The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL
TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC
HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG
DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK
IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV
EEYLDQFV
Sequence Info Allergen Name Length Opt Bits Score E Value
E1U332 Ole e 12.0101 308 1965 454.4 2.5e-129
AAG22740 Bet v 6.0102 308 1656 384.0 3.9e-108
AAC05116 Bet v 6.0101 300 1611 373.8 4.6e-105
A0A0U1VZC8 Cor a 6.0101 308 1604 372.1 1.4e-104
AAC24001 Pyr c 5 308 1552 360.3 5.4e-101
H2DF86 Dau c 5.0101 306 1463 340.0 6.8e-95
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 12.0101 Sequence ID: E1U332

 Score = 454.4 bits 1965,  Expect = 2e-129
 Identities = 308/308 100%, Positives = 308/308 100%, Gaps = 0/308 0%
Query  1    MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL 60
            MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL
Sbjct  1    MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL 60
Query  61   TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC 120
            TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC
Sbjct  61   TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC 120
Query  121  HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG 180
            HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG
Sbjct  121  HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG 180
Query  181  DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK 240
            DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK
Sbjct  181  DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK 240
Query  241  IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV 300
            IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV
Sbjct  241  IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV 300
Query  301  EEYLDQFV 308
            EEYLDQFV
Sbjct  301  EEYLDQFV 308

Sequence Alignment: 2. Allergen Name: Bet v 6.0102 Sequence ID: AAG22740

 Score = 384.0 bits 1656,  Expect = 4e-108
 Identities = 250/308 81%, Positives = 283/308 91%, Gaps = 0/308 0%
Query  1    MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL 60
            MA K+KILIIGGTGYIGKFIVEASAKS HPTFAL REST+SDPVKGK+++ FK  GVT+L
Sbjct  1    MAHKSKILIIGGTGYIGKFIVEASAKSGHPTFALVRESTVSDPVKGKLVEKFKGLGVTLL 60
Query  61   TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC 120
             GDLYDHESLVKA KQVDVVISTVG+LQLADQVKIIAAIKEAGN+KRFFPS+FG DVDR 
Sbjct  61   HGDLYDHESLVKAFKQVDVVISTVGHLQLADQVKIIAAIKEAGNIKRFFPSEFGNDVDRV 120
Query  121  HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG 180
            HAVEPAK++F  K++IRR  EAEGIPYT+VS+N+FAGY LPTL QP +T+PPR+KV+I+G
Sbjct  121  HAVEPAKTAFATKAEIRRKTEAEGIPYTYVSSNFFAGYFLPTLAQPGLTSPPREKVVIFG 180
Query  181  DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK 240
            DGNA+AVFN+E+DIGTYTI+AVDD RTLNKI+YIKP KNIYSFNE+VALWEKKIGKTLEK
Sbjct  181  DGNARAVFNKEDDIGTYTIRAVDDPRTLNKIVYIKPAKNIYSFNEIVALWEKKIGKTLEK 240
Query  241  IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV 300
            IYVPEE++LK IQESP PIN+++AINHS FVKGD TNF+IE SFGVEASELYPDVKYTTV
Sbjct  241  IYVPEEKLLKDIQESPIPINVILAINHSVFVKGDHTNFEIEASFGVEASELYPDVKYTTV 300
Query  301  EEYLDQFV 308
            EEYL QFV
Sbjct  301  EEYLQQFV 308

Sequence Alignment: 3. Allergen Name: Bet v 6.0101 Sequence ID: AAC05116

 Score = 373.8 bits 1611,  Expect = 5e-105
 Identities = 243/300 81%, Positives = 276/300 92%, Gaps = 0/300 0%
Query  1    MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL 60
            MA K+KILIIGGTGYIGKFIVEASAKS HPTFAL REST+SDPVKGK+++ FK  GVT+L
Sbjct  1    MAHKSKILIIGGTGYIGKFIVEASAKSGHPTFALVRESTVSDPVKGKLVEKFKGLGVTLL 60
Query  61   TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC 120
             GDLYDHESLVKA KQVDVVISTVG+LQLADQVKIIAAIKEAGN+KRFFPS+FG DVDR 
Sbjct  61   HGDLYDHESLVKAFKQVDVVISTVGHLQLADQVKIIAAIKEAGNIKRFFPSEFGNDVDRV 120
Query  121  HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG 180
            HAVEPAK++F  K++IRR  EAEGIPYT+VS+N+FAGY LPTL QP +T+PPR+KV+I+G
Sbjct  121  HAVEPAKTAFATKAEIRRKTEAEGIPYTYVSSNFFAGYFLPTLAQPGLTSPPREKVVIFG 180
Query  181  DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK 240
            DGNA+AVFN+E+DIGTYTI+AVDD RTLNKI+YIKP KNIYSFNE+VALWEKKIGKTLEK
Sbjct  181  DGNARAVFNKEDDIGTYTIRAVDDPRTLNKIVYIKPAKNIYSFNEIVALWEKKIGKTLEK 240
Query  241  IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV 300
            IYVPEE++LK IQESP PIN+++AINHS FVKGD TNF+IE SFGVEASELYPDVKYTTV
Sbjct  241  IYVPEEKLLKDIQESPIPINVILAINHSVFVKGDHTNFEIEASFGVEASELYPDVKYTTV 300

