The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRI
MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI
LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9M7R0 Ole e 8 171 1121 202.1 6.7e-54
AAF31152 Ole e 8 171 1094 197.5 1.6e-52
Q2KN25 Amb a 10.0101 160 583 110.1 3.1e-26
ABP87672 Cup a 4.0101 177 400 78.9 8.8e-17
O64943 Jun o 4 165 395 78.0 1.5e-16
Q1M0Y3 Per a 6.0101 151 294 60.7 2.2e-11
ABB89298 Bla g 6.0301 154 291 60.2 3.2e-11
ABB89297 Bla g 6.0201 151 286 59.3 5.7e-11
ABB89296 Bla g 6.0101 151 281 58.5 1e-10
D2DGW3 Tyr p 34.0101 153 276 57.6 1.9e-10
ACL36923 Tyr p 24.0101 153 276 57.6 1.9e-10
QBF67841 Der f 39.0101 153 273 57.1 2.7e-10
ADV17344 Pen m 6.0101 150 272 56.9 3e-10
QXY82447 Der p 39.0101 153 271 56.8 3.4e-10
P29291 Hom a 6.0101 150 265 55.8 6.9e-10
O81092 Ole e 3 84 244 52.0 5.3e-09
P58171 Syr v 3 81 243 51.8 5.8e-09
CAA73147 Bet v 4 85 232 49.9 2.2e-08
ALE34025 Sal k 7.0101 86 232 49.9 2.2e-08
Q39419 Bet v 4 85 228 49.3 3.5e-08
O82040 Phl p 7 78 226 48.9 4.2e-08
P94092 Cyn d 7 80 226 48.9 4.3e-08
CAA62634 Cyn d 7 82 226 48.9 4.4e-08
O81701 Aln g 4 85 225 48.7 5e-08
P02604 Gal d 7.0101 192 230 49.8 5.3e-08
BAA09633 Bra n 2 82 224 48.6 5.5e-08
Q39406 Bra n 2 83 224 48.6 5.6e-08
AAL92871 Che a 3 86 224 48.6 5.7e-08
A0JNJ5 Bos d 13.0101 192 229 49.7 5.9e-08
CAP05019 Par j 4.0101 84 223 48.4 6.3e-08
AY904434 Art v 5.0101 82 199 44.3 1.1e-06
P69197 Bra r 5.0101 79 192 43.1 2.4e-06
J7HCX7 Pro c 5.0101 153 194 43.6 3.2e-06
A0A514C9K9 Scy p 3.0101 153 175 40.4 3e-05
AIO08852 Der f 26.0101 160 174 40.2 3.5e-05
CAQ72972 Clu h 1.0301 109 135 33.4 0.0026
CAQ72970 Clu h 1.0101 109 134 33.3 0.003
QAT18638 Der p 26.0101 121 133 33.1 0.0036
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 202.1 bits 1121,  Expect = 7e-54
 Identities = 171/171 100%, Positives = 171/171 100%, Gaps = 0/171 0%
Query  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRI 60
            MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRI
Sbjct  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRI 60
Query  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
            MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI
Sbjct  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
Query  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171
            LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
Sbjct  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171

Sequence Alignment: 2. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 197.5 bits 1094,  Expect = 2e-52
 Identities = 167/171 97%, Positives = 168/171 98%, Gaps = 0/171 0%
Query  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRI 60
            MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELA  LKALGSNTSKEEI R+
Sbjct  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARM 60
Query  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
            MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI
Sbjct  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
Query  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171
            LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
Sbjct  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171

Sequence Alignment: 3. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 110.1 bits 583,  Expect = 3e-26
 Identities = 89/154 57%, Positives = 118/154 76%, Gaps = 5/154 3%
Query  8    NSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTD 67
            N+K S++  +  EV  +FNRFD NGDG+IS DEL  +LK+LGS+TS +E+ R+M EID D
Sbjct  5    NNKHSIFPTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDAD 64
Query  68   KDGFINVQEFAAFVKAETDPYPSSGGE-NELKEAFELYDQDHNGLISSVELHKILTRLGE 126
             DGFI++ EF  F K       S G E N+LKEAF++YDQ++NG+IS+ ELH+IL RLGE
Sbjct  65   GDGFISLDEFILFCKG----IESEGDEINDLKEAFKFYDQNNNGVISANELHQILGRLGE 120
Query  127  RYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNS 165
             Y+   C +MIKSVDSDGDG+V FEEF+KMM+ K G+ +
Sbjct  121  NYSVESCADMIKSVDSDGDGFVDFEEFRKMMSRKGGDGA 159

