The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE
EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK63086 Gad m 1.0101 109 702 122.7 2.2e-30
CAM56785 Gad m 1.0102 109 696 121.8 4.2e-30
CAC83658 Cyp c 1.01 109 565 100.8 8.9e-24
QCY53440 Cten i 1.0101 109 565 100.8 8.9e-24
CAC83659 Cyp c 1.02 109 556 99.3 2.4e-23
CAQ72971 Clu h 1.0201 110 551 98.5 4.3e-23
XP_026772003 Pan h 1.0101 109 539 96.6 1.6e-22
CAQ72967 Thu a 1.0101 109 535 96.0 2.5e-22
Q5IRB2 Lat c 1.0101 109 533 95.6 3.1e-22
FM202668 Xip g 1.0101 109 527 94.7 6.1e-22
P59747 Sco j 1 109 527 94.7 6.1e-22
CAA66404 Sal s 1 108 520 93.6 1.3e-21
Q90YK7 The c 1 109 520 93.6 1.3e-21
CAQ72970 Clu h 1.0101 109 515 92.8 2.3e-21
CAQ72969 Seb m 1.0201 110 515 92.8 2.3e-21
A0A1B1V0G7 Ras k 1.0101 109 514 92.6 2.6e-21
Q91483 Sal s 1 107 513 92.4 2.9e-21
CAM56786 Gad m 1.0202 109 507 91.5 5.6e-21
Q90YK9 Gad m 1.0201 109 505 91.2 7e-21
AAK63087 Gad m 1.0201 109 505 91.2 7e-21
CAQ72972 Clu h 1.0301 109 489 88.6 4.2e-20
Q6ITU9 Lat c 1.0201 109 484 87.8 7.3e-20
XP_019397705 Cro p 1.0101 109 477 86.7 1.6e-19
FM177701 Sar sa 1.0101 109 476 86.5 1.8e-19
CAQ72968 Seb m 1.0101 109 466 84.9 5.4e-19
Q91482 Sal s 1 109 455 83.1 1.8e-18
CAC95152 Ran e 2 109 435 79.9 1.7e-17
P86432 Onc m 1.0201 107 434 79.8 1.9e-17
AM904681 Lep w 1.0101 109 433 79.6 2.1e-17
P02622 Gad c 1 113 420 77.5 9.2e-17
P86431 Onc m 1.0101 108 395 73.5 1.4e-15
C1L370 Gal d 8.0101 110 372 69.8 1.9e-14
XP_019400389 Cro p 2.0101 110 370 69.5 2.3e-14
CAC83046 Ran e 1 110 350 66.3 2.1e-13
XP_026803769 Pan h 1.0201 109 329 62.9 2.2e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 122.7 bits 702,  Expect = 2e-30
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 2. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 121.8 bits 696,  Expect = 4e-30
 Identities = 108/109 99%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGV+EWAVLVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 3. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 100.8 bits 565,  Expect = 9e-24
 Identities = 89/109 81%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL DAD  AA++ C+AA+SF YK+FFAK GLS K+ DDIKKAF VIDQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ F AGARALTDAETKAFLKAGDSDGDG IGVDE+A LVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 4. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 100.8 bits 565,  Expect = 9e-24
 Identities = 89/109 81%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL DAD AAA++AC+AA+SF++KAFFAK GLS KS DD+KKAF +IDQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ FKA ARALTDAETK FLKAGDSDGDG IGVDE+A LVKA
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 5. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 99.3 bits 556,  Expect = 2e-23
 Identities = 85/109 77%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAG+L DAD  AA++AC+AA+SF++K FFAK GL+ KSADD+KKAF +IDQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ FKAGARALTD ETK FLKAGDSDGDG IGVDE+  LVKA
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 6. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 98.5 bits 551,  Expect = 4e-23
 Identities = 83/109 76%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAG+L+DAD AAA+ AC AA++F +K+FF K GLSGKSADD+KK F++IDQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            E+ELKLFLQ FKAGARAL+D ETKAFL AGD+DGDG IGVDE+AV+VKA
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109

Sequence Alignment: 7. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 96.6 bits 539,  Expect = 2e-22
 Identities = 84/109 77%, Positives = 94/109 86%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAG+L DAD AAA+ AC+A  SF +KAFF K GL+GKSADD+KKAF +IDQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ FK+ ARALTD ETK FLKAGD+DGDG IGVDE+A LVKA
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 8. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 96.0 bits 535,  Expect = 3e-22
 Identities = 84/109 77%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL +AD  AA+ AC+AA+SF YK FF K GL+ K+ +DIKKAF VIDQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ F AGARALTDAETKAFL AGDSDGDG IG+DE+A LVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 9. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 95.6 bits 533,  Expect = 3e-22
 Identities = 84/108 77%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL +AD  AA+ AC+AA+SF +K FF K GL+GKS DD+KKAF VIDQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            EDELKLFLQ F A ARALTDAETK FLKAGDSDGDG IGVDE+A LVK
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 10. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 94.7 bits 527,  Expect = 6e-22
 Identities = 80/109 73%, Positives = 92/109 84%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAG+L+DAD AAA++AC+ A +F YK FF  CGL+ KS DD+KKAF +IDQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ FKA AR LTDAET+AFLKAGDSDGDG IG +E+A LV A
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA 109

Sequence Alignment: 11. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 94.7 bits 527,  Expect = 6e-22
