The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGP
DDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITD
MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGS
NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF
SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72987 Ory s 1 275 1916 381.0 2.4e-107
AAF72985 Ory s 1 286 1433 287.4 3.8e-79
AAF72984 Ory s 1 268 1416 284.1 3.5e-78
AAF72988 Ory s 1 327 1332 267.9 3.3e-73
AAB61710 Ory s 1 261 1295 260.7 3.9e-71
AAF72989 Ory s 1 271 1274 256.6 6.8e-70
AAD10496 Tri a ps93 271 1242 250.4 5e-68
ACA23876 Pas n 1.0101 265 1124 227.5 3.8e-61
P58738 Zea m 1 269 1114 225.6 1.5e-60
AAF72990 Ory s 1 269 1053 213.8 5.3e-57
AAF72991 Ory s 1 267 1033 209.9 7.8e-56
AAF72983 Ory s 1 267 973 198.3 2.5e-52
A0A4D6G2J8 Uro m 1.0201 229 968 197.3 4.2e-52
P43213 Phl p 1 263 949 193.6 6.1e-51
CAB63699 Lol p 1.0103 263 942 192.3 1.6e-50
CAA10520 Poa p a 263 941 192.1 1.8e-50
CAA10140 Hol l 1 263 941 192.1 1.8e-50
P43216 Hol l 1 265 939 191.7 2.4e-50
A0A4D6FZ45 Uro m 1.0101 262 931 190.1 6.8e-50
AAL14079 Cyn d 1.0203 262 931 190.1 6.8e-50
AAA63279 Lol p 1.0101 263 931 190.1 6.8e-50
CAA93121 Hol l 1.0102 248 929 189.7 8.5e-50
CAA81613 Phl p 1.0101 263 928 189.6 1e-49
P14946 Lol p 1 263 925 189.0 1.5e-49
AAL14078 Cyn d 1 262 923 188.6 2e-49
Q41260 Pha a 1 269 921 188.2 2.7e-49
AAA63278 Lol p 1.0102 252 920 188.0 2.9e-49
QCX36431 Zoy m 1.0101 272 920 188.0 3.1e-49
AAL14077 Cyn d 1.0202 262 918 187.6 3.9e-49
O04701 Cyn d 1 246 916 187.2 4.8e-49
AAA50175 Gly m 2 277 903 184.7 3.1e-48
AAF80379 Cyn d 1.0204 244 895 183.1 8.1e-48
AAK96255 Cyn d 1.0201 244 894 182.9 9.2e-48
ABC58726 Sor h 1.0101 239 891 182.4 1.4e-47
Q07154 Zea m 1 191 860 176.3 7.2e-46
AAF72986 Ory s 1 275 837 171.9 2.2e-44
Q40638 Ory s 1 263 806 165.9 1.3e-42
CAB37496 Ara t expansin 265 457 98.3 3.1e-22
BAA85432 Ory s 1 284 371 81.6 3.4e-17
AAG13596 Ory s 1 275 351 77.7 4.9e-16
CAA10348 Poa p 2 122 195 47.4 3e-07
CAA10345 Dac g 2 122 195 47.4 3e-07
P43214 Phl p 2 122 195 47.4 3e-07
CAA10346 Cyn d 2 122 190 46.4 5.9e-07
P14947 Lol p 2 97 161 40.7 2.4e-05
P93124 Dac g 3 96 153 39.2 6.9e-05
2JNZ_A Phl p 3.0101 108 150 38.6 0.00012
CAA51775 Lol p 2 88 143 37.2 0.00025
Q7M1X8 Dac g 1.0101 34 127 33.9 0.00092
AAP80171 Cyn d 15 112 134 35.5 0.001
Q7M1X6 Ant o 1.0101 32 109 30.4 0.0098
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 381.0 bits 1916,  Expect = 2e-107
 Identities = 275/275 100%, Positives = 275/275 100%, Gaps = 0/275 0%
Query  1    MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGP 60
            MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGP
Sbjct  1    MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGP 60
Query  61   DDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITD 120
            DDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITD
Sbjct  61   DDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITD 120
Query  121  MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGS 180
            MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGS
Sbjct  121  MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGS 180
Query  181  NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
            NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF
Sbjct  181  NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
Query  241  SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS 275
            SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS
Sbjct  241  SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS 275

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 287.4 bits 1433,  Expect = 4e-79
 Identities = 210/270 77%, Positives = 232/270 85%, Gaps = 17/270 6%
Query  5    MGS--KVAAILAILSVLVVHGSCK--------------GHPVNYNVSDASAYGSGWLPAR 48
            MGS   +AA    LS+L V G C               G+  ++N SDA+ Y   W  AR
Sbjct  1    MGSLSSLAAAAVFLSLLAV-GHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKAR 59
Query  49   ATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPS 108
            ATWYG P GAGPDDNGGACGFK+ NQYPF SMTSCGN+P+FKDGKGCGSCY+IRC KD S
Sbjct  60   ATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQS 119
Query  109  CSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP 168
            CSG  ETVIITDMNYYPVA +HFDLSGTAFG +AKPGLNDKLRHSGIIDI+F RVPC +P
Sbjct  120  CSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFP 179
Query  169  GLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIW 228
            GLKI FHVEE SNPVYFAVLVEYED DGDVVQVDLMESK+A+G  TG WTPMRESWGSIW
Sbjct  180  GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIW 239
Query  229  RLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS 275
            RLD+NHRLQAPFS+RIR++SGKTLVANNVIPANW PN+ YRS VQ+S
Sbjct  240  RLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 284.1 bits 1416,  Expect = 4e-78
 Identities = 204/262 77%, Positives = 226/262 86%, Gaps = 7/262 2%
Query  7    SKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGA 66
            SK AA+ A++S LVV       P N++ SD +A    W  ARATWYGAPTGAGPDD+GGA
Sbjct  6    SKKAAVAALFSFLVVTCVAGARPGNFSASDFTA-DPNWEVARATWYGAPTGAGPDDDGGA 64
Query  67   CGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPV 126
            CGFKN NQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC   P+CSGN ETVIITDMNYYPV
Sbjct  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
Query  127  ARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYFA 186
            ++YHFDLSGTAFGAMAKPG ND+LRH+GIIDIQF+RVPCN+PGLK+ FHVEEGSNPVYFA
Sbjct  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFA 184
Query  187  VLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRS 246
            VLVEYED DGDVVQVDLME+ S        WTPMRESWGSIWRLDSNHRL APFSLRI +
Sbjct  185  VLVEYEDGDGDVVQVDLMEANSQ------SWTPMRESWGSIWRLDSNHRLTAPFSLRITN 238
Query  247  DSGKTLVANNVIPANWSPNSNYRSIVQFS 275
            +SGK LVA+ VIPANW+P + YRS VQ+S
Sbjct  239  ESGKQLVASQVIPANWAPMAVYRSFVQYS 267