Sequence Alignment: 4. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 78.9 bits 400,  Expect = 9e-17
 Identities = 66/151 43%, Positives = 101/151 66%, Gaps = 9/151 5%
Query  8    NSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTD 67
            +S   V  Q  +E++ VF +FDANGDGKISG ELA +L+++GS   + E+  +MEE DTD
Sbjct  26   SSGKRVLEQSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTD 85
Query  68   KDGFINVQEFAAF-VKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGE 126
             DG++++QEF  + +K  T          +LK AF+++D+D NG IS  EL + L  +GE
Sbjct  86   GDGYVSLQEFVDLNIKGAT--------VKDLKNAFKVFDRDCNGTISPAELCQTLKSMGE 137
Query  127  RYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQ 166
                 +   +I +VD +GDG +S EEF+ MMT++  + S+
Sbjct  138  PCTIEESKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK 177

Sequence Alignment: 5. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 78.0 bits 395,  Expect = 2e-16
 Identities = 64/147 43%, Positives = 96/147 65%, Gaps = 7/147 4%
Query  13   VYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFI 72
            V  Q  +E++ VF +FDANGDGKISG ELA +L++LGS+  + E+  +MEE D D DG++
Sbjct  19   VMEQSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYV 78
Query  73   NVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHD 132
            ++QEF        D         +LK AF+++D+D NG IS+ EL   L  +GE     +
Sbjct  79   SLQEFV-------DLNNKGASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEE 131
Query  133  CVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQ 166
               +I +VD +GDG +S EEF+ MMT++  + S+
Sbjct  132  SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK 165

Sequence Alignment: 6. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 60.7 bits 294,  Expect = 2e-11
 Identities = 48/140 34%, Positives = 76/140 54%, Gaps = 0/140 0%
Query  21   VQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAF 80
            ++  F+ FD   +G IS D +  +L+ LG     + +  I+ E+D D  G +  QEF  +
Sbjct  12   LKKAFDAFDREKNGFISTDMVGTILEMLGHPLDDDMLEEIIAEVDADGSGELEFQEFVTL 71
Query  81   VKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV 140
                     +   + ELKEAF LYD++ NG I++  L +IL  L ++    D   MI+ +
Sbjct  72   AARFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEI 131
Query  141  DSDGDGYVSFEEFKKMMTNK 160
            DSDG G V F+EF ++MT +
Sbjct  132  DSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 7. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 60.2 bits 291,  Expect = 3e-11
 Identities = 50/144 34%, Positives = 79/144 54%, Gaps = 4/144 2%
Query  15   LQEPNE----VQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDG 70
            LQ P E    ++  F+ FD    G IS + +  +L+ +G   ++  +  +++E+D DK G
Sbjct  6    LQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSG 65
Query  71   FINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAE 130
             +   EF  +         S   E EL+EAF LYD++ NG I +  L +IL  L E+   
Sbjct  66   RLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTS 125
Query  131  HDCVEMIKSVDSDGDGYVSFEEFKKMMT 158
             +   MI+ +D+DG G V F+EF +MMT
Sbjct  126  DELDMMIEEIDADGSGTVDFDEFMEMMT 153

