The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE
EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAC83658 Cyp c 1.01 109 692 92.7 2.3e-21
CAQ72967 Thu a 1.0101 109 625 84.9 5.3e-19
QCY53440 Cten i 1.0101 109 616 83.9 1.1e-18
CAC83659 Cyp c 1.02 109 615 83.8 1.2e-18
Q5IRB2 Lat c 1.0101 109 602 82.2 3.4e-18
Q90YK9 Gad m 1.0201 109 586 80.4 1.2e-17
AAK63087 Gad m 1.0201 109 586 80.4 1.2e-17
CAM56786 Gad m 1.0202 109 575 79.1 3e-17
XP_026772003 Pan h 1.0101 109 570 78.5 4.5e-17
P59747 Sco j 1 109 568 78.3 5.3e-17
AAK63086 Gad m 1.0101 109 565 77.9 6.8e-17
CAM56785 Gad m 1.0102 109 559 77.2 1.1e-16
CAQ72971 Clu h 1.0201 110 558 77.1 1.2e-16
FM202668 Xip g 1.0101 109 557 77.0 1.3e-16
A0A1B1V0G7 Ras k 1.0101 109 556 76.9 1.4e-16
CAA66404 Sal s 1 108 552 76.4 1.9e-16
Q91483 Sal s 1 107 545 75.6 3.4e-16
Q90YK7 The c 1 109 544 75.5 3.7e-16
CAQ72972 Clu h 1.0301 109 538 74.8 6.1e-16
CAQ72970 Clu h 1.0101 109 528 73.6 1.4e-15
Q6ITU9 Lat c 1.0201 109 526 73.4 1.6e-15
FM177701 Sar sa 1.0101 109 525 73.2 1.7e-15
CAQ72968 Seb m 1.0101 109 524 73.1 1.9e-15
XP_019397705 Cro p 1.0101 109 520 72.7 2.6e-15
CAQ72969 Seb m 1.0201 110 510 71.5 5.9e-15
AM904681 Lep w 1.0101 109 482 68.2 5.6e-14
Q91482 Sal s 1 109 481 68.1 6.1e-14
P86432 Onc m 1.0201 107 471 66.9 1.4e-13
CAC95152 Ran e 2 109 465 66.2 2.2e-13
P02622 Gad c 1 113 456 65.2 4.7e-13
P86431 Onc m 1.0101 108 428 61.9 4.4e-12
C1L370 Gal d 8.0101 110 404 59.1 3.1e-11
XP_019400389 Cro p 2.0101 110 393 57.8 7.6e-11
XP_026803769 Pan h 1.0201 109 390 57.5 9.7e-11
CAC83046 Ran e 1 110 345 52.2 3.7e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 92.7 bits 692,  Expect = 2e-21
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 2. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 84.9 bits 625,  Expect = 5e-19
 Identities = 98/109 89%, Positives = 102/109 93%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +ADITAAL  CQAADSF YK FF KVGL+AKTP+DIKKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFSAGARALTDAETKAFL AGDSDGDGKIG+DEFAALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 3. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 83.9 bits 616,  Expect = 1e-18
 Identities = 95/109 87%, Positives = 103/109 94%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGILNDADI AAL+ C+AADSF++K+FFAKVGLSAK+ DD+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A ARALTDAETK FLKAGDSDGDGKIGVDEFAALVKA
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 4. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 83.8 bits 615,  Expect = 1e-18
 Identities = 92/109 84%, Positives = 103/109 94%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAG+LNDADITAAL+ C+AADSF++K+FFAKVGL++K+ DD+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF AGARALTD ETK FLKAGDSDGDGKIGVDEF ALVKA
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 5. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 82.2 bits 602,  Expect = 3e-18
 Identities = 94/108 87%, Positives = 99/108 91%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGILN+ADITAAL  CQAADSF +K FF KVGL+ K+ DD+KKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSA ARALTDAETK FLKAGDSDGDGKIGVDEFAALVK
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 6. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 80.4 bits 586,  Expect = 1e-17
 Identities = 88/109 80%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGILNDADITAAL  C+A  SFD+K+FF KVGL+AK+P DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFSAGARAL+DAETK FLKAGDSDGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 7. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 80.4 bits 586,  Expect = 1e-17
 Identities = 88/109 80%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGILNDADITAAL  C+A  SFD+K+FF KVGL+AK+P DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFSAGARAL+DAETK FLKAGDSDGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 8. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 79.1 bits 575,  Expect = 3e-17
 Identities = 87/109 79%, Positives = 97/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGILNDADITAAL  C+A  SFD+K+FF KVGL+AK+  DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFSAGARAL+DAETK FLKAGDSDGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 9. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 78.5 bits 570,  Expect = 5e-17
 Identities = 85/109 77%, Positives = 97/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAG+LNDADI AAL  C+A  SFD+K+FF KVGL+ K+ DD+KKAF++IDQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF + ARALTD ETK FLKAGD+DGDGKIGVDEFA+LVKA
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 10. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 78.3 bits 568,  Expect = 5e-17
 Identities = 83/108 76%, Positives = 97/108 89%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFA +L DA++TAAL GC+AA SFD+K FF   GLS K+ D++KKAFA+IDQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF AGARAL+DAETKAFLKAGDSDGDGKIG+DEFAA++K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 11. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 77.9 bits 565,  Expect = 7e-17