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 267.9 bits 1332,  Expect = 3e-73
 Identities = 186/234 79%, Positives = 205/234 87%, Gaps = 4/234 1%
Query  41   GSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQ 100
            G GWL ARATWYGAP GAGPDDNGGACGFKNVN  PFS+MTSCGNEP+FKDGKGCGSCYQ
Sbjct  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
Query  101  IRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQF 160
            IRC   P+CSG  ETVIITDMNYYPV+ YHFDLSGTAFGAMAK   ND+LRH+GIIDIQF
Sbjct  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
Query  161  RRVPCNYPGLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGA----TGV 216
            RRVPC YPGL + FHVE+GSNPVY A+LVEYE+ DGDVVQVDLMES+ + GG     TGV
Sbjct  209  RRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGV 268
Query  217  WTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            WTPMRESWGSIWRLD+NH LQ PFSLRI ++SGKTL+A+ VIPA+W PN+ Y SIVQF
Sbjct  269  WTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 260.7 bits 1295,  Expect = 4e-71
 Identities = 184/258 71%, Positives = 213/258 82%, Gaps = 11/258 4%
Query  6    GSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGG 65
            G+    +  +LSVL  +G   G            Y + WLPA+ATWYG P GAGPDDNGG
Sbjct  3    GASAKVVAMLLSVLATYGFAAG----------VVYTNDWLPAKATWYGQPNGAGPDDNGG 52
Query  66   ACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYP 125
            ACGFKN NQYPF SMTSCGNEP+F+DGKGCG+CYQIRC  +PSCSG   TVIITDMNYYP
Sbjct  53   ACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYP 112
Query  126  VARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYF 185
            VARYHFDLSGTAFGAMA+PGLND+LRH+GIIDIQFRRVPC + GL +NFHVE GSNPVY+
Sbjct  113  VARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYL 172
Query  186  AVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIR 245
            AVLVE+ + DG VVQ+D+MES  + G  T VWTPMR SWGSIWRLD+NHRLQ P SLR+ 
Sbjct  173  AVLVEFANKDGTVVQLDVMESLPS-GKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMV 231
Query  246  SDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            S+SG+T++A+ VIPANW  N+NY S VQF
Sbjct  232  SESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 256.6 bits 1274,  Expect = 7e-70
 Identities = 178/260 68%, Positives = 212/260 81%, Gaps = 10/260 3%
Query  12   ILAILSVLVVHGSCKGHPVN------YNVSDASAYGSGWLPARATWYGAPTGAGPDDNGG 65
            +  +L VLVV   CKG          YN S+A    + W  A+ATWYG P GAG  DNGG
Sbjct  5    VYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGG 64
Query  66   ACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYP 125
            ACGFK VNQYPF  MTSCGN+P++K GKGCGSCY++RCN++P+CSGN +TV ITDMNY+P
Sbjct  65   ACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFP 124
Query  126  VARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYF 185
            +++YHFDLSG AFG +AKPG  D LR +GIID+QF RVPC +PGLK+ FHVEEGS+PVY+
Sbjct  125  LSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYL 184
Query  186  AVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIR 245
            AVLVEYE+ DGDV QVDL E+    G   G WTPMRESWGS+WRLDSNHRL+APFS+RIR
Sbjct  185  AVLVEYENGDGDVAQVDLKEA----GAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIR 240
Query  246  SDSGKTLVANNVIPANWSPNSNYRSIVQFS 275
            SDSGKTLVA +VIP NW+PN+ YRS VQ+S
Sbjct  241  SDSGKTLVAPDVIPLNWTPNTFYRSFVQYS 270

Sequence Alignment: 7. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 250.4 bits 1242,  Expect = 5e-68
 Identities = 173/267 64%, Positives = 217/267 81%, Gaps = 7/267 2%
Query  3    ARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDD 62
            A + S   A++A+LS+L    S +   VNY+ + A +Y SGWLPA+ATWYGAP GAGPDD
Sbjct  2    AGVSSNAIALVALLSMLFT--SVRS-AVNYDTAVARSYTSGWLPAKATWYGAPNGAGPDD 58
Query  63   NGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC--NKDPSCSGNIETVIITD 120
            NGGACGFKNVNQYP SSM +CGNEPIF  G+GCG CY+I+C  + +PSCSG    ++ITD
Sbjct  59   NGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITD 118
Query  121  MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGS 180
            MNYYPVARYH+DLSGTAFG+MAK GLND+LRH+GIID+QFRRVPCN+PG+K+ FHV+ GS
Sbjct  119  MNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPGMKVTFHVQRGS 178
Query  181  NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
            NP Y+AVLVEY ++DG VV+++LM++ +  G  TG W  MR SWGS+WR+D+N  +Q PF
Sbjct  179  NPNYLAVLVEYVNVDGTVVRMELMQTMN--GRPTGYWQDMRRSWGSVWRMDTNRPVQGPF 236
Query  241  SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            S+RI SD+GKTLVANN IPA W  +  Y S +QF
Sbjct  237  SIRITSDTGKTLVANNAIPAYWQQDHAYWSNLQF 270