Sequence Alignment: 8. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 59.3 bits 286,  Expect = 6e-11
 Identities = 45/140 32%, Positives = 78/140 55%, Gaps = 0/140 0%
Query  21   VQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAF 80
            ++  F+ FD    G IS + +  +L+ LG+   ++ +  I+ E+D D  G +  +EF  +
Sbjct  12   LKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDEIIAEVDADGSGELEFEEFCTL 71
Query  81   VKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV 140
                     +   ++EL+EAF LYD++ NG I++  L +IL  L ++    D   MI+ +
Sbjct  72   ASRFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEI 131
Query  141  DSDGDGYVSFEEFKKMMTNK 160
            DSDG G V F+EF ++MT +
Sbjct  132  DSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 9. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 58.5 bits 281,  Expect = 1e-10
 Identities = 47/143 32%, Positives = 78/143 54%, Gaps = 3/143 2%
Query  18   PNEVQ---GVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
            P ++Q     F+ FD    G IS + +  +L+ LG     + +  I+ E+D D  G +  
Sbjct  6    PEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGELEF 65
Query  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCV 134
            +EF ++         +   + EL+EAF LYD++ NG I++  L +IL  L ++    D  
Sbjct  66   EEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKITAEDLD 125
Query  135  EMIKSVDSDGDGYVSFEEFKKMMTNK 160
             MI+ +DSDG G V F+EF ++MT +
Sbjct  126  MMIEEIDSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 10. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 57.6 bits 276,  Expect = 2e-10
 Identities = 44/134 32%, Positives = 74/134 55%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD +  G I  + ++ +L+ LG    + ++ +++ EID D  G +   EF  +    
Sbjct  18   FDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++  E +  EMI  +D+DG
Sbjct  78   LVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 11. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 57.6 bits 276,  Expect = 2e-10
 Identities = 44/134 32%, Positives = 74/134 55%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD +  G I  + ++ +L+ LG    + ++ +++ EID D  G +   EF  +    
Sbjct  18   FDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++  E +  EMI  +D+DG
Sbjct  78   LVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 12. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 57.1 bits 273,  Expect = 3e-10
 Identities = 43/134 32%, Positives = 73/134 54%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD    G I  + ++ +L+ LG    ++++ +++ EID D  G +   EF  +    
Sbjct  18   FDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++    +  EMI  +D+DG
Sbjct  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 13. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 56.9 bits 272,  Expect = 3e-10
 Identities = 43/134 32%, Positives = 71/134 52%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAE 84
            FN FD  G G I+ + +  +L+ +G   S++ +  ++ E D D  G +  +EFA +    
Sbjct  16   FNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEFAELAAKF 75
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                     + EL+EAF +YD+D  G I++  L +IL  L  +    D   +I+ VD DG
Sbjct  76   LIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPTDLEGIIEEVDEDG 135
Query  145  DGYVSFEEFKKMMT 158
             G + F+EF +MM+
Sbjct  136  SGTLDFDEFMEMMS 149

Sequence Alignment: 14. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 56.8 bits 271,  Expect = 3e-10
 Identities = 43/134 32%, Positives = 72/134 53%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD    G I  + ++ +L+ LG    ++++  ++ EID D  G +   EF  +    
Sbjct  18   FDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQTLITEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++    +  EMI  +D+DG
Sbjct  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 15. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 55.8 bits 265,  Expect = 7e-10
 Identities = 44/146 30%, Positives = 76/146 52%, Gaps = 0/146 0%
Query  12   SVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGF 71
            S+  ++ + +Q  F+ FD +  G I+ + +  +L+ +G   S++ +  ++ E D D  G 
Sbjct  3    SLDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDGSGE 62
Query  72   INVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEH 131
            +  +EF  +             + EL+EAF +YD+  NG I++  L +IL  L  R  E 
Sbjct  63   LEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEE 122
Query  132  DCVEMIKSVDSDGDGYVSFEEFKKMM 157
            D   +I+ VD DG G + F EF +MM
Sbjct  123  DLDSIIEEVDEDGSGTLDFNEFMQMM 148

Sequence Alignment: 16. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 52.0 bits 244,  Expect = 5e-09
 Identities = 41/67 61%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            QE  E + +F RFDANGDGKIS  EL   LK LGS T  EEI R+M EIDTD DGFI+ +
Sbjct  6    QEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTP-EEIQRMMAEIDTDGDGFISFE 64
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  65   EFTVFARA 72

