The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD
EFISFCNANPGLMKDVAKVF
Sequence Info Allergen Name Length Opt Bits Score E Value
P94092 Cyn d 7 80 529 96.1 1.2e-22
CAA62634 Cyn d 7 82 529 96.1 1.2e-22
O82040 Phl p 7 78 482 88.4 2.5e-20
AAL92871 Che a 3 86 376 71.1 4.5e-15
ALE34025 Sal k 7.0101 86 371 70.3 7.9e-15
CAA73147 Bet v 4 85 355 67.6 4.8e-14
Q39419 Bet v 4 85 353 67.3 6.1e-14
P58171 Syr v 3 81 352 67.1 6.6e-14
P69197 Bra r 5.0101 79 351 66.9 7.2e-14
CAP05019 Par j 4.0101 84 350 66.8 8.4e-14
O81701 Aln g 4 85 347 66.3 1.2e-13
O81092 Ole e 3 84 345 66.0 1.5e-13
Q39406 Bra n 2 83 343 65.7 1.9e-13
BAA09633 Bra n 2 82 337 64.7 3.6e-13
AY904434 Art v 5.0101 82 316 61.2 3.9e-12
Q2KN25 Amb a 10.0101 160 267 53.5 1.6e-09
O64943 Jun o 4 165 243 49.6 2.5e-08
ABP87672 Cup a 4.0101 177 241 49.3 3.3e-08
AAF31152 Ole e 8 171 234 48.1 7.2e-08
Q9M7R0 Ole e 8 171 226 46.8 1.8e-07
ACL36923 Tyr p 24.0101 153 171 37.8 8.6e-05
QBF67841 Der f 39.0101 153 171 37.8 8.6e-05
D2DGW3 Tyr p 34.0101 153 171 37.8 8.6e-05
QXY82447 Der p 39.0101 153 171 37.8 8.6e-05
ABB89298 Bla g 6.0301 154 156 35.3 0.00047
ABB89297 Bla g 6.0201 151 155 35.1 0.00052
ABB89296 Bla g 6.0101 151 149 34.2 0.001
Q1M0Y3 Per a 6.0101 151 145 33.5 0.0016
P43187 Bet v 3 205 141 33.0 0.0032
P29291 Hom a 6.0101 150 136 32.0 0.0045
ADV17344 Pen m 6.0101 150 132 31.4 0.0071
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 96.1 bits 529,  Expect = 1e-22
 Identities = 80/80 100%, Positives = 80/80 100%, Gaps = 0/80 0%
Query  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
            MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD
Sbjct  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
Query  61   EFISFCNANPGLMKDVAKVF 80
            EFISFCNANPGLMKDVAKVF
Sbjct  61   EFISFCNANPGLMKDVAKVF 80

Sequence Alignment: 2. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 96.1 bits 529,  Expect = 1e-22
 Identities = 80/80 100%, Positives = 80/80 100%, Gaps = 0/80 0%
Query  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
            MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD
Sbjct  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 62
Query  61   EFISFCNANPGLMKDVAKVF 80
            EFISFCNANPGLMKDVAKVF
Sbjct  63   EFISFCNANPGLMKDVAKVF 82

Sequence Alignment: 3. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 88.4 bits 482,  Expect = 2e-20
 Identities = 75/78 96%, Positives = 77/78 98%, Gaps = 2/78 2%
Query  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
            MAD  DME IFKRFDTNGDGKISL+ELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF+
Sbjct  1    MAD--DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFN 58
Query  61   EFISFCNANPGLMKDVAKVF 80
            EFISFCNANPGLMKDVAKVF
Sbjct  59   EFISFCNANPGLMKDVAKVF 78

Sequence Alignment: 4. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 71.1 bits 376,  Expect = 4e-15
 Identities = 57/78 73%, Positives = 64/78 82%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            D  D E IFKRFDTNGDGKIS +EL DAL+TLGS + DEV+RMMAEIDTDGDGFI FDEF
Sbjct  9    DIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISFDEF 68
Query  63   ISFCNANPGLMKDVAKVF 80
              F  AN GL+KDV+K+F
Sbjct  69   TDFARANRGLVKDVSKIF 86