 Identities = 89/109 81%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGIL DAD  AA++ C+AA+SF YK+FFAK GLS K+ DDIKKAF VIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQ F AGARALTDAETKAFLKAGDSDGDG IGVDE+A LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 12. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 77.2 bits 559,  Expect = 1e-16
 Identities = 88/109 80%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGIL DAD  AA++ C+AA+SF YK+FFAK GLS K+ DDIKKAF VIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQ F AGARALTDAETKAFLKAGDSDGDG IGV+E+A LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 13. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 77.1 bits 558,  Expect = 1e-16
 Identities = 84/109 77%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAG+L+DADI AAL  C AAD+FD+KSFF KVGLS K+ DD+KK F +IDQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            E+ELKLFLQNF AGARAL+D ETKAFL AGD+DGDG IGVDEFA +VKA
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109

Sequence Alignment: 14. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 77.0 bits 557,  Expect = 1e-16
 Identities = 83/109 76%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAG+L+DAD+ AAL+ C+ A +FDYK FF   GL+AK+ DD+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A AR LTDAET+AFLKAGDSDGDGKIG +EFAALV A
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA 109

Sequence Alignment: 15. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 76.9 bits 556,  Expect = 1e-16
 Identities = 82/108 75%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFA +L DA+ITAAL GC+A  SFD+K FF   GL+ K+ DD+KKAFA+IDQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF AGAR L+DAETKAFLKAGD+DGDGKIGVDEFAA++K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 16. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 76.4 bits 552,  Expect = 2e-16
 Identities = 85/107 79%, Positives = 96/107 89%, Gaps = 1/107 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            M+FAG LNDAD+ AAL  C AADSF++K+FFAKVGL++K+ DD+KKAF VIDQDKSGFIE
Sbjct  1    MSFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSA ARALTDAETKAFL  GD DGDG IGVDEFAA++K
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 17. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 75.6 bits 545,  Expect = 3e-16
 Identities = 84/106 79%, Positives = 95/106 89%, Gaps = 1/106 0%
Query  2    AFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEE 61
            +FAG LNDAD+ AAL  C AADSF++K+FFAKVGL++K+ DD+KKAF VIDQDKSGFIEE
Sbjct  1    SFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   DELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            DELKLFLQNFSA ARALTDAETKAFL  GD DGDG IGVDEFAA++K
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 18. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 75.5 bits 544,  Expect = 4e-16
 Identities = 81/109 74%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFAGIL DA++ AAL+ C++A SFD+  FF   GL+ K+ DD+KKAF +IDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            E+ELKLFLQNFSA ARAL+DAETKAFLKAGDSDGDGKIGVDEFAA+VKA
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 19. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 74.8 bits 538,  Expect = 6e-16
 Identities = 81/107 75%, Positives = 92/107 85%, Gaps = 0/107 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAFA  L +ADITAAL  C+ ADSFD+K+FFAKVGL  K+ D++KKAF +IDQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALV 107
            E+ELKLFLQNF  GARALTD ETK FLKAGDSD DGKIG+DEFAAL+
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 20. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 73.6 bits 528,  Expect = 1e-15
 Identities = 79/108 73%, Positives = 93/108 86%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA+A +L  ADI AAL+ C+A DSF +K FFAK+GL+ K+  D+KKAF +IDQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF AGARALTDAETKAFLKAGD+DGDG IGVDEFA ++K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 21. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 73.4 bits 526,  Expect = 2e-15
 Identities = 77/108 71%, Positives = 90/108 83%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MAF+ +L+D+D+ AAL GC+ A +FD+K FF+  GLS KT DD+KKAFA+IDQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF A AR LTD ET  FLKAGD+DGDGKIG DEF ALVK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 22. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 73.2 bits 525,  Expect = 2e-15
 Identities = 79/108 73%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA+AG++ +ADITAAL+ C+AADSFD+K+FF KVG+S K+ D++KKAFA+IDQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF   ARALTD ETK FLKAGD+ GDGKIG+DEF  LVK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 23. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 73.1 bits 524,  Expect = 2e-15
 Identities = 83/108 76%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA+A  LN ADITAAL  C   D+F +K FF KVGLSAK+ DDIK AF VIDQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNFSA ARALT+AET AFLKAGDSDGDG IG+DEFAA+VK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 24. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 72.7 bits 520,  Expect = 3e-15
 Identities = 79/109 72%, Positives = 91/109 83%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA   IL+  DI AAL  CQAA+SF+YKSFF+ VGL  K+ D +KK F ++DQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDEL+LFL+NFS+ ARALTDAETKAFL AGD+DGDGKIGVDEF ALVKA