Sequence Alignment: 17. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 51.8 bits 243,  Expect = 6e-09
 Identities = 40/69 57%, Positives = 49/69 71%, Gaps = 1/69 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            +E  E++ +F RFDANGDGKIS  EL   LK LGS T  EEI R+M EIDTD DGFI+ +
Sbjct  3    EEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTP-EEIQRMMAEIDTDGDGFISFE 61
Query  76   EFAAFVKAET 85
            EF  F +A +
Sbjct  62   EFKDFARANS 71

Sequence Alignment: 18. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 49.9 bits 232,  Expect = 2e-08
 Identities = 38/67 56%, Positives = 46/67 68%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            Q+  E + +F RFDANGDGKIS  EL   LK LGS T  +E+  +M EIDTD DGFI+ Q
Sbjct  7    QDKAERERIFKRFDANGDGKISAAELGEALKTLGSITP-DEVKHMMAEIDTDGDGFISFQ 65
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  66   EFTDFARA 73

Sequence Alignment: 19. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 49.9 bits 232,  Expect = 2e-08
 Identities = 38/67 56%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            Q+  + + +F RFD NGDGKIS  EL   LK LGS TS +EI R+M EIDTD DGFI+ +
Sbjct  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTS-DEIVRMMAEIDTDGDGFISFE 66
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  67   EFTEFARA 74

Sequence Alignment: 20. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 49.3 bits 228,  Expect = 4e-08
 Identities = 38/67 56%, Positives = 46/67 68%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            Q+  E + +F RFDANGDGKIS  EL   LK LGS T  +E+  +M EIDTD DGFI+ Q
Sbjct  7    QDKAERERIFKRFDANGDGKISAAELGEALKTLGSITP-DEVKHMMAEIDTDGDGFISFQ 65
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  66   EFTDFGRA 73

Sequence Alignment: 21. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 48.9 bits 226,  Expect = 4e-08
 Identities = 35/64 54%, Positives = 46/64 71%, Gaps = 1/64 1%
Query  19   NEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFA 78
            ++++ +F RFD NGDGKIS  EL   L+ LGS TS +E+ R+M EIDTD DGFI+  EF 
Sbjct  3    DDMERIFKRFDTNGDGKISLSELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDFNEFI 61
Query  79   AFVKA 83
            +F  A
Sbjct  62   SFCNA 66

Sequence Alignment: 22. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 48.9 bits 226,  Expect = 4e-08
 Identities = 35/68 51%, Positives = 47/68 69%, Gaps = 1/68 1%
Query  15   LQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
            + +  +++ +F RFD NGDGKIS  EL   L+ LGS TS +E+ R+M EIDTD DGFI+ 
Sbjct  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 59
Query  75   QEFAAFVKA 83
             EF +F  A
Sbjct  60   DEFISFCNA 68

Sequence Alignment: 23. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 48.9 bits 226,  Expect = 4e-08
 Identities = 35/68 51%, Positives = 47/68 69%, Gaps = 1/68 1%
Query  15   LQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
            + +  +++ +F RFD NGDGKIS  EL   L+ LGS TS +E+ R+M EIDTD DGFI+ 
Sbjct  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 61
Query  75   QEFAAFVKA 83
             EF +F  A
Sbjct  62   DEFISFCNA 70

Sequence Alignment: 24. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 48.7 bits 225,  Expect = 5e-08
 Identities = 37/67 55%, Positives = 45/67 67%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            Q+  E + +F  FDANGDGKIS  EL   LK LGS T  +E+  +M EIDTD DGFI+ Q
Sbjct  7    QDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTP-DEVKHMMAEIDTDGDGFISFQ 65
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  66   EFTNFARA 73

Sequence Alignment: 25. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 49.8 bits 230,  Expect = 5e-08
 Identities = 41/138 29%, Positives = 80/138 57%, Gaps = 11/138 7%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIM-----EEIDTDKDG 70
            ++ ++ +  F  FD  GD KI+  ++  +++ALG N +  EI +I+     EE++  K  
Sbjct  48   EQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKK-- 105
Query  71   FINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAE 130
             I  +EF   ++A  +     G   ++ E + ++D++ NG +   EL  +L  LGE+  E
Sbjct  106  -ITFEEFLPMLQAAANN-KDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTE 163
Query  131  HDCVEMIKSVDSDGDGYVSFEEF-KKMMT 158
             +  E++K    D +G +++E F K +M+
Sbjct  164  EEVEELMKG-QEDSNGCINYEAFVKHIMS 191

