLIKDVAK 84
            + FEEF  +  A+R L+++ A+
Sbjct  63   LEFEEFVSL--ASRFLVEEDAE 82

Sequence Alignment: 27. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 32.8 bits 148,  Expect = 0.003
 Identities = 25/71 35%, Positives = 40/71 56%, Gaps = 2/71 2%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLG-SVTSDEIVRMMAEIDTDG 59
            M + D  Q +    + F  FDT G G I++  +G  L+ +G  ++   +  ++AE D DG
Sbjct  1    MDSLDEEQ-IETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDG 59
Query  60   DGFISFEEFTEFA 72
             G + FEEF E+A
Sbjct  60   SGMLEFEEFAELA 72

Sequence Alignment: 28. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 32.4 bits 145,  Expect = 0.004
 Identities = 23/70 32%, Positives = 42/70 60%, Gaps = 1/70 1%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDG 59
            +  ED      + +  F+ +D  G+G I+++ L + LK L   +T++++  M+ EID+DG
Sbjct  76   LVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEIDSDG 135
Query  60   DGFISFEEFTE 70
             G + F+EF E
Sbjct  136  SGTVDFDEFME 146

Sequence Alignment: 29. Allergen Name: Bet v 3 Sequence ID: P43187

 Score = 32.5 bits 145,  Expect = 0.005
 Identities = 28/67 41%, Positives = 38/67 56%, Gaps = 3/67 4%
Query  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVR---MMAEIDTDGDGFIS 64
            Q+ AD    FK FD +GDG IS+ EL   L  LG     EI R   M+  +D++ DG + 
Sbjct  130  QEEADSFGGFKVFDEDGDGYISARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVD 189
Query  65   FEEFTEFARA 74
            F EF +  R+
Sbjct  190  FFEFKDMMRS 199

Sequence Alignment: 30. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 31.3 bits 138,  Expect = 0.008
 Identities = 23/70 32%, Positives = 41/70 58%, Gaps = 1/70 1%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGS-VTSDEIVRMMAEIDTDG 59
            +  ED      +    F+ +D  G+G I+++ L + LK L   +T++++  M+ EID+DG
Sbjct  76   LVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEIDSDG 135
Query  60   DGFISFEEFTE 70
             G + F+EF E
Sbjct  136  SGTVDFDEFME 146

Sequence Alignment: 31. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 31.2 bits 137,  Expect = 0.009
 Identities = 24/71 33%, Positives = 41/71 57%, Gaps = 2/71 2%
Query  1    MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLG-SVTSDEIVRMMAEIDTDG 59
            M + D  Q L+  ++ F  FDT+  G I+   +G  L+ +G  ++   +  +++E D DG
Sbjct  1    MDSLDAEQ-LSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDG 59
Query  60   DGFISFEEFTEFA 72
             G + FEEF E+A
Sbjct  60   SGELEFEEFVELA 72

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.