The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE
EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR
Sequence Info Allergen Name Length Opt Bits Score E Value
CAQ72971 Clu h 1.0201 110 704 103.3 1.6e-24
CAA66404 Sal s 1 108 563 84.9 5.4e-19
CAC83659 Cyp c 1.02 109 563 84.9 5.5e-19
QCY53440 Cten i 1.0101 109 562 84.8 6e-19
CAC83658 Cyp c 1.01 109 558 84.2 8.6e-19
XP_026772003 Pan h 1.0101 109 557 84.1 9.4e-19
Q91483 Sal s 1 107 556 84.0 1e-18
AAK63086 Gad m 1.0101 109 551 83.3 1.6e-18
P59747 Sco j 1 109 548 82.9 2.1e-18
CAM56785 Gad m 1.0102 109 545 82.5 2.8e-18
CAQ72970 Clu h 1.0101 109 543 82.3 3.3e-18
A0A1B1V0G7 Ras k 1.0101 109 539 81.8 4.8e-18
Q5IRB2 Lat c 1.0101 109 539 81.8 4.8e-18
Q90YK7 The c 1 109 537 81.5 5.7e-18
CAQ72967 Thu a 1.0101 109 535 81.2 6.9e-18
CAM56786 Gad m 1.0202 109 530 80.6 1.1e-17
Q90YK9 Gad m 1.0201 109 528 80.3 1.3e-17
AAK63087 Gad m 1.0201 109 528 80.3 1.3e-17
CAQ72972 Clu h 1.0301 109 522 79.5 2.2e-17
FM202668 Xip g 1.0101 109 517 78.9 3.5e-17
CAQ72968 Seb m 1.0101 109 512 78.2 5.5e-17
FM177701 Sar sa 1.0101 109 507 77.6 8.6e-17
CAQ72969 Seb m 1.0201 110 503 77.1 1.2e-16
Q6ITU9 Lat c 1.0201 109 499 76.5 1.8e-16
XP_019397705 Cro p 1.0101 109 486 74.8 5.7e-16
Q91482 Sal s 1 109 484 74.6 6.9e-16
P86432 Onc m 1.0201 107 461 71.6 5.5e-15
AM904681 Lep w 1.0101 109 442 69.1 3.1e-14
CAC95152 Ran e 2 109 436 68.3 5.3e-14
P86431 Onc m 1.0101 108 422 66.5 1.9e-13
XP_019400389 Cro p 2.0101 110 421 66.4 2.1e-13
C1L370 Gal d 8.0101 110 421 66.4 2.1e-13
P02622 Gad c 1 113 416 65.8 3.3e-13
XP_026803769 Pan h 1.0201 109 382 61.3 6.9e-12
CAC83046 Ran e 1 110 369 59.6 2.3e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 103.3 bits 704,  Expect = 2e-24
 Identities = 110/110 100%, Positives = 110/110 100%, Gaps = 0/110 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR 110
            EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR 110

Sequence Alignment: 2. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 84.9 bits 563,  Expect = 5e-19
 Identities = 85/107 79%, Positives = 97/107 90%, Gaps = 1/107 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            M+FAGL +DAD+AAAL ACTAAD+F+HK+FF KVGL+ KS+DDVKK FY+IDQDKSGFIE
Sbjct  1    MSFAGL-NDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            E+ELKLFLQNF A ARAL+D ETKAFLA GD DGDGMIGVDEFA M+K
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 3. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 84.9 bits 563,  Expect = 5e-19
 Identities = 86/109 78%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DADI AAL AC AAD+F+HK+FF KVGL+ KSADDVKK F IIDQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNFKAGARAL+D ETK FL AGD+DGDG IGVDEF  +VKA
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 4. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 84.8 bits 562,  Expect = 6e-19
 Identities = 87/109 79%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DADIAAAL AC AAD+F+HK+FF KVGLS KS DDVKK F IIDQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNFKA ARAL+D ETK FL AGD+DGDG IGVDEFA +VKA
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 5. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 84.2 bits 558,  Expect = 9e-19
 Identities = 84/109 77%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DADI AAL  C AAD+FD+KSFF KVGLS K+ DD+KK F +IDQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNF AGARAL+D ETKAFL AGD+DGDG IGVDEFA +VKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 6. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 84.1 bits 557,  Expect = 9e-19
 Identities = 86/109 78%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DADIAAAL AC A  +FDHK+FF KVGL+GKSADDVKK F IIDQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNFK+ ARAL+D ETK FL AGD DGDG IGVDEFA +VKA
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 7. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 84.0 bits 556,  Expect = 1e-18
 Identities = 84/106 79%, Positives = 96/106 90%, Gaps = 1/106 0%
Query  2    AFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIEE 61
            +FAGL +DAD+AAAL ACTAAD+F+HK+FF KVGL+ KS+DDVKK FY+IDQDKSGFIEE
Sbjct  1    SFAGL-NDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   EELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            +ELKLFLQNF A ARAL+D ETKAFLA GD DGDGMIGVDEFA M+K
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 8. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 83.3 bits 551,  Expect = 2e-18
 Identities = 83/109 76%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DAD AAA+ AC AA++F +K+FF K GLSGKSADD+KK F++IDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQ FKAGARAL+D ETKAFL AGD+DGDG IGVDE+AV+VKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 9. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 82.9 bits 548,  Expect = 2e-18