Sequence Alignment: 8. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 227.5 bits 1124,  Expect = 4e-61
 Identities = 162/262 61%, Positives = 196/262 74%, Gaps = 11/262 4%
Query  5    MGS--KVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDD 62
            MGS  K+ A+ A+L+ LV  GSC    V    +  + Y   WLPA+ATWYG P GAGPDD
Sbjct  1    MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDD 60
Query  63   NGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMN 122
            NGGACG KNVN  P++  T+CGN PIFKDGKGCGSCY+IRCNK P CSG   TV ITDMN
Sbjct  61   NGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNK-PECSGQPVTVFITDMN 119
Query  123  YYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSN 181
            Y P+A YHFDLSG AFGAMAKPGLNDKLRH GI D++FRRV C Y G  KI FHVE+GSN
Sbjct  120  YEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSN 179
Query  182  PVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFS 241
            P Y+A+LV++   DGD+V ++L E  S        W PM+ SWG+IWR+D+   L  PFS
Sbjct  180  PNYLAMLVKFVADDGDIVLMELKEKSSD-------WKPMKLSWGAIWRMDTPKALVPPFS 232
Query  242  LRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            +R+ S+SGK ++A +VIP NW P++ Y S VQF
Sbjct  233  IRLTSESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 9. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 225.6 bits 1114,  Expect = 1e-60
 Identities = 158/264 59%, Positives = 197/264 74%, Gaps = 10/264 3%
Query  5    MGSKVAAIL---AILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPD 61
            MGS V  I+   A+L+ LV  GSC    V    +  + Y   WL ARATWYG P GAG  
Sbjct  1    MGSLVNNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAP 60
Query  62   DNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDM 121
            DNGGACG KNVN  P+S MT+CGN PIFKDGKGCGSCY++RC + P CSGN  TV ITDM
Sbjct  61   DNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDM 120
Query  122  NYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGS 180
            NY P+A YHFDLSG AFG++AKPGLNDK+RH GI+D++FRRV C YP G KI FH+E+G 
Sbjct  121  NYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGC 180
Query  181  NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
            NP Y+AVLV+Y   DGD+V +++ +  SA       W PM+ SWG+IWR+D+   L+ PF
Sbjct  181  NPNYLAVLVKYVADDGDIVLMEIQDKLSAE------WKPMKLSWGAIWRMDTAKALKGPF 234
Query  241  SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            S+R+ S+SGK ++A +VIPANW P++ Y S VQF
Sbjct  235  SIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 10. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 213.8 bits 1053,  Expect = 5e-57
 Identities = 149/264 56%, Positives = 193/264 73%, Gaps = 10/264 3%
Query  5    MGSKVAAIL---AILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPD 61
            MGS    I+   A+++ LV  GSC    V    +  + Y + WLPARATWYG P G+G  
Sbjct  1    MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST 60
Query  62   DNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDM 121
            DNGGACG KNVN  P++ M SCGN PIFKDG+GCGSCY+++C +  +CS    TV ITDM
Sbjct  61   DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM 120
Query  122  NYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGS 180
            NY P++ YHFD+SG AFGAMA PG   +LR +GIID+QFRRV C YPG  K+ FHVE+GS
Sbjct  121  NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS 180
Query  181  NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
            NP Y+AVLV++   DGDV+Q+DL E+          W PM+ SWG+IWR+D+   L+APF
Sbjct  181  NPNYLAVLVKFVADDGDVIQMDLQEA------GLPAWRPMKLSWGAIWRMDTATPLKAPF 234
Query  241  SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            S+R+ ++SGK+L+A +VIP NW P++ Y S VQF
Sbjct  235  SIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 209.9 bits 1033,  Expect = 8e-56
 Identities = 144/253 56%, Positives = 186/253 73%, Gaps = 7/253 2%
Query  15   ILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQ 74
            + + +V   SC    V    +  +AYG  WL AR TWYG P GAGPDDNGGACG+K++++
Sbjct  12   VAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDK 71
Query  75   YPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLS 134
             PF  M SCGN+PIFKDGKGCGSC++++C+K  +CS     + ITDMN  P+A YHFDLS
Sbjct  72   APFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLS 131
Query  135  GTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYED 193
            G AFGAMAK G +++LR +GIID+QFRRV C YPG  K+ FHVE+GSNP YFAVLV+Y  
Sbjct  132  GHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVG 191
Query  194  LDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLV 253
             DGDVV+V+L E  S        W P+ ESWG+IWR+D+   L+ PFSLR+ ++S + LV
Sbjct  192  GDGDVVKVELKEKGSEE------WKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLV 245
Query  254  ANNVIPANWSPNSNYRSIVQ 273
            AN+VIP NW  N+ Y+S +Q
Sbjct  246  ANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 198.3 bits 973,  Expect = 2e-52
 Identities = 133/253 52%, Positives = 182/253 71%, Gaps = 7/253 2%
Query  15   ILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQ 74
            +++ +V   SC    V    +  ++YG  WL A+ATWYGAP GAGP DNGGACG+K+V++
Sbjct  12   VVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDK 71
Query  75   YPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLS 134
             PF  M SCGN+PIFKDGKGCGSC++I+C+K  +CS     + +TDMN  P+A YHFDLS
Sbjct  72   APFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLS 131
Query  135  GTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYED 193
            G AFGAMAK G +++LR +GIID QFRRV C YP   KI FH+E+ SNP Y+A+LV+Y  
Sbjct  132  GLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVA 191
Query  194  LDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLV 253
             DGDVV+V++ E  S        W  ++ESWG+IWR+D+   L+ PFS+R+ ++ G+ ++
Sbjct  192  GDGDVVEVEIKEKGSEE------WKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKII 245
Query  254  ANNVIPANWSPNSNYRSIVQ 273
            A + IP  W  +S Y+S VQ
Sbjct  246  AEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 13. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 197.3 bits 968,  Expect = 4e-52
 Identities = 133/225 59%, Positives = 169/225 75%, Gaps = 7/225 3%
Query  44   WLPARATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC 103
            WL A+ATWYG PTGAGPDDNGGACG+K+VN+ PF+SM +CGN PIFKDG GCGSCY+I+C
Sbjct  4    WLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIKC 63
Query  104  NKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRV 163
            +K   CSG    V ITD NY P+A YHFDL+GTAFGAMAK G  +KLR +GIID+QFRRV
Sbjct  64   DKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRV 123
Query  164  PCNYPG-LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRE 222
             C YP   KI FHVE+G NP YFA+L++Y   DGD+V VD+ E  S        + P++ 
Sbjct  124  KCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEE------FIPLKH 177
Query  223  SWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            SWG+IWR+DS   ++ P ++R+ S+ G TLV ++ IP  W  ++ Y S +QF
Sbjct  178  SWGAIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 14. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 193.6 bits 949,  Expect = 6e-51
 Identities = 135/260 51%, Positives = 178/260 68%, Gaps = 8/260 3%
Query  5    MGSKVAAILAILSVLVVHGSCKGHP-VNYNVSDASAYGSGWLPARATWYGAPTGAGPDDN 63
            M S  + +L ++   V  GS  G P V    +  + YG  WL A++TWYG PTGAGP DN
Sbjct  1    MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  64   GGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNY 123
            GGACG+K+V++ PFS MT CGN PIFK G+GCGSC++I+C K  +CSG    V ITD N 
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  124  YPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNP 182
             P+A YHFDLSG AFGAMAK G   KLR +G +++QFRRV C YP G K+ FHVE+GSNP
Sbjct  121  EPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  183  VYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSL 242
             Y+A+LV+Y + DGDVV VD+ E           W  ++ESWG+IWR+D+  +L  PF++
Sbjct  181  NYLALLVKYVNGDGDVVAVDIKEK------GKDKWIELKESWGAIWRIDTPDKLTGPFTV 234
Query  243  RIRSDSGKTLVANNVIPANWSPNSNYRS 270
            R  ++ G    A +VIP  W  +++Y S
Sbjct  235  RYTTEGGTKTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 15. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 192.3 bits 942,  Expect = 2e-50
 Identities = 133/253 52%, Positives = 180/253 71%, Gaps = 12/253 4%
Query  7    SKVAAILAILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNG 64
            S V  ++A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNG
Sbjct  5    SSVLLVVALFAVFLGSAHGIAKVPP-GPNIT--AEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  65   GACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYY 124
            GACG+K+V++ PF+ MT CGN PIFKDG+GCGSC++I+C K  SCSG   TV ITD N  
Sbjct  62   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
Query  125  PVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPV 183
            P+A YHFDLSG AFG+MAK G   KLR +G +++QFRRV C YP G K  FHVE+ SNP 
Sbjct  122  PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPN 181
Query  184  YFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLR 243
            Y+A+LV+Y D DGDVV VD+ E           W  ++ESWG++WR+D+  +L  PF++R
Sbjct  182  YLAILVKYVDGDGDVVAVDIKEK------GKDKWIELKESWGAVWRIDTPDKLTGPFTVR 235
Query  244  IRSDSGKTLVANNVIPANWSPNSNY 268
              ++ G      +VIP  W  +++Y
Sbjct  236  YTTEGGTKSEVEDVIPEGWKADTSY 260

