The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK
LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG
ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA35597 Tri a 30.0101 168 1182 132.8 4.9e-33
CAA35597 Tri a TAI 168 1182 132.8 4.9e-33
CAA49557 Hor v 1 171 997 113.9 2.4e-27
CAA34709 Tri a TAI 143 244 37.0 0.00029
CAA49556 Hor v 1 149 230 35.6 0.0008
CAA35188 Hor v 1 144 222 34.7 0.0014
P01086 Hor v 1 144 222 34.7 0.0014
CAA46705 Hor v 1 148 222 34.8 0.0014
Q41540 Tri a 40.0101 143 221 34.6 0.0015
CAA42453 Tri a TAI 143 221 34.6 0.0015
CAA31794 Hor v 1 147 206 33.1 0.0043
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 30.0101 Sequence ID: CAA35597

 Score = 132.8 bits 1182,  Expect = 5e-33
 Identities = 168/168 100%, Positives = 168/168 100%, Gaps = 0/168 0%
Query  1    MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK 60
            MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK
Sbjct  1    MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK 60
Query  61   LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG 120
            LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG
Sbjct  61   LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG 120
Query  121  ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI 168
            ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI
Sbjct  121  ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI 168

Sequence Alignment: 2. Allergen Name: Tri a TAI Sequence ID: CAA35597

 Score = 132.8 bits 1182,  Expect = 5e-33
 Identities = 168/168 100%, Positives = 168/168 100%, Gaps = 0/168 0%
Query  1    MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK 60
            MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK
Sbjct  1    MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK 60
Query  61   LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG 120
            LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG
Sbjct  61   LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG 120
Query  121  ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI 168
            ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI
Sbjct  121  ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI 168

Sequence Alignment: 3. Allergen Name: Hor v 1 Sequence ID: CAA49557

 Score = 113.9 bits 997,  Expect = 2e-27
 Identities = 142/168 84%, Positives = 154/168 91%, Gaps = 3/168 1%
Query  1    MACKSSCSLLLLAAVLLSVLAAASASGS---CVPGVAFRTNLLPHCRDYVLQQTCGTFTP 57
            MACKSS SLLLLA V++SV+AAA+A+ +   C PGVAF TNLL HCRDYVLQQTC  FTP
Sbjct  1    MACKSSRSLLLLATVMVSVFAAAAAAAAATDCSPGVAFPTNLLGHCRDYVLQQTCAVFTP 60
Query  58   GSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSG 117
            GSKLPEWMTSA +  PG+PYLAKLYCCQELAEI QQCRCEALRYF+ALPVPSQPVDP +G
Sbjct  61   GSKLPEWMTSAELNYPGQPYLAKLYCCQELAEIPQQCRCEALRYFMALPVPSQPVDPSTG 120
Query  118  NVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI 168
            NVG+SGL+DLPGCPREMQ DFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI
Sbjct  121  NVGQSGLMDLPGCPREMQRDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI 171

Sequence Alignment: 4. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 37.0 bits 244,  Expect = 0.0003
 Identities = 86/140 61%, Positives = 107/140 76%, Gaps = 29/140 20%
Query  1    MACKSSCSLLLLAAVLLSVLAAASASGS--CVPGVAFRTNLLPHCRDYVLQQTCGTFTPG 58
            MA KS+C +LLLAAVL+S++AA +A G+  C P ++     LP CRDYV QQ C      
Sbjct  1    MASKSNC-VLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQAC------ 53
Query  59   SKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGN 118
                       I +PG PYLAK  CC ELA I QQCRC+ALRYF+  P  S+P       
Sbjct  54   ----------RIETPGSPYLAKQQCCGELANIPQQCRCQALRYFMG-P-KSRP------- 94
Query  119  VGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLW 167
              +SGL++LPGCPRE+Q DFVR+LV PG CNL T+HN  YC A+E+  W
Sbjct  95   -DQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAMEESQW 142

Sequence Alignment: 5. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 35.6 bits 230,  Expect = 0.0008
 Identities = 85/140 60%, Positives = 102/140 72%, Gaps = 29/140 20%
Query  1    MACKSSCSLLLLAAVLLSVLAAASASGS--CVPGVAFRTNLLPHCRDYVLQQTCGTFTPG 58
            MA KSSC LLL AAVL+S++AA +A GS  C P  A     LP CRDYV QQ C      
Sbjct  1    MASKSSCDLLL-AAVLVSIFAAVAAVGSEDCTPWTATPITPLPSCRDYVEQQAC------ 53
Query  59   SKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGN 118
                       I +PG PYLAK  CC ELA I QQCRC+ALR+F+           R   
Sbjct  54   ----------RIETPGPPYLAKQQCCGELANIPQQCRCQALRFFMG----------RKSR 93
Query  119  VGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLW 167
              +SGL++LPGCPRE+Q DFVR+LV PG CNL T+HN  YC A+++  W
Sbjct  94   PDQSGLMELPGCPREVQMDFVRILVTPGFCNLTTVHNTPYCLAMDEWQW 142