Sequence Alignment: 26. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 48.6 bits 224,  Expect = 6e-08
 Identities = 36/66 54%, Positives = 45/66 68%, Gaps = 1/66 1%
Query  17   EPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQE 76
            E  E   +F +FDANGDGKIS  EL   LK LGS  + ++I R+M EIDTD DG+I+ QE
Sbjct  5    EKAEHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQE 63
Query  77   FAAFVKA 83
            F+ F  A
Sbjct  64   FSDFASA 70

Sequence Alignment: 27. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 48.6 bits 224,  Expect = 6e-08
 Identities = 36/66 54%, Positives = 45/66 68%, Gaps = 1/66 1%
Query  17   EPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQE 76
            E  E   +F +FDANGDGKIS  EL   LK LGS  + ++I R+M EIDTD DG+I+ QE
Sbjct  6    EKAEHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQE 64
Query  77   FAAFVKA 83
            F+ F  A
Sbjct  65   FSDFASA 71

Sequence Alignment: 28. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 48.6 bits 224,  Expect = 6e-08
 Identities = 36/67 53%, Positives = 45/67 67%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            Q+  + + +F RFD NGDGKIS  EL   LK LGS T  +E+ R+M EIDTD DGFI+  
Sbjct  8    QDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTP-DEVRRMMAEIDTDGDGFISFD 66
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  67   EFTDFARA 74

Sequence Alignment: 29. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 49.7 bits 229,  Expect = 6e-08
 Identities = 42/139 30%, Positives = 83/139 59%, Gaps = 11/139 7%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIM-----EEIDTDKDG 70
            Q+ +E +  F  FD  G+ KI+  ++  VL+ALG+N +  E+ +++     EE++  K  
Sbjct  48   QQQDEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKK-- 105
Query  71   FINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAE 130
             I  ++F   ++A ++     G   ++ E + ++D++ NG +   EL  +L  LGE+  E
Sbjct  106  -IEFEQFLPMLQAISNN-KDQGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKE 163
Query  131  HDCVEMIKSVDSDGDGYVSFEEF-KKMMTN 159
             + VE + +   D +G +++E F K +M+N
Sbjct  164  EE-VEALMAGQEDSNGCINYEAFVKHIMSN 192

Sequence Alignment: 30. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 48.4 bits 223,  Expect = 6e-08
 Identities = 36/63 57%, Positives = 48/63 76%, Gaps = 1/63 1%
Query  20   EVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAA 79
            E + +F RFD+NGDGKIS  EL   LKALGS T+ +E+ R+M EIDTD DG I+++EF++
Sbjct  10   EQERIFKRFDSNGDGKISSSELGEALKALGSVTA-DEVHRMMAEIDTDGDGAISLEEFSS 68
Query  80   FVKA 83
            F  A
Sbjct  69   FADA 72

Sequence Alignment: 31. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 44.3 bits 199,  Expect = 1e-06
 Identities = 33/67 49%, Positives = 42/67 62%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
            ++  E   +F  FD NGDGKIS  EL   L  LGS  S EE+  +M+E+DTD DG+I+  
Sbjct  4    EDKAECDRIFGAFDKNGDGKISAAELGESLTKLGS-VSPEEVQTMMDELDTDGDGYISYD 62
Query  76   EFAAFVKA 83
            EFA F  A
Sbjct  63   EFAEFFNA 70

Sequence Alignment: 32. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 43.1 bits 192,  Expect = 2e-06
 Identities = 31/63 49%, Positives = 42/63 66%, Gaps = 1/63 1%
Query  20   EVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAA 79
            E + +F +FD +GDGKIS  EL   LK LGS  + +++ R+M +IDTD DG I+ QEF  
Sbjct  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
Query  80   FVKA 83
            F  A
Sbjct  64   FASA 67