Sequence Alignment: 16. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 192.1 bits 941,  Expect = 2e-50
 Identities = 136/255 53%, Positives = 180/255 70%, Gaps = 12/255 4%
Query  7    SKVAAILAILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNG 64
            S V  ++A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNG
Sbjct  5    SSVLLVVALFAVFLGTAHGIAKVPP-GPNIT--ATYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  65   GACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYY 124
            GACG+K+V++ PFS MT CGN PIFK G+GCGSC++I+C K  SCSG    V ITD N  
Sbjct  62   GACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEE 121
Query  125  PVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPV 183
            P+A YHFDLSG AFGAMAK G   KLR +G ++++FRRV C YP G K+ FHVE+GSNP 
Sbjct  122  PIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPN 181
Query  184  YFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLR 243
            Y+A+LV+Y   DGDVV VD+ E           W  ++ESWGSIWR+D+  +L  PF++R
Sbjct  182  YLALLVKYVTGDGDVVAVDIKEK------GKDKWIELKESWGSIWRVDTPDKLTGPFTVR 235
Query  244  IRSDSGKTLVANNVIPANWSPNSNYRS 270
              ++ G    A +VIP  W  ++ Y S
Sbjct  236  YTTEGGTKGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 17. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 192.1 bits 941,  Expect = 2e-50
 Identities = 134/255 52%, Positives = 182/255 71%, Gaps = 12/255 4%
Query  7    SKVAAILAILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNG 64
            S V  ++A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNG
Sbjct  5    SLVLLVVALFAVFLGTAHGIAKVPP-GPNIT--ATYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  65   GACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYY 124
            GACG+K+V++ PFS MT CGN PIFK G+GCGSC++I+C K  SCSG    V ITD N  
Sbjct  62   GACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEE 121
Query  125  PVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPV 183
            P+A YH+DLSG AFGAMAK G   KLR +G ++++FRRV C YP G K+ FHVE+GSNP 
Sbjct  122  PIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPN 181
Query  184  YFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLR 243
            Y+A+LV+Y D DGDVV VD+ E           W  ++ESWG++WR+D+  +L  PF++R
Sbjct  182  YLALLVKYVDGDGDVVAVDIKEK------GKDKWIELKESWGAVWRVDTPDKLTGPFTVR 235
Query  244  IRSDSGKTLVANNVIPANWSPNSNYRS 270
              ++ G  + A +VIP  W  ++ Y S
Sbjct  236  YTTEGGTKVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 18. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 191.7 bits 939,  Expect = 2e-50
 Identities = 135/252 53%, Positives = 180/252 71%, Gaps = 11/252 4%
Query  9    VAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACG 68
            VAA++A++ +   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNGGACG
Sbjct  12   VAALFAVF-LGSAHGIAKVPP-GPNIT--ATYGDEWLDAKSTWYGKPTGAGPKDNGGACG 67
Query  69   FKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVAR 128
            +K+V++ PFS MT CGN PIFKDG+GCGSC++I+C K  SCSG   TV ITD N  P+A 
Sbjct  68   YKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIAP 127
Query  129  YHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPVYFAV 187
            YHFDLSG AFG+MAK G   KLR +G ++++FRRV C YP G K  FHVE+GSNP Y+A+
Sbjct  128  YHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLAL 187
Query  188  LVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSD 247
            LV+Y D DGDVV VD+ E           W  ++ESWG++WR+D+  +L  PF++R  ++
Sbjct  188  LVKYIDGDGDVVAVDIKEK------GKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTE 241
Query  248  SGKTLVANNVIPANWSPNSNYRS 270
             G    A +VIP  W  ++ Y +
Sbjct  242  GGTKGEAEDVIPEGWKADTAYEA 264

Sequence Alignment: 19. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 190.1 bits 931,  Expect = 7e-50
 Identities = 136/256 53%, Positives = 187/256 73%, Gaps = 12/256 4%
Query  11   AILAILSVLVVHGS-CK-GHPVNYNVSDASAYGSGWLPARATWYGA-PTGAGPDDNGGAC 67
            A++A++   +V G+ C  G     N++  + YG  WL A+AT+YG+ P GA PDD+GGAC
Sbjct  3    AVVAVVLASMVGGALCAMGDKPGPNIT--ATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  68   GFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVA 127
            G+K+V++ PF SMT CGNEPIFKDG GCGSCY+I+C +   CSG    + ITD NY  +A
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  128  RYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFA 186
             YHFDLSG AFGAMAK G  DKLR +G + +QFRRV C YP   KI FHVE+GSNP Y+A
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  187  VLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRS 246
            +LV+Y   DG++V VD+ +SK      +  + PM++SWG+IWR+D    L+ PF++R+ S
Sbjct  181  LLVKYAAGDGNIVSVDI-KSKG-----SDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTS 234
Query  247  DSGKTLVANNVIPANWSPNSNYRSIVQF 274
            +SG  +   +VIP +W P++ Y+S +QF
Sbjct  235  ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 20. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 190.1 bits 931,  Expect = 7e-50
 Identities = 136/256 53%, Positives = 187/256 73%, Gaps = 12/256 4%
Query  11   AILAILSVLVVHGS-CK-GHPVNYNVSDASAYGSGWLPARATWYGA-PTGAGPDDNGGAC 67
            A++A++   +V G+ C  G     N++  + YG  WL A+AT+YG+ P GA PDD+GGAC
Sbjct  3    AVVAVVLASMVGGALCAMGDKPGPNIT--ATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  68   GFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVA 127
            G+K+V++ PF SMT CGNEPIFKDG GCGSCY+I+C +   CSG    + ITD NY  +A
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  128  RYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFA 186
             YHFDLSG AFGAMAK G  DKLR +G + +QFRRV C YP   KI FHVE+GSNP Y+A
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  187  VLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRS 246
            +LV+Y   DG++V VD+ +SK      +  + PM++SWG+IWR+D    L+ PF++R+ S
Sbjct  181  LLVKYAAGDGNIVSVDI-KSKG-----SDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTS 234
Query  247  DSGKTLVANNVIPANWSPNSNYRSIVQF 274
            +SG  +   +VIP +W P++ Y+S +QF
Sbjct  235  ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 21. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 190.1 bits 931,  Expect = 7e-50
 Identities = 132/253 52%, Positives = 179/253 70%, Gaps = 12/253 4%
Query  7    SKVAAILAILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNG 64
            S V  ++A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNG
Sbjct  5    SSVLLVVALFAVFLGSAHGIAKVPP-GPNIT--AEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  65   GACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYY 124
            GACG+KNV++ PF+ MT CGN PIFKDG+GCGSC++I+C K  SCSG   TV ITD N  
Sbjct  62   GACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
Query  125  PVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPV 183
            P+A YHFDLSG AFG+MAK G    +R +G +++QFRRV C YP   K  FHVE+ SNP 
Sbjct  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
Query  184  YFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLR 243
            Y+A+LV+Y D DGDVV VD+ E           WT ++ESWG++WR+D+  +L  PF++R
Sbjct  182  YLAILVKYVDGDGDVVAVDIKEK------GKDKWTELKESWGAVWRIDTPDKLTGPFTVR 235
Query  244  IRSDSGKTLVANNVIPANWSPNSNY 268
              ++ G      +VIP  W  +++Y
Sbjct  236  YTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 22. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 189.7 bits 929,  Expect = 8e-50
 Identities = 131/240 54%, Positives = 172/240 71%, Gaps = 10/240 4%
Query  22   HGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMT 81
            HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNGGACG+K+V++ PFS MT
Sbjct  7    HGIAKVPP-GPNIT--ATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMT 63
Query  82   SCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAM 141
             CGN PIFKDG+GCGSC++I+C+K  SCSG   TV ITD N  P+A YHFDLSG AFG+M
Sbjct  64   GCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSM 123
Query  142  AKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQ 200
            AK G   KLR +G ++++FRRV C YP G K  FHVE+GSNP Y+A+LV+Y D DGDVV 
Sbjct  124  AKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA 183
Query  201  VDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPA 260
            VD+ E           W  ++ESWG++WR+D+  +L  PF++R  ++ G    A +VIP 
Sbjct  184  VDIKEK------GKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPE 237
Query  261  NWSPNSNYRS 270
             W  ++ Y +
Sbjct  238  GWKADTAYEA 247