 Identities = 78/108 72%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFA +L DA+  AA+  C+AA SF +K FF  CGLSGKS D++KKAF +IDQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            E+ELKLFLQ FKAGARAL+DAETKAFLKAGDSDGDG IG+DE+A ++K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 12. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 93.6 bits 520,  Expect = 1e-21
 Identities = 81/107 75%, Positives = 93/107 86%, Gaps = 1/107 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            M+FAG L DAD AAA+ AC AA+SF++KAFFAK GL+ KS+DD+KKAF+VIDQDKSGFIE
Sbjct  1    MSFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            EDELKLFLQ F A ARALTDAETKAFL  GD DGDG IGVDE+A ++K
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 13. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 93.6 bits 520,  Expect = 1e-21
 Identities = 79/109 72%, Positives = 94/109 86%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL DA+ AAA++AC++A SF +  FF  CGL+GKS+DD+KKAF +IDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            E+ELKLFLQ F A ARAL+DAETKAFLKAGDSDGDG IGVDE+A +VKA
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 14. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 92.8 bits 515,  Expect = 2e-21
 Identities = 81/108 75%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA+A +L  AD  AA+KACEA +SF +K FFAK GL+ KSA D+KKAF +IDQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            E+ELKLFLQ FKAGARALTDAETKAFLKAGD+DGDG IGVDE+AV++K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 15. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 92.8 bits 515,  Expect = 2e-21
 Identities = 78/108 72%, Positives = 90/108 83%, Gaps = 1/108 0%
Query  1    MAFAGI-LADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFI 59
            MAFA + L DAD AAA+  C+ A  F++K FF  CGLSGKS+D++KKAF +IDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            EE+ELKLFLQ FKAGARAL+DAETK FLKAGDSDGDG IG DEWA +VK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 16. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 92.6 bits 514,  Expect = 3e-21
 Identities = 76/108 70%, Positives = 90/108 83%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFA +L DA+  AA+  C+A  SF +K FF  CGL+GKS DD+KKAF +IDQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            E+ELKLFLQ FKAGAR L+DAETKAFLKAGD+DGDG IGVDE+A ++K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 17. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 92.4 bits 513,  Expect = 3e-21
 Identities = 80/106 75%, Positives = 92/106 86%, Gaps = 1/106 0%
Query  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
            +FAG L DAD AAA+ AC AA+SF++KAFFAK GL+ KS+DD+KKAF+VIDQDKSGFIEE
Sbjct  1    SFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            DELKLFLQ F A ARALTDAETKAFL  GD DGDG IGVDE+A ++K
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 18. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 91.5 bits 507,  Expect = 6e-21
 Identities = 78/109 71%, Positives = 89/109 81%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL DAD  AA+ AC+A  SF +KAFF K GL+ KS+ DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ F AGARAL+DAETK FLKAGDSDGDG IGVDE+  ++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 19. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 91.2 bits 505,  Expect = 7e-21
 Identities = 78/109 71%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL DAD  AA+ AC+A  SF +KAFF K GL+ KS  DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ F AGARAL+DAETK FLKAGDSDGDG IGVDE+  ++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 20. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 91.2 bits 505,  Expect = 7e-21
 Identities = 78/109 71%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFAGIL DAD  AA+ AC+A  SF +KAFF K GL+ KS  DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ F AGARAL+DAETK FLKAGDSDGDG IGVDE+  ++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 21. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 88.6 bits 489,  Expect = 4e-20
 Identities = 75/107 70%, Positives = 87/107 81%, Gaps = 0/107 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAFA  L +AD  AA+ AC+ A+SF +KAFFAK GL GKS D++KKAF +IDQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLV 107
            E+ELKLFLQ F  GARALTD ETK FLKAGDSD DG IG+DE+A L+
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 22. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 87.8 bits 484,  Expect = 7e-20
 Identities = 71/108 65%, Positives = 87/108 80%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MAF+ +L+D+D AAA+  C+ A +F +K FF+ CGLS K++DD+KKAF +IDQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            E+ELKLFLQ FKA AR LTD ET  FLKAGD+DGDG IG DE+  LVK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 23. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 86.7 bits 477,  Expect = 2e-19
 Identities = 73/109 66%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA   IL+  D  AA+ +C+AAESF+YK+FF+  GL GKSAD +KK F ++DQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDEL+LFL+ F + ARALTDAETKAFL AGD+DGDG IGVDE+  LVKA
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 24. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 86.5 bits 476,  Expect = 2e-19