 Identities = 83/108 76%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFA +L DA++ AAL  C AA +FDHK FFK  GLSGKS D+VKK F IIDQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EEELKLFLQNFKAGARALSD ETKAFL AGD+DGDG IG+DEFA M+K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 10. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 82.5 bits 545,  Expect = 3e-18
 Identities = 82/109 75%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DAD AAA+ AC AA++F +K+FF K GLSGKSADD+KK F++IDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQ FKAGARAL+D ETKAFL AGD+DGDG IGV+E+AV+VKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 11. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 82.3 bits 543,  Expect = 3e-18
 Identities = 85/108 78%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA+A LL  ADI AAL AC A D+F HK FF K+GL+ KSA D+KK F IIDQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EEELKLFLQNFKAGARAL+D ETKAFL AGDADGDGMIGVDEFAVM+K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 12. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 81.8 bits 539,  Expect = 5e-18
 Identities = 83/108 76%, Positives = 88/108 81%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFA +L DA+I AAL  C A  +FDHK FFK  GL+GKS DDVKK F IIDQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EEELKLFLQNFKAGAR LSD ETKAFL AGD DGDG IGVDEFA M+K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 13. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 81.8 bits 539,  Expect = 5e-18
 Identities = 82/108 75%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L++ADI AAL AC AAD+F HK FF KVGL+GKS DDVKK F +IDQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            E+ELKLFLQNF A ARAL+D ETK FL AGD+DGDG IGVDEFA +VK
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 14. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 81.5 bits 537,  Expect = 6e-18
 Identities = 83/109 76%, Positives = 92/109 84%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L DA++AAAL AC +A +FDH  FFK  GL+GKS+DDVKK F IIDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            EEELKLFLQNF A ARALSD ETKAFL AGD+DGDG IGVDEFA MVKA
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 15. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 81.2 bits 535,  Expect = 7e-18
 Identities = 79/109 72%, Positives = 94/109 86%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L++ADI AAL AC AAD+F +K FF KVGL+ K+ +D+KK F +IDQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNF AGARAL+D ETKAFL AGD+DGDG IG+DEFA +VKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 16. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 80.6 bits 530,  Expect = 1e-17
 Identities = 80/109 73%, Positives = 91/109 83%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DADI AAL AC A  +FDHK+FF KVGL+ KS+ D+KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNF AGARALSD ETK FL AGD+DGDG IGVDEF  M+KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 17. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 80.3 bits 528,  Expect = 1e-17
 Identities = 80/109 73%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DADI AAL AC A  +FDHK+FF KVGL+ KS  D+KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNF AGARALSD ETK FL AGD+DGDG IGVDEF  M+KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 18. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 80.3 bits 528,  Expect = 1e-17
 Identities = 80/109 73%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+L+DADI AAL AC A  +FDHK+FF KVGL+ KS  D+KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNF AGARALSD ETK FL AGD+DGDG IGVDEF  M+KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 19. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 79.5 bits 522,  Expect = 2e-17
 Identities = 78/107 72%, Positives = 89/107 83%, Gaps = 0/107 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFA +L +ADI AALGAC  AD+FDHK+FF KVGL GKS D++KK F IIDQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMV 107
            EEELKLFLQNF  GARAL+D ETK FL AGD+D DG IG+DEFA ++
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 20. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 78.9 bits 517,  Expect = 3e-17
 Identities = 80/109 73%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAFAG+LSDAD+AAAL AC  A TFD+K FFK  GL+ KS DDVKK F IIDQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+ELKLFLQNFKA AR L+D ET+AFL AGD+DGDG IG +EFA +V A
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA 109

Sequence Alignment: 21. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 78.2 bits 512,  Expect = 5e-17
 Identities = 79/108 73%, Positives = 88/108 81%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA+A  L+ ADI AAL AC+  DTF HK FF KVGLS KSADD+K  F +IDQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EEELKLFLQNF A ARAL++ ET AFL AGD+DGDGMIG+DEFA MVK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 22. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 77.6 bits 507,  Expect = 9e-17