Sequence Alignment: 23. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 189.6 bits 928,  Expect = 1e-49
 Identities = 133/260 51%, Positives = 174/260 66%, Gaps = 8/260 3%
Query  5    MGSKVAAILAILSVLVVHGSCKGHP-VNYNVSDASAYGSGWLPARATWYGAPTGAGPDDN 63
            M S  + +L +    V  GS  G P V    +  + YG  WL A++TWYG PT AGP DN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDN 60
Query  64   GGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNY 123
            GGACG+K+V++ PFS MT CGN PIFK G+GCGSC++I+C K  +CSG    V ITD N 
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  124  YPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNP 182
             P+A YHFDLSG AFG+MAK G   KLR +G ++IQFRRV C YP G K+ FHVE+GSNP
Sbjct  121  EPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  183  VYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSL 242
             Y+A+LV++   DGDVV VD+ E           W  ++ESWG+IWR+D+   L+ PF++
Sbjct  181  NYLALLVKFVAGDGDVVAVDIKEK------GKDKWIALKESWGAIWRIDTPEVLKGPFTV 234
Query  243  RIRSDSGKTLVANNVIPANWSPNSNYRS 270
            R  ++ G    A +VIP  W  ++ Y S
Sbjct  235  RYTTEGGTKGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 24. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 189.0 bits 925,  Expect = 2e-49
 Identities = 131/253 51%, Positives = 178/253 70%, Gaps = 12/253 4%
Query  7    SKVAAILAILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNG 64
            S V  ++A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNG
Sbjct  5    SSVLLVVALFAVFLGSAHGIAKVPP-GPNIT--AEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  65   GACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYY 124
            GACG+KNV++ PF+ MT CGN PIFKDG+GCGSC++I+C K  SCSG   TV ITD N  
Sbjct  62   GACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
Query  125  PVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPV 183
            P+A YHFDLSG AFG+MAK G    +R +G +++QFRRV C YP   K  FHVE+ SNP 
Sbjct  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
Query  184  YFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLR 243
            Y+A+LV+Y D DGDVV VD+ E           W  ++ESWG++WR+D+  +L  PF++R
Sbjct  182  YLAILVKYVDGDGDVVAVDIKEK------GKDKWIELKESWGAVWRIDTPDKLTGPFTVR 235
Query  244  IRSDSGKTLVANNVIPANWSPNSNY 268
              ++ G      +VIP  W  +++Y
Sbjct  236  YTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 25. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 188.6 bits 923,  Expect = 2e-49
 Identities = 134/258 51%, Positives = 182/258 70%, Gaps = 11/258 4%
Query  9    VAAILAILSVLVVHGSCK-GHPVNYNVSDASAYGSGWLPARATWYGA-PTGAGPDDNGGA 66
            +AA+  +L+ +V    C  G     N++  + YG  WL A+AT+YG+ P GA PDD+GGA
Sbjct  2    LAAVAVVLASMVGGAWCAMGDKPGPNIT--ATYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
Query  67   CGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPV 126
            CG+K+V++ PF  MT CGNEPIFKDG GCGSCY+I+C +   CSG    + ITD NY  +
Sbjct  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
Query  127  ARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYF 185
            A YHFDLSG AFGAMAK G  DKLR +G + +QFRRV C YP   KI FHVE+GS+P Y+
Sbjct  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYL 179
Query  186  AVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIR 245
            A+LV+Y   DG++V VD+    S       V+ PM+ SWG+IWR+D    L+ PF++R+ 
Sbjct  180  ALLVKYAAGDGNIVGVDIKPKGS------DVFLPMKLSWGAIWRMDPPKPLKGPFTIRLT 233
Query  246  SDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            S+SG  +   +VIP +W P++ Y+S +QF
Sbjct  234  SESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 26. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 188.2 bits 921,  Expect = 3e-49
 Identities = 132/251 52%, Positives = 181/251 72%, Gaps = 14/251 5%
Query  7    SKVAAILAILSVLVVHGSCKGH---PVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDN 63
            S +  + A+L+V+V  GS +G    P   N++  + YG  WL A++TWYG PTGAGP DN
Sbjct  11   SSLLVVAALLAVFV--GSAQGIAKVPPGPNIT--AEYGDKWLDAKSTWYGKPTGAGPKDN 66
Query  64   GGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNY 123
            GGACG+K+V++ PF+ MT CGN PIFKDG+GCGSC++++C+K  SCSG   TV ITD N 
Sbjct  67   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNE 126
Query  124  YPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNP 182
             P+A YHFDLSG AFG+MAK G  + +R +G +++QFRRV C YP G K  FHVE+GSNP
Sbjct  127  EPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNP 186
Query  183  VYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSL 242
             Y+A+LV+Y D DGDVV VD+ E           W  ++ESWG+IWR+D+  +L  PF++
Sbjct  187  NYLALLVKYVDGDGDVVAVDIKEK------GKDKWIELKESWGAIWRIDTPDKLTGPFTV 240
Query  243  RIRSDSGKTLVANNVIPANWSPNSN 267
            R  ++ G      +VIP  W  +++
Sbjct  241  RYTTEGGTKAEFEDVIPEGWKADTH 265

Sequence Alignment: 27. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 188.0 bits 920,  Expect = 3e-49
 Identities = 129/246 52%, Positives = 175/246 71%, Gaps = 12/246 4%
Query  14   AILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKN 71
            A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNGGACG+K+
Sbjct  1    ALFAVFLGSAHGIAKVPP-GPNIT--AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKD 57
Query  72   VNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHF 131
            V++ PF+ MT CGN PIFKDG+GCGSC++I+C K  SCSG   TV ITD N  P+A YHF
Sbjct  58   VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHF 117
Query  132  DLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVE 190
            DLSG AFG+MAK G    +R +G +++QFRRV C YP   K  FHVE+GSNP Y+A+LV+
Sbjct  118  DLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVK 177
Query  191  YEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGK 250
            Y D DGDVV VD+ E           W  ++ESWG++WR+D+  +L  PF++R  ++ G 
Sbjct  178  YVDGDGDVVAVDIKEK------GKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 231
Query  251  TLVANNVIPANWSPNSNY 268
                 +VIP  W  +++Y
Sbjct  232  KSEVEDVIPEGWKADTSY 249