Sequence Alignment: 5. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 70.3 bits 371,  Expect = 8e-15
 Identities = 56/78 71%, Positives = 64/78 82%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            D  D E IFKRFDTNGDGKIS +EL DAL+TLGS ++DE+ RMMAEIDTDGDGFI F+EF
Sbjct  9    DLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEF 68
Query  63   ISFCNANPGLMKDVAKVF 80
              F  AN GL+KDVAK+F
Sbjct  69   TEFARANRGLIKDVAKIF 86

Sequence Alignment: 6. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 67.6 bits 355,  Expect = 5e-14
 Identities = 54/78 69%, Positives = 61/78 78%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            D  + E IFKRFD NGDGKIS AEL +AL+TLGS + DEV+ MMAEIDTDGDGFI F EF
Sbjct  8    DKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEF 67
Query  63   ISFCNANPGLMKDVAKVF 80
              F  AN GL+KDVAK+F
Sbjct  68   TDFARANRGLLKDVAKIF 85

Sequence Alignment: 7. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 67.3 bits 353,  Expect = 6e-14
 Identities = 54/78 69%, Positives = 61/78 78%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            D  + E IFKRFD NGDGKIS AEL +AL+TLGS + DEV+ MMAEIDTDGDGFI F EF
Sbjct  8    DKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEF 67
Query  63   ISFCNANPGLMKDVAKVF 80
              F  AN GL+KDVAK+F
Sbjct  68   TDFGRANRGLLKDVAKIF 85

Sequence Alignment: 8. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 67.1 bits 352,  Expect = 7e-14
 Identities = 51/78 65%, Positives = 63/78 80%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            +  ++E IFKRFD NGDGKIS +EL + L+TLGS + +E+QRMMAEIDTDGDGFI F+EF
Sbjct  4    EVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEF 63
Query  63   ISFCNANPGLMKDVAKVF 80
              F  AN GL+KDVAK+F
Sbjct  64   KDFARANSGLIKDVAKIF 81

Sequence Alignment: 9. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 66.9 bits 351,  Expect = 7e-14
 Identities = 55/79 69%, Positives = 64/79 81%, Gaps = 1/79 1%
Query  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
            MAD  + E IFK+FDT+GDGKIS AEL +AL+ LGS + D+V RMMA+IDTDGDG I F 
Sbjct  1    MADA-EHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQ 59
Query  61   EFISFCNANPGLMKDVAKVF 80
            EF  F +ANPGLMKDVAKVF
Sbjct  60   EFTEFASANPGLMKDVAKVF 79

Sequence Alignment: 10. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 66.8 bits 350,  Expect = 8e-14
 Identities = 52/78 66%, Positives = 65/78 83%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            D  + E IFKRFD+NGDGKIS +EL +AL+ LGS +ADEV+RMMAEIDTDGDG I ++EF
Sbjct  7    DRAEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGAISLEEF 66
Query  63   ISFCNANPGLMKDVAKVF 80
             SF +AN GL+KD+AK+F
Sbjct  67   SSFADANRGLIKDIAKIF 84

Sequence Alignment: 11. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 66.3 bits 347,  Expect = 1e-13
 Identities = 53/78 67%, Positives = 61/78 78%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            D  + E IFK FD NGDGKIS +EL DAL+TLGS + DEV+ MMAEIDTDGDGFI F EF
Sbjct  8    DQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDGFISFQEF 67
Query  63   ISFCNANPGLMKDVAKVF 80
             +F  AN GL+KDVAK+F
Sbjct  68   TNFARANRGLVKDVAKIF 85