Sequence Alignment: 6. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 34.7 bits 222,  Expect = 0.001
 Identities = 63/134 47%, Positives = 78/134 58%, Gaps = 25/134 18%
Query  9    LLLLAAVLLSVLAAASAS--GSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMT 66
            LLL AAV+L++L A + S   SC PG A+  N L  CR YV+ Q C       + P  +T
Sbjct  7    LLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQIC------HQGPRLLT 60
Query  67   SASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLID 126
            S            K  CC EL+ I   CRCEALR  +      Q V    G    + + D
Sbjct  61   SD----------MKRRCCDELSAIPAYCRCEALRIIM------QGVVTWQGAFEGAYFKD 104
Query  127  LPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQP 165
             P CPRE Q  +   LV P +CNL TIH   YCP + QP
Sbjct  105  SPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPEL-QP 142

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 34.7 bits 222,  Expect = 0.001
 Identities = 63/134 47%, Positives = 78/134 58%, Gaps = 25/134 18%
Query  9    LLLLAAVLLSVLAAASAS--GSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMT 66
            LLL AAV+L++L A + S   SC PG A+  N L  CR YV+ Q C       + P  +T
Sbjct  7    LLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQIC------HQGPRLLT 60
Query  67   SASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLID 126
            S            K  CC EL+ I   CRCEALR  +      Q V    G    + + D
Sbjct  61   SD----------MKRRCCDELSAIPAYCRCEALRIIM------QGVVTWQGAFEGAYFKD 104
Query  127  LPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQP 165
             P CPRE Q  +   LV P +CNL TIH   YCP + QP
Sbjct  105  SPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPEL-QP 142

Sequence Alignment: 8. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 34.8 bits 222,  Expect = 0.001
 Identities = 63/134 47%, Positives = 78/134 58%, Gaps = 25/134 18%
Query  9    LLLLAAVLLSVLAAASAS--GSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMT 66
            LLL AAV+L++L A + S   SC PG A+  N L  CR YV+ Q C       + P  +T
Sbjct  7    LLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQIC------HQGPRLLT 60
Query  67   SASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLID 126
            S            K  CC EL+ I   CRCEALR  +      Q V    G    + + D
Sbjct  61   SD----------MKRRCCDELSAIPAYCRCEALRIIM------QGVVTWQGAFEGAYFKD 104
Query  127  LPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQP 165
             P CPRE Q  +   LV P +CNL TIH   YCP + QP
Sbjct  105  SPNCPRERQTSYAANLVTPQECNLGTIHGSAYCPEL-QP 142

Sequence Alignment: 9. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 34.6 bits 221,  Expect = 0.001
 Identities = 75/140 53%, Positives = 101/140 72%, Gaps = 29/140 20%
Query  1    MACKSSCSLLLLAAVLLSVLAAASASGS--CVPGVAFRTNLLPHCRDYVLQQTCGTFTPG 58
            MA KS+ +LL+  A+L+ ++AA +A G+  C P  +     LP CR+YV +Q C      
Sbjct  1    MASKSNYNLLF-TALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQAC------ 53
Query  59   SKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGN 118
                       I  PG PYLAK  CC++LA I QQCRC+ALRYF+  P  S+P       
Sbjct  54   ----------RIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMG-P-KSRP------- 94
Query  119  VGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLW 167
              +SGL++LPGCPRE+Q +FV +LV PG CNL T+HN  YC  +E+  W
Sbjct  95   -DQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQW 142

Sequence Alignment: 10. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 34.6 bits 221,  Expect = 0.001
 Identities = 75/140 53%, Positives = 101/140 72%, Gaps = 29/140 20%
Query  1    MACKSSCSLLLLAAVLLSVLAAASASGS--CVPGVAFRTNLLPHCRDYVLQQTCGTFTPG 58
            MA KS+ +LL+  A+L+ ++AA +A G+  C P  +     LP CR+YV +Q C      
Sbjct  1    MASKSNYNLLF-TALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQAC------ 53
Query  59   SKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGN 118
                       I  PG PYLAK  CC++LA I QQCRC+ALRYF+  P  S+P       
Sbjct  54   ----------RIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMG-P-KSRP------- 94
Query  119  VGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLW 167
              +SGL++LPGCPRE+Q +FV +LV PG CNL T+HN  YC  +E+  W
Sbjct  95   -DQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQW 142

Sequence Alignment: 11. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 33.1 bits 206,  Expect = 0.004
 Identities = 55/123 44%, Positives = 73/123 59%, Gaps = 28/123 22%
Query  9    LLLLAAVLLSVLAAASAS-----GSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPE 63
            ++L  AVLLSVLA A+A+       C  GV F  N L  C  YV+++ CG          
Sbjct  8    FVLSGAVLLSVLAVAAATLESVKDECQLGVDFPHNPLATCHTYVIKRVCGR--------- 58
Query  64   WMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESG 123
                     P +P L K  CC+ELA +  +CRCEALR ++        V    G V E  
Sbjct  59   --------GPSRPMLVKERCCRELAAVPDHCRCEALRILM------DGVRTPEGRVVEGR 104
Query  124  LIDLPGCPREMQWDFVRLLVAPGQCNLATIH 154
            L D   CPRE Q  F   LV   +CNL++++
Sbjct  105  LGDRRDCPREEQRAFAATLVTAAECNLSSVQ 135

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.