Sequence Alignment: 28. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 188.0 bits 920,  Expect = 3e-49
 Identities = 135/265 50%, Positives = 182/265 68%, Gaps = 11/265 4%
Query  2    AARMGSKVAAILAILSVLVVHGSCK-GHPVNYNVSDASAYGSGWLPARATWYGA-PTGAG 59
            +AR  +++AA+  +LS +V    C+ G     N++  + Y   W  A+AT+YG+ P GA 
Sbjct  5    SARRQAQLAAVAVLLSAMVGSALCEIGDKPGPNIT--ATYNEEWQDAKATFYGSNPRGAA 62
Query  60   PDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIIT 119
            PDD+GGACG+KNV++ PF  MT CGNEPIFKDG GCGSC++I+C +   CS     + IT
Sbjct  63   PDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRIT 122
Query  120  DMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEE 178
            D NY  +A YHFDLSG AFG+MAK G  D LR +G + +QFRRV C YP   KI FHVE+
Sbjct  123  DKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEK 182
Query  179  GSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQA 238
            G N  Y+A+LVEY   DGD+V VD+    S        + PM+ SWG+IWR+D    L+ 
Sbjct  183  GCNDNYLALLVEYAAGDGDIVAVDIKPKGSDE------FLPMKPSWGAIWRIDPKKPLKG 236
Query  239  PFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            PF++R+ S+SG  LV  +VIPA+W PN+ Y S +Q+
Sbjct  237  PFTVRLTSESGAKLVQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 29. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 187.6 bits 918,  Expect = 4e-49
 Identities = 134/256 52%, Positives = 185/256 72%, Gaps = 12/256 4%
Query  11   AILAILSVLVVHGS-CK-GHPVNYNVSDASAYGSGWLPARATWYGA-PTGAGPDDNGGAC 67
            A++A++   +V G+ C  G     N++  + YG  WL A+AT+YG+ P GA PDD+GGAC
Sbjct  3    AVVAVVLASMVGGALCAMGDKPGPNIT--ATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  68   GFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVA 127
            G+K+V++ PF  MT CGNEPIFKDG  CGSCY+I+C +   CSG    + ITD NY  +A
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  128  RYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNPVYFA 186
             YHFDLSG AFGAMAK G  DKLR +G + +QFRRV C YP   KI FHVE+GSNP Y+A
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  187  VLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRS 246
            +LV+Y   DG++V VD+ +SK      +  + PM++SWG+IWR+D    L+ PF++R+ S
Sbjct  181  LLVKYAAGDGNIVSVDI-KSKG-----SDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTS 234
Query  247  DSGKTLVANNVIPANWSPNSNYRSIVQF 274
            +SG  +   +VIP +W P++ Y+S +QF
Sbjct  235  ESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 30. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 187.2 bits 916,  Expect = 5e-49
 Identities = 131/231 56%, Positives = 169/231 73%, Gaps = 8/231 3%
Query  38   SAYGSGWLPARATWYGA-PTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCG 96
            + YGS WL ARAT+YG+ P GA PDD+GGACG+K+V++ PF  MT+CGNEPIFKDG GC 
Sbjct  12   ATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCR 71
Query  97   SCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGII 156
            +CY+I+C +   CSG    V ITD NY  +A YHFDLSG AFGAMAK G  DKLR +G +
Sbjct  72   ACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGEL 131
Query  157  DIQFRRVPCNYP-GLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATG 215
             +QFRRV C YP G KI FH+E+GSN  Y+A+LV+Y   DG++V VD+    S       
Sbjct  132  TLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDS------D 185
Query  216  VWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
             + PM+ SWG+IWR+D    L+ PFS+R+ S+ G  LV ++VIPANW P++ Y S +QF
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244

Sequence Alignment: 31. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 184.7 bits 903,  Expect = 3e-48
 Identities = 138/265 52%, Positives = 184/265 69%, Gaps = 12/265 4%
Query  4    RMGSKVAAILAILSV-LVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDD 62
            R  S++  ++AILS+ LV+   C      YN S  S   S W PA ATWYG   G G + 
Sbjct  7    RALSELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDGSE- 65
Query  63   NGGACGFKN-VNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITD- 120
             GGACG+ N V Q PFSS+ S G+  I+  GKGCGSCY+++C  + +CSGN   V+ITD 
Sbjct  66   -GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDE 124
Query  121  -MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEG 179
                   A+YHFDLSG AFGAMA  G ++ LR++G I+IQ RR+ CNYPG  I FHV+ G
Sbjct  125  CAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSG 184
Query  180  SNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAP 239
            SN  YFA LVEYED DGD+ +V+L E+       +G W  M++SWG++W++D    L+AP
Sbjct  185  SNQEYFATLVEYEDGDGDLAKVELKEALD-----SGSWDSMQQSWGAVWKFDKGSPLRAP 239
Query  240  FSLRIRS-DSGKTLVANNVIPANWSPNSNYRSIVQFS 275
            FS+++ + +SG+T+VANNVIPA W+P   YRSIV F+
Sbjct  240  FSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNFA 276

Sequence Alignment: 32. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 183.1 bits 895,  Expect = 8e-48
 Identities = 125/231 54%, Positives = 168/231 72%, Gaps = 8/231 3%
Query  38   SAYGSGWLPARATWYGA-PTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCG 96
            + YG  WL A+AT+YG+ P GA PDD+GGACG+K+V++ PF  MT CGNEPIFKDG  CG
Sbjct  12   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 71
Query  97   SCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGII 156
            SCY+I+C +   CSG    + ITD NY  +A YHFDLSG AFGAMAK G  DKLR +G +
Sbjct  72   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 131
Query  157  DIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATG 215
             +QFRRV C YP   KI FHVE+GS+P Y+A+LV+Y   DG++V VD+    S       
Sbjct  132  MLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGS------D 185
Query  216  VWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
             + PM++SWG+IWR+D    L+ PF++R+ S+SG  +  ++VIP +W P++ Y+S +QF
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 33. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 182.9 bits 894,  Expect = 9e-48
 Identities = 125/231 54%, Positives = 168/231 72%, Gaps = 8/231 3%
Query  38   SAYGSGWLPARATWYGA-PTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCG 96
            + YG  WL A+AT+YG+ P GA PDD+GGACG+K+V++ PF  MT CGNEPIFKDG  CG
Sbjct  12   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 71
Query  97   SCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGII 156
            SCY+I+C +   CSG    + ITD NY  +A YHFDLSG AFGAMAK G  DKLR +G +
Sbjct  72   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 131
Query  157  DIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATG 215
             +QFRRV C YP   KI FHVE+GS+P Y+A+LV+Y   DG++V VD+    S       
Sbjct  132  MLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGS------D 185
Query  216  VWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
             + PM++SWG+IWR+D    L+ PF++R+ S+SG  +  ++VIP +W P++ Y+S +QF
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 34. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 182.4 bits 891,  Expect = 1e-47
 Identities = 128/226 56%, Positives = 170/226 75%, Gaps = 12/226 5%
Query  33   NVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDG 92
            N+++   YGS WL  +ATWYG PTGAGPDDNGGACG+K+VN+ PF+SM +CGN PIFKDG
Sbjct  9    NITET--YGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDG 66
Query  93   KGCGSCYQIRCNKD-PS-CSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKL 150
              CGSC++I+C+K  P+ CSG    V ITDMNY  +A YHFDL+G AFGAMAK G  +KL
Sbjct  67   L-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEKL 125
Query  151  RHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAY 210
              +GIID++FRRV C Y G K+ FHVE+GSNP Y+A+LV+Y D DGD+V VD+ E     
Sbjct  126  AKAGIIDMKFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEK---- 180
Query  211  GGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNY 268
            GG    + P++ SWG+IWR DS   ++ P +++I ++ G     ++VIP  W  ++ Y
Sbjct  181  GG--DAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTY 236