Sequence Alignment: 12. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 66.0 bits 345,  Expect = 1e-13
 Identities = 51/78 65%, Positives = 62/78 79%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            +  + E IFKRFD NGDGKIS +EL + L+TLGS + +E+QRMMAEIDTDGDGFI F+EF
Sbjct  7    EVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEF 66
Query  63   ISFCNANPGLMKDVAKVF 80
              F  AN GL+KDVAK+F
Sbjct  67   TVFARANRGLVKDVAKIF 84

Sequence Alignment: 13. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 65.7 bits 343,  Expect = 2e-13
 Identities = 54/80 67%, Positives = 65/80 81%, Gaps = 3/80 3%
Query  1    MAD-TGDMEH--IFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFI 57
            MAD T   EH  IFK+FD NGDGKIS +EL DAL+ LGS + D+++RMMAEIDTDGDG+I
Sbjct  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
Query  58   DFDEFISFCNANPGLMKDVAKVF 80
             + EF  F +AN GLMKDVAK+F
Sbjct  61   SYQEFSDFASANRGLMKDVAKIF 83

Sequence Alignment: 14. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 64.7 bits 337,  Expect = 4e-13
 Identities = 48/78 61%, Positives = 62/78 79%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            +  + + IFK+FD NGDGKIS +EL DAL+ LGS + D+++RMMAEIDTDGDG+I + EF
Sbjct  5    EKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEF 64
Query  63   ISFCNANPGLMKDVAKVF 80
              F +AN GLMKDVAK+F
Sbjct  65   SDFASANRGLMKDVAKIF 82

Sequence Alignment: 15. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 61.2 bits 316,  Expect = 4e-12
 Identities = 48/78 61%, Positives = 57/78 73%, Gaps = 0/78 0%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
            D  + + IF  FD NGDGKIS AEL ++L  LGS S +EVQ MM E+DTDGDG+I +DEF
Sbjct  5    DKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGYISYDEF 64
Query  63   ISFCNANPGLMKDVAKVF 80
              F NAN GLMKDV K+F
Sbjct  65   AEFFNANRGLMKDVGKIF 82

Sequence Alignment: 16. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 53.5 bits 267,  Expect = 2e-09
 Identities = 42/64 65%, Positives = 50/64 78%, Gaps = 1/64 1%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDFDE 61
            D  ++  IF RFDTNGDG+IS  EL   L++LGS TS DEV+R+MAEID DGDGFI +DE
Sbjct  14   DKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLDE 73
Query  62   FISFC 66
            FI FC
Sbjct  74   FILFC 78
 Score = 36.5 bits 163,  Expect = 0.0002
 Identities = 25/60 41%, Positives = 36/60 60%, Gaps = 1/60 1%
Query  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDE 61
            +  D++  FK +D N +G IS  EL   L  LG   S +    M+  +D+DGDGF+DF+E
Sbjct  87   EINDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVESCADMIKSVDSDGDGFVDFEE 146
Query  62   F 62
            F
Sbjct  147  F 147

Sequence Alignment: 17. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 49.6 bits 243,  Expect = 3e-08
 Identities = 37/75 49%, Positives = 53/75 70%, Gaps = 3/75 4%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFDEFIS 64
            ++E +FK+FD NGDGKIS +EL D LR+LGS   + EV+ MM E D DGDG++ + EF+ 
Sbjct  26   ELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVD 85
Query  65   FCNANPGL--MKDVAKVF 80
            + N    +  +K+  KVF
Sbjct  86   LNNKGASVKDLKNAFKVF 103

Sequence Alignment: 18. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 49.3 bits 241,  Expect = 3e-08
 Identities = 36/74 48%, Positives = 52/74 70%, Gaps = 2/74 2%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFDEFIS 64
            ++E +FK+FD NGDGKIS +EL D LR++GS   + EV+ MM E DTDGDG++ + EF+ 
Sbjct  38   ELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVD 97
Query  65   FCNANPGLMKDVAKVF 80
            + N     +KD+   F
Sbjct  98   L-NIKGATVKDLKNAF 112

