The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEF
ISFCNANPGLMKDVAKVF
Sequence Info Allergen Name Length Opt Bits Score E Value
O82040 Phl p 7 78 512 91.3 3.4e-21
P94092 Cyn d 7 80 482 86.5 9.5e-20
CAA62634 Cyn d 7 82 482 86.5 9.6e-20
AAL92871 Che a 3 86 374 69.2 1.6e-14
ALE34025 Sal k 7.0101 86 373 69.1 1.8e-14
P58171 Syr v 3 81 359 66.8 8e-14
O81092 Ole e 3 84 356 66.3 1.1e-13
P69197 Bra r 5.0101 79 354 66.0 1.4e-13
CAA73147 Bet v 4 85 354 66.0 1.4e-13
O81701 Aln g 4 85 353 65.9 1.6e-13
CAP05019 Par j 4.0101 84 352 65.7 1.8e-13
Q39419 Bet v 4 85 352 65.7 1.8e-13
BAA09633 Bra n 2 82 347 64.9 3.1e-13
Q39406 Bra n 2 83 347 64.9 3.1e-13
AY904434 Art v 5.0101 82 308 58.6 2.3e-11
Q2KN25 Amb a 10.0101 160 264 52.0 4.6e-09
O64943 Jun o 4 165 247 49.3 3.1e-08
ABP87672 Cup a 4.0101 177 245 49.0 4e-08
AAF31152 Ole e 8 171 234 47.2 1.3e-07
Q9M7R0 Ole e 8 171 226 45.9 3.3e-07
ACL36923 Tyr p 24.0101 153 177 38.0 6.9e-05
QBF67841 Der f 39.0101 153 177 38.0 6.9e-05
D2DGW3 Tyr p 34.0101 153 177 38.0 6.9e-05
QXY82447 Der p 39.0101 153 177 38.0 6.9e-05
ABB89298 Bla g 6.0301 154 159 35.2 0.00051
ABB89296 Bla g 6.0101 151 151 33.9 0.0012
ABB89297 Bla g 6.0201 151 150 33.7 0.0014
Q1M0Y3 Per a 6.0101 151 147 33.2 0.0019
P29291 Hom a 6.0101 150 143 32.6 0.003
ADV17344 Pen m 6.0101 150 134 31.1 0.0081
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 91.3 bits 512,  Expect = 3e-21
 Identities = 78/78 100%, Positives = 78/78 100%, Gaps = 0/78 0%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEF 60
            MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEF
Sbjct  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEF 60
Query  61   ISFCNANPGLMKDVAKVF 78
            ISFCNANPGLMKDVAKVF
Sbjct  61   ISFCNANPGLMKDVAKVF 78

Sequence Alignment: 2. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 86.5 bits 482,  Expect = 9e-20
 Identities = 75/78 96%, Positives = 77/78 98%, Gaps = 2/78 2%
Query  1    MAD--DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFN 58
            MAD  DME IFKRFDTNGDGKISL+ELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF+
Sbjct  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
Query  59   EFISFCNANPGLMKDVAKVF 78
            EFISFCNANPGLMKDVAKVF
Sbjct  61   EFISFCNANPGLMKDVAKVF 80

Sequence Alignment: 3. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 86.5 bits 482,  Expect = 1e-19
 Identities = 75/78 96%, Positives = 77/78 98%, Gaps = 2/78 2%
Query  1    MAD--DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFN 58
            MAD  DME IFKRFDTNGDGKISL+ELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF+
Sbjct  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 62
Query  59   EFISFCNANPGLMKDVAKVF 78
            EFISFCNANPGLMKDVAKVF
Sbjct  63   EFISFCNANPGLMKDVAKVF 82

Sequence Alignment: 4. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 69.2 bits 374,  Expect = 2e-14
 Identities = 57/75 76%, Positives = 64/75 85%, Gaps = 0/75 0%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
            D ERIFKRFDTNGDGKIS SEL DAL+TLGS + DEV+RMMAEIDTDGDGFI F+EF  F
Sbjct  12   DRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISFDEFTDF 71
Query  64   CNANPGLMKDVAKVF 78
              AN GL+KDV+K+F
Sbjct  72   ARANRGLVKDVSKIF 86