Sequence Alignment: 35. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 176.3 bits 860,  Expect = 7e-46
 Identities = 117/189 61%, Positives = 150/189 79%, Gaps = 7/189 3%
Query  80   MTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFG 139
            MT+CGN PIFKDGKGCGSCY++RC + P CSGN  TV ITDMNY P+A YHFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  140  AMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPVYFAVLVEYEDLDGDV 198
            ++AKPGLNDKLRH GI+D++FRRV C YP G KI FH+E+G NP Y AVLV++   DGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  199  VQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVI 258
            V +++ +  SA       W PM+ SWG+IWR+D+   L+ PFS+R+ S+SGK ++A ++I
Sbjct  121  VLMEIQDKLSAE------WKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDII 174
Query  259  PANWSPNSNYRSIVQF 274
            PANW P++ Y S VQF
Sbjct  175  PANWRPDAVYTSNVQF 190

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 171.9 bits 837,  Expect = 2e-44
 Identities = 133/264 50%, Positives = 180/264 68%, Gaps = 21/264 7%
Query  1    MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAY----GSGWLPARATWYGAPT 56
            M +R G+ V A+L  L +L +  S  G+  NY     S      G GW    ATWYG P 
Sbjct  1    MVSR-GTFVFAVLVALPILSLPVS--GYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQ 57
Query  57   GAGPDDNGGACGFKN-VNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIET 115
            G G +  GGACG+++ V Q PFSSM + G   +FK+GKGCGSCYQI+C  + +CSG   T
Sbjct  58   GDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVT 115
Query  116  VIITDMNYYPVA---RYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKI 172
            V+ITD     V      HFD+SGTAFGAMA  G+ D+LR +G++ IQ++RVPC +  + +
Sbjct  116  VVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNV 174
Query  173  NFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDS 232
             F V+ GSNP Y+A+LV+Y + DGD+  V +M+++   GG  G W  M++SWG+ WRL+S
Sbjct  175  AFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKAR---GG--GGWKAMQQSWGATWRLNS 229
Query  233  N--HRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS 275
            N    L  PFS+R+ S SGK LVANNVIP+ W     YRS V ++
Sbjct  230  NTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYA 274

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 165.9 bits 806,  Expect = 1e-42
 Identities = 119/246 48%, Positives = 163/246 66%, Gaps = 11/246 4%
Query  5    MGSKVAAILAILSVLVVHGSCKGHP-VNYNVSDASAYGSGWLPARATWYGAPTGAGPDDN 63
            M S    +  ++   +V  S  GHP V    +  ++YG  WL AR      P    P DN
Sbjct  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
Query  64   GGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNY 123
            GGACG+K+V++ PF  M SCGN+PIFKDGKGCGSC++I+C+K  +CS     + +TDMN 
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  124  YPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNP 182
             P+A YHFDLSG    AMAK G +++LR +GIID QFRRV C YP   KI FH+E+ SNP
Sbjct  121  EPIAAYHFDLSGL---AMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
Query  183  VYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSL 242
             Y+A+LV+Y   DGDVV+V++ E  S        W  ++ESWG+IWR+D+   L+ PFS+
Sbjct  178  NYLALLVKYVAGDGDVVEVEIKEKGSEE------WKALKESWGAIWRIDTPKPLKGPFSV 231
Query  243  RIRSDSGKTLVANNVIP 259
            R+ ++  +   A + IP
Sbjct  232  RVTTEGARRSSAEDAIP 248

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 98.3 bits 457,  Expect = 3e-22
 Identities = 81/203 39%, Positives = 123/203 60%, Gaps = 16/203 7%
Query  63   NGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPS-CSGNIETVIITDM 121
            + GAC + ++    F+   +     I+KDG GCG+C+Q+RC K+P+ CS    TVI+TD+
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRC-KNPTLCSSKGTTVIVTDL 99
Query  122  NYYPVARYHFDLSGTAFGAMAKP--GLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEG 179
            N     +  + LS  AF AMAKP  G +  L   GI+DI++RRVPC+Y   K+N  VEE 
Sbjct  100  N--KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGNKKMNVRVEES 157
Query  180  S-NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDS--NHRL 236
            S NP Y+A+ + Y+    +VV + + +  S++      W+ M  S G++W  D   N  L
Sbjct  158  SKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSH------WSYMTRSHGAVWVTDKVPNGAL 211
Query  237  QAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS 275
            Q  F +    D GK + +  V+PANW    +Y + VQ +
Sbjct  212  QFRFVVTAGYD-GKMVWSQRVLPANWEAGKSYDAGVQIT 249

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 81.6 bits 371,  Expect = 3e-17
 Identities = 77/215 35%, Positives = 123/215 57%, Gaps = 37/215 17%
Query  42   SGWLPARATWYGAPTGAGPDDNGGACGFKNVNQYP-FSSMTSCGNEPIFKDGKGCGSCYQ 100
            S W    AT+YG P+G G DD GGACG+ + +    +S+ T+  + P+F DG GCG CY+
Sbjct  50   SDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYE 108
Query  101  IRCNKDPSCSGNIETVIITDMN------YYPV--------ARYHFDLSGTAFGAMAKPGL 146
            +RC K P C+    +V+IT  N      Y P          R+HFD++  +F  +A+   
Sbjct  109  LRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ--- 165
Query  147  NDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMES 206
                R +GI+ +Q+RRVPC   G  + F ++   N  ++ + V      GDV  + +   
Sbjct  166  ----RVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSV--- 215
Query  207  KSAYGGATGVWTPMRESWGSIWR----LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANW 262
            K++ GG  G W     +WG  ++    LD++  L     L   S   +T++ ++ I   W
Sbjct  216  KTSGGG--GAWIQAAHNWGITYQVFAALDNSDGLTV--KLTTYSTPQQTIIVSDAISPWW 271
Query  263  SPNSNYRSIVQF 274
                 Y+    F
Sbjct  272  ITGLCYQGSNNF 283