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 25. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 71.5 bits 510,  Expect = 6e-15
 Identities = 78/108 72%, Positives = 91/108 84%, Gaps = 1/108 0%
Query  1    MAFAGI-LNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFI 59
            MAFA + L DADI AAL GC+ A  F++K+FF   GLS K+ D++KKAFA+IDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            EE+ELKLFLQ F AGARAL+DAETK FLKAGDSDGDGKIG DE+AA+VK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 26. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 68.2 bits 482,  Expect = 6e-14
 Identities = 75/108 69%, Positives = 87/108 80%, Gaps = 1/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            M FAG L+ A+I AAL GC AADSFDYK FF   GL+ K+ +++K AF  IDQD+SGFIE
Sbjct  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFSA ARALTD ET  FLKAGD DGDGKIG++EF  LV++
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108

Sequence Alignment: 27. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 68.1 bits 481,  Expect = 6e-14
 Identities = 72/108 66%, Positives = 88/108 81%, Gaps = 0/108 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA A +  +ADI  AL+ C+AAD+F +K+FF  +G+++K+ DD+KKAF VIDQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
             +ELKLFLQNF   AR LTDAETKAFLKAGD+DGDG IG+DEFA LVK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 28. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 66.9 bits 471,  Expect = 1e-13
 Identities = 73/106 68%, Positives = 85/106 80%, Gaps = 1/106 0%
Query  2    AFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEE 61
            +FAG LNDAD+ AAL  C AADSF++K+FFAK      +PDD+KK    +DQDKSGF+EE
Sbjct  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   DELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            DELKLFLQNFSA ARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 29. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 66.2 bits 465,  Expect = 2e-13
 Identities = 72/109 66%, Positives = 87/109 79%, Gaps = 0/109 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            M+   I+++ DI AAL+  +AA SF+YK FF KVGL+ K+  D KK F ++D+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109
            +DEL LFLQNF A AR L+DAET AFLKAGDSDGDGKIGV+EF ALVKA
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 30. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 65.2 bits 456,  Expect = 5e-13
 Identities = 73/106 68%, Positives = 82/106 77%, Gaps = 0/106 0%
Query  2    AFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEE 61
            AF GIL++ADI AA   C    SFD   F+AKVGL A + D++KK F + D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   DELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALV 107
            DELKLFL  F+A  RALTDAETKAFLKAGDSDGDGKIGVDEF ALV
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 31. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 61.9 bits 428,  Expect = 4e-12
 Identities = 64/107 59%, Positives = 83/107 77%, Gaps = 0/107 0%
Query  2    AFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEE 61
            A A +  +AD+  AL+ C+AADSF++K+FF  +G+++K  DD+KK   V+DQD SGF+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   DELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108
            +ELKLFLQNF      LTDAETKAFLKAGD+DGDG +G+DEFA LVK
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 32. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 59.1 bits 404,  Expect = 3e-11
 Identities = 59/107 55%, Positives = 78/107 72%, Gaps = 0/107 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA   +L+  DI  A+    AA+SF+YK FF  VGL  K+P+D+KK F ++D+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALV 107
            E+ELK+ L+ F+   R L+D ETKA+L AGD DGDGKIG DEFA +V
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 33. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 57.8 bits 393,  Expect = 8e-11
 Identities = 60/107 56%, Positives = 77/107 71%, Gaps = 0/107 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA   +L+  DI  A+    AA+SF++K FF  VGL  K+ DD+KK F ++D+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALV 107
            EDELK  L+ F+  AR L+D ETK +L AGD DGDGKIGVDEF +LV
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 34. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 57.5 bits 390,  Expect = 1e-10
 Identities = 61/107 57%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            MA   +L   DI  AL   + AD+FD+K FF  VGL A + +++KK F+V+D D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALV 107
            EDELK+ L+ FS   R LTD ETKAFL A D DGDGKIG+DEF A+V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 52.2 bits 345,  Expect = 4e-09
 Identities = 53/107 49%, Positives = 73/107 68%, Gaps = 0/107 0%
Query  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
            M    +L   DI+ A+    A +SF++K FF   GL +K+ + ++K F V+DQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALV 107
            ++EL L L+ F+   R+L+D ET A+L AGD DGDGKIGVDEF  LV
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.