Sequence Alignment: 5. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 69.1 bits 373,  Expect = 2e-14
 Identities = 57/75 76%, Positives = 63/75 84%, Gaps = 0/75 0%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
            D ERIFKRFDTNGDGKIS SEL DAL+TLGS ++DE+ RMMAEIDTDGDGFI F EF  F
Sbjct  12   DRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEFTEF 71
Query  64   CNANPGLMKDVAKVF 78
              AN GL+KDVAK+F
Sbjct  72   ARANRGLIKDVAKIF 86

Sequence Alignment: 6. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 66.8 bits 359,  Expect = 8e-14
 Identities = 53/75 70%, Positives = 62/75 82%, Gaps = 0/75 0%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
            ++ERIFKRFD NGDGKIS SEL + L+TLGS + +E+QRMMAEIDTDGDGFI F EF  F
Sbjct  7    ELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEFKDF 66
Query  64   CNANPGLMKDVAKVF 78
              AN GL+KDVAK+F
Sbjct  67   ARANSGLIKDVAKIF 81

Sequence Alignment: 7. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 66.3 bits 356,  Expect = 1e-13
 Identities = 57/78 73%, Positives = 64/78 82%, Gaps = 6/78 7%
Query  1    MADD------MERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGF 54
            MADD       ERIFKRFD NGDGKIS SEL + L+TLGS + +E+QRMMAEIDTDGDGF
Sbjct  1    MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF 60
Query  55   IDFNEFISFCNANPGLMKDVAKVF 78
            I F EF  F  AN GL+KDVAK+F
Sbjct  61   ISFEEFTVFARANRGLVKDVAKIF 84

Sequence Alignment: 8. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 66.0 bits 354,  Expect = 1e-13
 Identities = 55/78 70%, Positives = 65/78 83%, Gaps = 1/78 1%
Query  1    MAD-DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNE 59
            MAD + ERIFK+FDT+GDGKIS +EL +AL+ LGS + D+V RMMA+IDTDGDG I F E
Sbjct  1    MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQE 60
Query  60   FISFCNANPGLMKDVAKVF 78
            F  F +ANPGLMKDVAKVF
Sbjct  61   FTEFASANPGLMKDVAKVF 79

Sequence Alignment: 9. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 66.0 bits 354,  Expect = 1e-13
 Identities = 57/78 73%, Positives = 64/78 82%, Gaps = 7/78 8%
Query  1    MADDM-------ERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDG 53
            MADD        ERIFKRFD NGDGKIS +EL +AL+TLGS + DEV+ MMAEIDTDGDG
Sbjct  1    MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDG 60
Query  54   FIDFNEFISFCNANPGLMKDVAKVF 78
            FI F EF  F  AN GL+KDVAK+F
Sbjct  61   FISFQEFTDFARANRGLLKDVAKIF 85

Sequence Alignment: 10. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 65.9 bits 353,  Expect = 2e-13
 Identities = 58/78 74%, Positives = 64/78 82%, Gaps = 7/78 8%
Query  1    MADDM-------ERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDG 53
            MADD        ERIFK FD NGDGKIS SEL DAL+TLGS + DEV+ MMAEIDTDGDG
Sbjct  1    MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDG 60
Query  54   FIDFNEFISFCNANPGLMKDVAKVF 78
            FI F EF +F  AN GL+KDVAK+F
Sbjct  61   FISFQEFTNFARANRGLVKDVAKIF 85

Sequence Alignment: 11. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 65.7 bits 352,  Expect = 2e-13
 Identities = 53/75 70%, Positives = 64/75 85%, Gaps = 0/75 0%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
            + ERIFKRFD+NGDGKIS SEL +AL+ LGS +ADEV+RMMAEIDTDGDG I + EF SF
Sbjct  10   EQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGAISLEEFSSF 69
Query  64   CNANPGLMKDVAKVF 78
             +AN GL+KD+AK+F
Sbjct  70   ADANRGLIKDIAKIF 84

Sequence Alignment: 12. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 65.7 bits 352,  Expect = 2e-13
 Identities = 57/78 73%, Positives = 64/78 82%, Gaps = 7/78 8%
Query  1    MADDM-------ERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDG 53
            MADD        ERIFKRFD NGDGKIS +EL +AL+TLGS + DEV+ MMAEIDTDGDG
Sbjct  1    MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDG 60
Query  54   FIDFNEFISFCNANPGLMKDVAKVF 78
            FI F EF  F  AN GL+KDVAK+F
Sbjct  61   FISFQEFTDFGRANRGLLKDVAKIF 85