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 77.7 bits 351,  Expect = 5e-16
 Identities = 63/204 30%, Positives = 108/204 52%, Gaps = 15/204 7%
Query  63   NGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMN 122
            N G+CG+ ++         +  +  +F+ G GCG+C+Q+RC     CS     V++TD  
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
Query  123  YYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSN 181
                 R  + LS  A+ AMA+PG+  +LR    +D++++RVPC Y  G  ++  VEE S 
Sbjct  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
Query  182  PVY-FAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
            P   +++   Y+    D+V VD+     A  G++  W  M   +G  W   + +    P+
Sbjct  169  PPRELSIRFLYQGGQTDIVAVDV-----ATVGSSN-WKFMTRDYGPAW--STAQAPAGPL 220
Query  241  SLRIRSDSG---KTLVANN-VIPANWSPNSNYRSIVQFS 275
             +R+    G   K + A+  V+P  W+    Y + VQ +
Sbjct  221  QFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIA 259

Sequence Alignment: 41. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 47.4 bits 195,  Expect = 3e-07
 Identities = 35/89 39%, Positives = 56/89 62%, Gaps = 10/89 11%
Query  171  KINFHVEEGSNPVYFAVLVEYEDLDGDVV-QVDLMESKSAYGGATGVWTPMRESWGSIWR 229
            K+ F VE+GSN  ++AVLV+YE   GD + +V+L E  S        W  M +  G +W 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE---GDTMAEVELREHGSDE------WVAMTKGEGGVWT 79
Query  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNY 268
            +DS   LQ PF++R  ++ G   V ++V+P  ++  + Y
Sbjct  80   FDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 47.4 bits 195,  Expect = 3e-07
 Identities = 35/89 39%, Positives = 56/89 62%, Gaps = 10/89 11%
Query  171  KINFHVEEGSNPVYFAVLVEYEDLDGDVV-QVDLMESKSAYGGATGVWTPMRESWGSIWR 229
            K+ F VE+GSN  ++AVLV+YE   GD + +V+L E  S        W  M +  G +W 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE---GDTMAEVELREHGSDE------WVAMTKGEGGVWT 79
Query  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNY 268
            +DS   LQ PF++R  ++ G   V ++V+P  ++  + Y
Sbjct  80   FDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 47.4 bits 195,  Expect = 3e-07
 Identities = 35/89 39%, Positives = 56/89 62%, Gaps = 10/89 11%
Query  171  KINFHVEEGSNPVYFAVLVEYEDLDGDVV-QVDLMESKSAYGGATGVWTPMRESWGSIWR 229
            K+ F VE+GSN  ++AVLV+YE   GD + +V+L E  S        W  M +  G +W 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE---GDTMAEVELREHGSDE------WVAMTKGEGGVWT 79
Query  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNY 268
            +DS   LQ PF++R  ++ G   V ++V+P  ++  + Y
Sbjct  80   FDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 46.4 bits 190,  Expect = 6e-07
 Identities = 34/89 38%, Positives = 56/89 62%, Gaps = 10/89 11%
Query  171  KINFHVEEGSNPVYFAVLVEYEDLDGDVV-QVDLMESKSAYGGATGVWTPMRESWGSIWR 229
            K+ F VE+GSN  ++AVLV+YE   GD + +V+L E  S        W  M +  G +W 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE---GDTMAEVELREHGSDE------WVAMTKGEGGVWT 79
Query  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNY 268
            +DS   L+ PF++R  ++ G   V ++V+P  ++  + Y
Sbjct  80   FDSEEPLKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 40.7 bits 161,  Expect = 2e-05
 Identities = 25/92 27%, Positives = 53/92 57%, Gaps = 6/92 6%
Query  172  INFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLD 231
            + F VE+GS+   +A+ ++Y      + +V+L E  S        W  ++++   +W + 
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNE------WLALKKNGDGVWEIK 57
Query  232  SNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYR 269
            S+  L+ PF++R  S+ G   V ++V+PA++   + Y+
Sbjct  58   SDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 39.2 bits 153,  Expect = 7e-05
 Identities = 27/92 29%, Positives = 50/92 54%, Gaps = 7/92 7%
Query  170  LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWR 229
            +K+ F VE+GS+P  + + ++Y      + +V+L +  S        W P+ +  G++W 
Sbjct  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEE------WEPLTKK-GNLWE 53
Query  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNY 268
            + S+  L  PF++R  S  G   V + VIP  +   + Y
Sbjct  54   VKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 47. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 38.6 bits 150,  Expect = 0.0001
 Identities = 26/93 27%, Positives = 51/93 54%, Gaps = 7/93 7%
Query  170  LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWR 229
            +++ F V++GS+P  + + ++Y      + +V+L +  S        W P+ +  G++W 
Sbjct  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEE------WEPLTKK-GNVWE 65
Query  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYR 269
            + S+  L  PF++R  S  G   V + VIP  +S    Y+
Sbjct  66   VKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 48. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 37.2 bits 143,  Expect = 0.0002
 Identities = 26/82 31%, Positives = 52/82 63%, Gaps = 8/82 9%
Query  174  FHVEEGSNPVYFAVLVEYEDLDGDVV-QVDLMESKSAYGGATGVWTPMRESWGSIWRLDS 232
            F VE+GS+   +A+ ++Y   +GD + +V+L E  S        W  ++++   +W + S
Sbjct  2    FTVEKGSDEKNLALSIKYSK-EGDAMAEVELKEHGSNE------WLALKKNGDGVWEIKS 54
Query  233  NHRLQAPFSLRIRSDSGKTLVANNVIPANW 262
            +  L+ PF++R  S+ G   V ++V+PA++
Sbjct  55   DKPLKGPFNFRFVSEKGMWNVFDDVVPADF 84

Sequence Alignment: 49. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 33.9 bits 127,  Expect = 0.0009
 Identities = 17/30 56%, Positives = 22/30 73%, Gaps = 2/30 6%
Query  29   PVNYNVSDASAYGSGWLPARATWYGAPTGAGP 60
            P   N++  + YG  WL A++TWYG PTGAGP
Sbjct  5    PPGPNIT--ATYGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 50. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 35.5 bits 134,  Expect = 0.001
 Identities = 36/92 39%, Positives = 62/92 67%, Gaps = 13/92 14%
Query  170  LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWR 229
            + I FHVEE S+P  FA+ +  +D   ++ QVD+ E      GA  +  PM +S G  W 
Sbjct  20   VNIIFHVEE-SSP-KFALSI--KDSAKEITQVDVREH-----GADNM-DPMTKS-GDSWT 68
Query  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274
            +D    L+ P+++R+R++ G + V ++VIP NW   ++Y + ++F
Sbjct  69   IDKP--LKGPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 51. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 30.4 bits 109,  Expect = 0.01
 Identities = 15/28 53%, Positives = 20/28 71%, Gaps = 2/28 7%
Query  29   PVNYNVSDASAYGSGWLPARATWYGAPTGA 58
            P   N++  + YG  WL A++TWYG PTGA
Sbjct  5    PPGPNIT--ATYGDKWLDAKSTWYGKPTGA 32

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.