 Identities = 74/108 68%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA+AG++ +AD  AA++AC+AA+SF +KAFF K G+SGKSAD++KKAF +IDQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            E+ELKLFLQ F   ARALTD ETK FLKAGD+ GDG IG+DE+  LVK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 25. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 84.9 bits 466,  Expect = 5e-19
 Identities = 75/108 69%, Positives = 85/108 78%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA+A  L  AD  AA+ AC   ++F +K FF K GLS KSADDIK AF VIDQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            E+ELKLFLQ F A ARALT+AET AFLKAGDSDGDG IG+DE+A +VK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 26. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 83.1 bits 455,  Expect = 2e-18
 Identities = 72/108 66%, Positives = 87/108 80%, Gaps = 0/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA A +  +AD   A++AC+AA++FS+K FF   G++ KSADD+KKAF VIDQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
             +ELKLFLQ F   AR LTDAETKAFLKAGD+DGDG IG+DE+AVLVK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 27. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 79.9 bits 435,  Expect = 2e-17
 Identities = 68/109 62%, Positives = 86/109 78%, Gaps = 0/109 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            M+   I+++ D  AA+++ +AA SF+YK FF K GL+GKSA D KK F ++D+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            +DEL LFLQ F+A AR L+DAET AFLKAGDSDGDG IGV+E+  LVKA
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 28. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 79.8 bits 434,  Expect = 2e-17
 Identities = 71/106 66%, Positives = 83/106 78%, Gaps = 1/106 0%
Query  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
            +FAG L DAD AAA+ AC AA+SF++KAFFAK      S DD+KK    +DQDKSGF+EE
Sbjct  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            DELKLFLQ F A ARALTDAETK    AGD+DGDG +G+DE+AVLVK
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 29. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 79.6 bits 433,  Expect = 2e-17
 Identities = 69/108 63%, Positives = 83/108 76%, Gaps = 1/108 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            M FAG+ A A+  AA+  C AA+SF YK FF  CGL+ KSA+++K AF  IDQD+SGFIE
Sbjct  1    MTFAGLDA-AEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109
            EDELKLFLQ F A ARALTD ET  FLKAGD DGDG IG++E+  LV++
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108

Sequence Alignment: 30. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 77.5 bits 420,  Expect = 9e-17
 Identities = 69/106 65%, Positives = 77/106 72%, Gaps = 0/106 0%
Query  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
            AF GIL++AD  AA  AC    SF    F+AK GL   SAD++KK F + D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLV 107
            DELKLFL  F A  RALTDAETKAFLKAGDSDGDG IGVDE+  LV
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 31. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 73.5 bits 395,  Expect = 1e-15
 Identities = 62/107 57%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  2    AFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEE 61
            A A +  +AD   A++AC+AA+SF++K FF   G++ K  DD+KK   V+DQD SGF+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   DELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108
            +ELKLFLQ F      LTDAETKAFLKAGD+DGDG +G+DE+AVLVK
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 32. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 69.8 bits 372,  Expect = 2e-14
 Identities = 58/107 54%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA   +L+  D   AV A  AAESF+YK FF   GL  KS +D+KK F ++D+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLV 107
            E+ELK+ L+ F    R L+D ETKA+L AGD DGDG IG DE+A +V
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 33. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 69.5 bits 370,  Expect = 2e-14
 Identities = 60/107 56%, Positives = 73/107 68%, Gaps = 0/107 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA   +L+  D   AV A  AAESF++K FF   GL  KS DD+KK F ++D+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLV 107
            EDELK  L+ F   AR L+D ETK +L AGD DGDG IGVDE+  LV
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 34. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 66.3 bits 350,  Expect = 2e-13
 Identities = 56/107 52%, Positives = 72/107 67%, Gaps = 0/107 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            M    +LA  D + AV A  A ESF++K FF  CGL  KS + ++K F V+DQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLV 107
            ++EL L L+ F    R+L+D ET A+L AGD DGDG IGVDE+  LV
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

Sequence Alignment: 35. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 62.9 bits 329,  Expect = 2e-12
 Identities = 53/107 49%, Positives = 68/107 63%, Gaps = 0/107 0%
Query  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
            MA   +L   D   A+   + A++F +K FF   GL   SA+++KK F V+D D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLV 107
            EDELK+ L+ F    R LTD ETKAFL A D DGDG IG+DE+  +V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.