Sequence Alignment: 13. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 64.9 bits 347,  Expect = 3e-13
 Identities = 50/75 66%, Positives = 62/75 82%, Gaps = 0/75 0%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
            + +RIFK+FD NGDGKIS SEL DAL+ LGS + D+++RMMAEIDTDGDG+I + EF  F
Sbjct  8    EHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSDF 67
Query  64   CNANPGLMKDVAKVF 78
             +AN GLMKDVAK+F
Sbjct  68   ASANRGLMKDVAKIF 82

Sequence Alignment: 14. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 64.9 bits 347,  Expect = 3e-13
 Identities = 50/75 66%, Positives = 62/75 82%, Gaps = 0/75 0%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
            + +RIFK+FD NGDGKIS SEL DAL+ LGS + D+++RMMAEIDTDGDG+I + EF  F
Sbjct  9    EHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSDF 68
Query  64   CNANPGLMKDVAKVF 78
             +AN GLMKDVAK+F
Sbjct  69   ASANRGLMKDVAKIF 83

Sequence Alignment: 15. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 58.6 bits 308,  Expect = 2e-11
 Identities = 49/78 62%, Positives = 60/78 76%, Gaps = 4/78 5%
Query  1    MADD----MERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFID 56
            MAD+     +RIF  FD NGDGKIS +EL ++L  LGS S +EVQ MM E+DTDGDG+I 
Sbjct  1    MADEDKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGYIS 60
Query  57   FNEFISFCNANPGLMKDVAKVF 78
            ++EF  F NAN GLMKDV K+F
Sbjct  61   YDEFAEFFNANRGLMKDVGKIF 82

Sequence Alignment: 16. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 52.0 bits 264,  Expect = 5e-09
 Identities = 40/62 64%, Positives = 51/62 82%, Gaps = 1/62 1%
Query  3    DDMERIFKRFDTNGDGKISLSELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDFNEFI 61
            +++ +IF RFDTNGDG+IS  EL   L++LGS TS DEV+R+MAEID DGDGFI ++EFI
Sbjct  16   EEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLDEFI 75
Query  62   SFC 64
             FC
Sbjct  76   LFC 78
 Score = 36.0 bits 164,  Expect = 0.0003
 Identities = 25/58 43%, Positives = 36/58 62%, Gaps = 1/58 1%
Query  3    DDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNEF 60
            +D++  FK +D N +G IS +EL   L  LG   S +    M+  +D+DGDGF+DF EF
Sbjct  89   NDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVESCADMIKSVDSDGDGFVDFEEF 147

Sequence Alignment: 17. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 49.3 bits 247,  Expect = 3e-08
 Identities = 38/75 50%, Positives = 53/75 70%, Gaps = 3/75 4%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFNEFIS 62
            ++E +FK+FD NGDGKIS SEL D LR+LGS   + EV+ MM E D DGDG++ + EF+ 
Sbjct  26   ELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVD 85
Query  63   FCNANPGL--MKDVAKVF 78
            + N    +  +K+  KVF
Sbjct  86   LNNKGASVKDLKNAFKVF 103

Sequence Alignment: 18. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 49.0 bits 245,  Expect = 4e-08
 Identities = 37/74 50%, Positives = 52/74 70%, Gaps = 2/74 2%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFNEFIS 62
            ++E +FK+FD NGDGKIS SEL D LR++GS   + EV+ MM E DTDGDG++ + EF+ 
Sbjct  38   ELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVD 97
Query  63   FCNANPGLMKDVAKVF 78
            + N     +KD+   F
Sbjct  98   L-NIKGATVKDLKNAF 112

Sequence Alignment: 19. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 47.2 bits 234,  Expect = 1e-07
 Identities = 37/64 57%, Positives = 47/64 73%, Gaps = 1/64 1%
Query  3    DDMERIFKRFDTNGDGKISLSELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDFNEFI 61
            ++++ +F RFD NGDGKIS  EL  AL+ LGS TS +E+ RMM EIDTD DGFI+  EF 
Sbjct  19   NEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFA 78
Query  62   SFCNA 66
            +F  A
Sbjct  79   AFVKA 83

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 45.9 bits 226,  Expect = 3e-07
 Identities = 35/64 54%, Positives = 46/64 71%, Gaps = 1/64 1%
Query  3    DDMERIFKRFDTNGDGKISLSELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDFNEFI 61
            ++++ +F RFD NGDGKIS  EL   L+ LGS TS +E+ R+M EIDTD DGFI+  EF 
Sbjct  19   NEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFA 78
Query  62   SFCNA 66
            +F  A
Sbjct  79   AFVKA 83