Sequence Alignment: 19. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 48.1 bits 234,  Expect = 7e-08
 Identities = 37/68 54%, Positives = 48/68 70%, Gaps = 1/68 1%
Query  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 59
            + +  +++ +F RFD NGDGKIS  EL  AL+ LGS TS +E+ RMM EIDTD DGFI+ 
Sbjct  15   LQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
Query  60   DEFISFCNA 68
             EF +F  A
Sbjct  75   QEFAAFVKA 83

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 46.8 bits 226,  Expect = 2e-07
 Identities = 35/68 51%, Positives = 47/68 69%, Gaps = 1/68 1%
Query  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 59
            + +  +++ +F RFD NGDGKIS  EL   L+ LGS TS +E+ R+M EIDTD DGFI+ 
Sbjct  15   LQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
Query  60   DEFISFCNA 68
             EF +F  A
Sbjct  75   QEFAAFVKA 83

Sequence Alignment: 21. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 37.8 bits 171,  Expect = 9e-05
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 63
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 22. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 37.8 bits 171,  Expect = 9e-05
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 63
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 23. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 37.8 bits 171,  Expect = 9e-05
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 63
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 24. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 37.8 bits 171,  Expect = 9e-05
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 63
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 25. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 35.3 bits 156,  Expect = 0.0005
 Identities = 23/58 39%, Positives = 36/58 62%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFDEFI 63
            ++   F+ +D  G+G I  + L + LR L    ++DE+  M+ EID DG G +DFDEF+
Sbjct  91   ELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEFM 149

Sequence Alignment: 26. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 35.1 bits 155,  Expect = 0.0005
 Identities = 22/58 37%, Positives = 38/58 65%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 63
            ++   F+ +D  G+G I+ A L + L+ L    +A+++  M+ EID+DG G +DFDEF+
Sbjct  87   ELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFM 145

Sequence Alignment: 27. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 34.2 bits 149,  Expect = 0.001
 Identities = 21/58 36%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 63
            ++   F+ +D  G+G I+   L + L+ L    +A+++  M+ EID+DG G +DFDEF+
Sbjct  87   ELREAFRLYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFM 145

Sequence Alignment: 28. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 33.5 bits 145,  Expect = 0.002
 Identities = 21/58 36%, Positives = 36/58 62%, Gaps = 1/58 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADE-VQRMMAEIDTDGDGFIDFDEFI 63
            +++  F+ +D  G+G I+   L + L+ L     +E +  M+ EID+DG G +DFDEF+
Sbjct  87   ELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEIDSDGSGTVDFDEFM 145

Sequence Alignment: 29. Allergen Name: Bet v 3 Sequence ID: P43187

 Score = 33.0 bits 141,  Expect = 0.003
 Identities = 24/52 46%, Positives = 33/52 63%, Gaps = 3/52 5%
Query  11   FKRFDTNGDGKISLAELTDALRTLG---STSADEVQRMMAEIDTDGDGFIDFDEF 62
            FK FD +GDG IS  EL   L  LG    +  D V++M+  +D++ DG +DF EF
Sbjct  139  FKVFDEDGDGYISARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEF 193

Sequence Alignment: 30. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 32.0 bits 136,  Expect = 0.004
 Identities = 20/62 32%, Positives = 36/62 58%, Gaps = 1/62 1%
Query  6    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADE-VQRMMAEIDTDGDGFIDFDEFIS 64
            ++   F+ +D  G+G I+   L + LR L +   +E +  ++ E+D DG G +DF+EF+ 
Sbjct  87   ELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEEDLDSIIEEVDEDGSGTLDFNEFMQ 146
Query  65   FCN 67
              N
Sbjct  147  MMN 149

Sequence Alignment: 31. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 31.4 bits 132,  Expect = 0.007
 Identities = 21/56 37%, Positives = 31/56 55%, Gaps = 1/56 1%
Query  7    MEHIFKRFDTNGDGKISLAELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFDEF 62
            +   F  FDT G G I+   +   LR +G   S   +Q ++AE D DG G ++F+EF
Sbjct  12   LRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEF 68

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.