The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIF
ADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVG
LHAAQ
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9LDX4 Tri a 25.0101 125 794 218.2 5.3e-59
Q4W1F7 Zea m 25.0101 128 611 169.5 2.5e-44
CAI78451 Mala s 13.0101 105 276 80.5 1.3e-17
CBW45298 Plo i 2.0101 106 269 78.6 4.6e-17
AJ937745 Asp f 29.0101 110 265 77.5 1e-16
AJ937744 Asp f 28.0101 108 263 77.0 1.4e-16
Q9UW02 Cop c 2 106 261 76.5 2e-16
AAL79931 Fus c 2 121 222 66.0 3.3e-13
CAA58999 Alt a 4 433 102 33.3 0.0086
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 25.0101 Sequence ID: Q9LDX4

 Score = 218.2 bits 794,  Expect = 5e-59
 Identities = 125/125 100%, Positives = 125/125 100%, Gaps = 0/125 0%
Query  1    MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIF 60
            MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIF
Sbjct  1    MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIF 60
Query  61   ADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVG 120
            ADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVG
Sbjct  61   ADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVG 120
Query  121  LHAAQ 125
            LHAAQ
Sbjct  121  LHAAQ 125

Sequence Alignment: 2. Allergen Name: Zea m 25.0101 Sequence ID: Q4W1F7

 Score = 169.5 bits 611,  Expect = 2e-44
 Identities = 92/122 75%, Positives = 105/122 86%, Gaps = 0/122 0%
Query  3    ASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFAD 62
            A+AA AT  A   G VI++HSLE+W++QIEEAN+AKKLVVIDFTA+WC PCR MAPIFAD
Sbjct  6    AAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFAD 65
Query  63   LAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLH 122
            +AKK P  VFLKVDVDE+K+IAEQFSVEAMPTFLFM+EGDVKDRVVGA KEEL  K+ LH
Sbjct  66   MAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELH 125
Query  123  AA 124
             A
Sbjct  126  MA 127

Sequence Alignment: 3. Allergen Name: Mala s 13.0101 Sequence ID: CAI78451

 Score = 80.5 bits 276,  Expect = 1e-17
 Identities = 42/94 44%, Positives = 59/94 62%, Gaps = 4/94 4%
Query  30   QIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAV---FLKVDVDELKSIAEQ 86
            Q ++     K+VVIDF A+WCGPC+++ P+F  ++   PA     F KVDVDE   IA++
Sbjct  9    QFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDT-PAGDKVGFYKVDVDEQSQIAQE 67
Query  87   FSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLHAA 124
              + AMPTF+F K G   D VVGA   +L   +  H+A
Sbjct  68   VGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105

Sequence Alignment: 4. Allergen Name: Plo i 2.0101 Sequence ID: CBW45298

 Score = 78.6 bits 269,  Expect = 5e-17
 Identities = 42/99 42%, Positives = 66/99 66%, Gaps = 3/99 3%
Query  19   ISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFP-AAVFLKVDV 77
            I +  +E  T ++ EA    KLVVIDF A+WCGPC+I+ P + ++A +   + V +KVDV
Sbjct  3    IHIKDVEDLTARLTEA--GDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV 60
Query  78   DELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKV 119
            DE + IA ++S+  MPTF+F+K G   ++  GA  E+L + +
Sbjct  61   DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTI 102

Sequence Alignment: 5. Allergen Name: Asp f 29.0101 Sequence ID: AJ937745

 Score = 77.5 bits 265,  Expect = 1e-16
 Identities = 40/103 38%, Positives = 66/103 64%, Gaps = 5/103 4%
Query  22   HSLEQWT-MQI--EEANAAKKLVVIDFTASWCGPCRIMAPIFADLA--KKFPAAVFLKVD 76
            H++E+ T  ++  E+       V++D +A+WCGPC+ ++P+F  L+  ++F  A F ++D
Sbjct  3    HNVEKITDAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYEID 62
Query  77   VDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLHAA 124
            VDEL  +A ++ V AMPTF+F K+G   + VVGA    L   +  H A
Sbjct  63   VDELSEVAAELGVRAMPTFMFFKDGQKVNEVVGANPPALEAAIKAHVA 110

Sequence Alignment: 6. Allergen Name: Asp f 28.0101 Sequence ID: AJ937744

 Score = 77.0 bits 263,  Expect = 1e-16
 Identities = 35/79 44%, Positives = 57/79 72%, Gaps = 1/79 1%
Query  41   VVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKE 100
            VV+DF A+WCGPCR +AP   +L++K+    F++VDVD+++S+A + ++ AMPTF++ K+
Sbjct  24   VVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDVDKVRSVAHEMNIRAMPTFVLYKD 83
Query  101  GD-VKDRVVGAIKEELTNKV 119
            G  ++ RVVG    EL   +
Sbjct  84   GQPLEKRVVGGNVRELEEMI 103

Sequence Alignment: 7. Allergen Name: Cop c 2 Sequence ID: Q9UW02

 Score = 76.5 bits 261,  Expect = 2e-16
 Identities = 38/81 46%, Positives = 55/81 67%, Gaps = 2/81 2%
Query  39   KLVVIDFTASWCGPCRIMAPIFADLAKKFPAA--VFLKVDVDELKSIAEQFSVEAMPTFL 96
            K+++IDF A+WCGPCR+++PIF  +++K+ A   VF KVDVD    I+E+  + AMPTF 
Sbjct  19   KIIIIDFWATWCGPCRVISPIFEKFSEKYGANNIVFAKVDVDTASDISEEAKIRAMPTFQ 78
Query  97   FMKEGDVKDRVVGAIKEELTNKV 119
              K+G   D +VGA    L + V
Sbjct  79   VYKDGQKIDELVGANPTALESLV 101

Sequence Alignment: 8. Allergen Name: Fus c 2 Sequence ID: AAL79931

 Score = 66.0 bits 222,  Expect = 3e-13
 Identities = 30/61 49%, Positives = 44/61 72%, Gaps = 3/61 4%
Query  41   VVIDFTASWCGPCRIMAPIFADLAKKF--PAAV-FLKVDVDELKSIAEQFSVEAMPTFLF 97
            VV+DF A WC PC+ +AP++  L+ K   P  + F KV+VD ++  A+Q+ + AMPTF+F
Sbjct  21   VVVDFFADWCPPCKAIAPVYEQLSTKHSVPDVLAFAKVNVDHVQDAAQQYGITAMPTFMF 80
Query  98   MKEG 101
             KEG
Sbjct  81   FKEG 84

Sequence Alignment: 9. Allergen Name: Alt a 4 Sequence ID: CAA58999

 Score = 33.3 bits 102,  Expect = 0.009
 Identities = 22/62 35%, Positives = 37/62 59%, Gaps = 15/62 24%
Query  39   KLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFM 98
            K V+++F A WCG C+ +AP + +L + + +        DEL  +     V+A  T+   
Sbjct  252  KDVLVEFYAPWCGHCKALAPKYEELGQLYAS--------DELSKLVTIAKVDA--TL--- 298
Query  99   KEGDVKDRVVGAIKEEL 115
               DV D + G +   L
Sbjct  299  --NDVPDEIQGFLPSSL 313

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.