Sequence Alignment: 4. Allergen Name: Cor a 6.0101 Sequence ID: A0A0U1VZC8

 Score = 372.1 bits 1604,  Expect = 1e-104
 Identities = 241/308 78%, Positives = 278/308 90%, Gaps = 0/308 0%
Query  1    MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL 60
            MA K+KIL IGGTGYIGKFIVEAS K+ HPTF L REST+SDPVKGK+++ FK+SG T++
Sbjct  1    MAQKSKILFIGGTGYIGKFIVEASLKAGHPTFVLVRESTVSDPVKGKLVEKFKSSGATLV 60
Query  61   TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC 120
             GDLYDH SLVKAIK+VDVVISTVG+LQLADQVKIIAAIKEAGNVKRFFPS+FG DVDR 
Sbjct  61   HGDLYDHGSLVKAIKHVDVVISTVGHLQLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRV 120
Query  121  HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG 180
            HAVEPAK++F  K +IRR IEAEGIPYT+VS+NYFAGY LPTL QP +TAPPRDKV I+G
Sbjct  121  HAVEPAKTAFATKVEIRRKIEAEGIPYTYVSSNYFAGYFLPTLAQPGLTAPPRDKVTIFG 180
Query  181  DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK 240
            DG+ KA+FN+E+DIGTYTI+AVDD RTLNK+LY++P KNIYSFNELVALWEKKIGKTLEK
Sbjct  181  DGHVKAIFNKEDDIGTYTIRAVDDPRTLNKVLYLRPAKNIYSFNELVALWEKKIGKTLEK 240
Query  241  IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV 300
            I++ EE++LK IQESP PIN++++INHS FVKGD TNF+IE SFGVEAS+LYPDVKYTTV
Sbjct  241  IHLTEEKILKDIQESPIPINVILSINHSVFVKGDHTNFEIEESFGVEASQLYPDVKYTTV 300
Query  301  EEYLDQFV 308
            EEYL QFV
Sbjct  301  EEYLQQFV 308

Sequence Alignment: 5. Allergen Name: Pyr c 5 Sequence ID: AAC24001

 Score = 360.3 bits 1552,  Expect = 5e-101
 Identities = 230/308 74%, Positives = 274/308 88%, Gaps = 0/308 0%
Query  1    MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL 60
            MA K++IL IGGTGYIGKFIVEASAK+ +PT+ L RE+++SDP K K+I+ FK  GV  +
Sbjct  1    MASKSQILFIGGTGYIGKFIVEASAKAGYPTYVLVREASLSDPAKSKVIENFKALGVNFV 60
Query  61   TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC 120
             GDLYDHESLVKAIKQVDVVISTVG+ QLADQ KIIAAIKEAGNVKRFFPS+FG DVDR 
Sbjct  61   LGDLYDHESLVKAIKQVDVVISTVGHGQLADQGKIIAAIKEAGNVKRFFPSEFGNDVDRS 120
Query  121  HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG 180
            HAVEPAKS+FE K++IRRA+EAEGIPYT+VS+N+FAGY LPTL QP  ++ PRDKV+ILG
Sbjct  121  HAVEPAKSAFETKAKIRRAVEAEGIPYTYVSSNFFAGYFLPTLNQPGASSAPRDKVVILG 180
Query  181  DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK 240
            DGN KA+FN+E+DIGTYTI+AVDD RTLNK+LYI+PP N  SFNELV+LWEKKIGKTLE+
Sbjct  181  DGNPKAIFNKEDDIGTYTIRAVDDPRTLNKVLYIRPPANTISFNELVSLWEKKIGKTLER 240
Query  241  IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV 300
            IYVPEEQ+LK IQE+  P+N++++I+H+ FVKGD TNF+IEPSFGVEA+ LYPDVKYTTV
Sbjct  241  IYVPEEQLLKNIQEAAVPLNVILSISHAVFVKGDHTNFEIEPSFGVEATALYPDVKYTTV 300
Query  301  EEYLDQFV 308
            +EYL+QFV
Sbjct  301  DEYLNQFV 308

Sequence Alignment: 6. Allergen Name: Dau c 5.0101 Sequence ID: H2DF86

 Score = 340.0 bits 1463,  Expect = 7e-95
 Identities = 219/304 72%, Positives = 259/304 85%, Gaps = 0/304 0%
Query  5    TKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTILTGDL 64
            TKILI+GGTGYIGKFIVEASAK+ HPTF L RE+T++ P K ++I  FK+ GVT + GDL
Sbjct  3    TKILIVGGTGYIGKFIVEASAKAGHPTFVLVREATLTSPDKSQLIDSFKSLGVTFVHGDL 62
Query  65   YDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRCHAVE 124
            YDH SLVKAIKQVDVVIST+G+ QLADQ K++AAI EAGNVKRFFPS+FG DVDR +AVE
Sbjct  63   YDHGSLVKAIKQVDVVISTLGHGQLADQDKLLAAIVEAGNVKRFFPSEFGQDVDRVNAVE 122
Query  125  PAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILGDGNA 184
            PAKS+F  K+Q RR +EA G+P+T+V+ ++FAGY LPTL Q    APPRDK +ILGDG  
Sbjct  123  PAKSAFAAKAQFRRTVEAAGVPFTYVACDFFAGYFLPTLAQAGAAAPPRDKAVILGDGIP 182
Query  185  KAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEKIYVP 244
            K  FN+E DI TYTIKAVDD RTLNKILY++PP N  SFNEL+++WEKKIGKTLEKIYVP
Sbjct  183  KVAFNKEEDIATYTIKAVDDPRTLNKILYVRPPHNTLSFNELLSVWEKKIGKTLEKIYVP 242
Query  245  EEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTVEEYL 304
            EEQVLK IQESP PIN++++I+HSAFVKGD T+F++EPSFGVEAS LYPDVKYTTV+EYL
Sbjct  243  EEQVLKSIQESPVPINVLLSISHSAFVKGDQTSFEVEPSFGVEASALYPDVKYTTVDEYL 302
Query  305  DQFV 308
             QFV
Sbjct  303  SQFV 306

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.