Sequence Alignment: 21. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 38.0 bits 177,  Expect = 7e-05
 Identities = 26/61 42%, Positives = 39/61 63%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNE 59
            M +++   F+ +D  G+G I  S L + LR L    + DE+  M+AEIDTDG G +DF+E
Sbjct  86   MQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDE 145
Query  60   FI 61
            F+
Sbjct  146  FM 147

Sequence Alignment: 22. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 38.0 bits 177,  Expect = 7e-05
 Identities = 26/61 42%, Positives = 39/61 63%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNE 59
            M +++   F+ +D  G+G I  S L + LR L    + DE+  M+AEIDTDG G +DF+E
Sbjct  86   MQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDE 145
Query  60   FI 61
            F+
Sbjct  146  FM 147

Sequence Alignment: 23. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 38.0 bits 177,  Expect = 7e-05
 Identities = 26/61 42%, Positives = 39/61 63%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNE 59
            M +++   F+ +D  G+G I  S L + LR L    + DE+  M+AEIDTDG G +DF+E
Sbjct  86   MQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDE 145
Query  60   FI 61
            F+
Sbjct  146  FM 147

Sequence Alignment: 24. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 38.0 bits 177,  Expect = 7e-05
 Identities = 26/61 42%, Positives = 39/61 63%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNE 59
            M +++   F+ +D  G+G I  S L + LR L    + DE+  M+AEIDTDG G +DF+E
Sbjct  86   MQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDE 145
Query  60   FI 61
            F+
Sbjct  146  FM 147

Sequence Alignment: 25. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 35.2 bits 159,  Expect = 0.0005
 Identities = 24/61 39%, Positives = 37/61 60%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFNE 59
            M  ++   F+ +D  G+G I  S L + LR L    ++DE+  M+ EID DG G +DF+E
Sbjct  88   MEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDE 147
Query  60   FI 61
            F+
Sbjct  148  FM 149

Sequence Alignment: 26. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 33.9 bits 151,  Expect = 0.001
 Identities = 21/61 34%, Positives = 39/61 63%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNE 59
            M  ++   F+ +D  G+G I+ + L + L+ L    +A+++  M+ EID+DG G +DF+E
Sbjct  84   MQQELREAFRLYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDE 143
Query  60   FI 61
            F+
Sbjct  144  FM 145

Sequence Alignment: 27. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 33.7 bits 150,  Expect = 0.001
 Identities = 21/61 34%, Positives = 39/61 63%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFNE 59
            M  ++   F+ +D  G+G I+ + L + L+ L    +A+++  M+ EID+DG G +DF+E
Sbjct  84   MQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDE 143
Query  60   FI 61
            F+
Sbjct  144  FM 145

Sequence Alignment: 28. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 33.2 bits 147,  Expect = 0.002
 Identities = 21/61 34%, Positives = 38/61 62%, Gaps = 1/61 1%
Query  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADE-VQRMMAEIDTDGDGFIDFNE 59
            M  +++  F+ +D  G+G I+ + L + L+ L     +E +  M+ EID+DG G +DF+E
Sbjct  84   MQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEIDSDGSGTVDFDE 143
Query  60   FI 61
            F+
Sbjct  144  FM 145

Sequence Alignment: 29. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 32.6 bits 143,  Expect = 0.003
 Identities = 21/62 33%, Positives = 36/62 58%, Gaps = 1/62 1%
Query  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADE-VQRMMAEIDTDGDGFIDFNEFIS 62
            ++   F+ +D  G+G I+   L + LR L +   +E +  ++ E+D DG G +DFNEF+ 
Sbjct  87   ELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEEDLDSIIEEVDEDGSGTLDFNEFMQ 146
Query  63   FCN 65
              N
Sbjct  147  MMN 149

Sequence Alignment: 30. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 31.1 bits 134,  Expect = 0.008
 Identities = 21/58 36%, Positives = 32/58 55%, Gaps = 1/58 1%
Query  3    DDMERIFKRFDTNGDGKISLSELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFNEF 60
            + + + F  FDT G G I+   +   LR +G   S   +Q ++AE D DG G ++F EF
Sbjct  10   ETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEF 68

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.