Sequence Alignment: 33. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 43.6 bits 194,  Expect = 3e-06
 Identities = 40/135 29%, Positives = 72/135 53%, Gaps = 6/135 4%
Query  21   VQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAA- 79
            V+  F+ +D  G+G +    +   L+AL  N +   I ++  + +  K+  I ++EF   
Sbjct  13   VKFAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIEKVGGK-EKRKEKIIKLEEFIPI 71
Query  80   FVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKS 139
            F + + D    +G   ++ E ++LYD+  NG +   EL  IL  LGER  + +   ++K 
Sbjct  72   FAQVKKDK--DAGSYEDFMEVLKLYDKSENGTMMYAELEHILLSLGERLEKSELEPVLKE 129
Query  140  V--DSDGDGYVSFEEFKKMMT 158
               + D DG++ +E F K MT
Sbjct  130  CCNEEDEDGFIPYEPFLKKMT 150

Sequence Alignment: 34. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 40.4 bits 175,  Expect = 3e-05
 Identities = 37/131 28%, Positives = 67/131 51%, Gaps = 6/131 4%
Query  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEF-AAFVKA 83
            F+ +D  G G +    +   L+AL  N +   I ++  +    K+  + V +F   F + 
Sbjct  17   FSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKK-KEKMLKVDDFLPIFAQV 75
Query  84   ETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV--D 141
            + D    +G   ++ E ++LYD+  NG +   EL  IL  LGER  + +   ++K    +
Sbjct  76   KKD--KDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDE 133
Query  142  SDGDGYVSFEEFKKMMT 158
             D DG++ +E F K +T
Sbjct  134  EDEDGFIPYEPFLKKLT 150

Sequence Alignment: 35. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 40.2 bits 174,  Expect = 3e-05
 Identities = 35/136 25%, Positives = 70/136 51%, Gaps = 7/136 5%
Query  18   PNEVQGV---FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
            P EV+     F+ +D +G  K+    L  +L++L    +++ + +   E    +  F+  
Sbjct  6    PPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK-FMTF 64
Query  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCV 134
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE+  + +  
Sbjct  65   EEFLP-IYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVE 123
Query  135  EMIKSVDS--DGDGYVSFEEFKK 155
            E+IK+     D +G++ +E F K
Sbjct  124  EIIKTCGGGCDDEGFMKYETFIK 146

Sequence Alignment: 36. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 33.4 bits 135,  Expect = 0.003
 Identities = 24/65 36%, Positives = 40/65 61%, Gaps = 3/65 4%
Query  95   NELKEAFELYDQDHNGLISSVELHKILTRL--GER-YAEHDCVEMIKSVDSDGDGYVSFE 151
            +ELK+AFE+ DQD +G+I   EL   L  +  G R   + +  + +K+ DSD DG +  +
Sbjct  42   DELKKAFEIIDQDKSGFIEEEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGID 101
Query  152  EFKKMMTN 159
            EF  ++ +
Sbjct  102  EFAALINH 109

Sequence Alignment: 37. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 33.3 bits 134,  Expect = 0.003
 Identities = 24/62 38%, Positives = 38/62 61%, Gaps = 3/62 4%
Query  96   ELKEAFELYDQDHNGLISSVELHKILT--RLGER-YAEHDCVEMIKSVDSDGDGYVSFEE 152
            +LK+AFE+ DQD +G+I   EL   L   + G R   + +    +K+ D+DGDG +  +E
Sbjct  43   DLKKAFEIIDQDKSGFIEEEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDE 102
Query  153  FKKMM 157
            F  M+
Sbjct  103  FAVMI 107

Sequence Alignment: 38. Allergen Name: Der p 26.0101 Sequence ID: QAT18638

 Score = 33.1 bits 133,  Expect = 0.004
 Identities = 28/109 25%, Positives = 54/109 49%, Gaps = 5/109 4%
Query  18   PNEVQGV---FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
            P EV+     F+ +D  G GK+    L  +L++L    ++E + +   E    +  ++  
Sbjct  6    PPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK-YMTF 64
Query  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERY 128
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE +
Sbjct  65   EEFLP-IYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENW 117

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.