 Identities = 79/108 73%, Positives = 90/108 83%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA+AGL+ +ADI AAL AC AAD+FDHK+FF KVG+SGKSAD++KK F IIDQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EEELKLFLQNF   ARAL+D ETK FL AGD  GDG IG+DEF  +VK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 23. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 77.1 bits 503,  Expect = 1e-16
 Identities = 81/108 75%, Positives = 88/108 81%, Gaps = 1/108 0%
Query  1    MAFAGL-LSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFI 59
            MAFA + L DADIAAAL  C  A  F+HK+FFK  GLSGKS+D+VKK F IIDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EEEELKLFLQ FKAGARALSD ETK FL AGD+DGDG IG DE+A MVK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 24. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 76.5 bits 499,  Expect = 2e-16
 Identities = 76/108 70%, Positives = 84/108 77%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MAF+ +LSD+D+AAAL  C  A TFDHK FF   GLS K++DDVKK F IIDQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EEELKLFLQNFKA AR L+D ET  FL AGD DGDG IG DEF  +VK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 25. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 74.8 bits 486,  Expect = 6e-16
 Identities = 75/109 68%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA   +LS  DI AAL +C AA++F++KSFF  VGL GKSAD VKK F I+DQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            E+EL+LFL+NF + ARAL+D ETKAFLAAGD DGDG IGVDEF  +VKA
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 26. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 74.6 bits 484,  Expect = 7e-16
 Identities = 76/108 70%, Positives = 85/108 78%, Gaps = 0/108 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA A L  +ADI  AL AC AADTF  K+FF  +G++ KSADDVKK F +IDQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
             EELKLFLQNF   AR L+D ETKAFL AGDADGDGMIG+DEFAV+VK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 27. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 71.6 bits 461,  Expect = 5e-15
 Identities = 71/106 66%, Positives = 85/106 80%, Gaps = 1/106 0%
Query  2    AFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIEE 61
            +FAGL +DAD+AAAL AC AAD+F+HK+FF K      S DD+KK    +DQDKSGF+EE
Sbjct  1    SFAGL-NDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   EELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            +ELKLFLQNF A ARAL+D ETK    AGDADGDGM+G+DEFAV+VK
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 28. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 69.1 bits 442,  Expect = 3e-14
 Identities = 69/109 63%, Positives = 84/109 77%, Gaps = 1/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            M FAGL   A+I AAL  C AAD+FD+K FF   GL+ KSA++VK  F  IDQD+SGFIE
Sbjct  1    MTFAGL-DAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR 110
            E+ELKLFLQNF A ARAL+DKET  FL AGD DGDG IG++EF  +V+++
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK 109

Sequence Alignment: 29. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 68.3 bits 436,  Expect = 5e-14
 Identities = 68/109 62%, Positives = 86/109 78%, Gaps = 0/109 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            M+   ++S+ DI AAL +  AA +F++K FF+KVGL+GKSA D KK F I+D+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109
            ++EL LFLQNF+A AR LSD ET AFL AGD+DGDG IGV+EF  +VKA
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 30. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 66.5 bits 422,  Expect = 2e-13
 Identities = 65/107 60%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  2    AFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIEE 61
            A A L  +AD+  AL AC AAD+F+ K+FF  +G++ K  DDVKK   ++DQD SGF+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   EELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108
            EELKLFLQNF      L+D ETKAFL AGDADGDGM+G+DEFAV+VK
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 31. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 66.4 bits 421,  Expect = 2e-13
 Identities = 67/107 62%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA   LLS  DI  A+GA  AA++F+HK FF+ VGL  KS DDVKK F+I+D+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMV 107
            E+ELK  L+ F   AR LSDKETK +LAAGD DGDG IGVDEF  +V
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 32. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 66.4 bits 421,  Expect = 2e-13
 Identities = 66/107 61%, Positives = 82/107 76%, Gaps = 0/107 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA   +LS  DI  A+GA +AA++F++K FF+ VGL  KS +DVKK F+I+D+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMV 107
            EEELK+ L+ F    R LSDKETKA+LAAGD DGDG IG DEFA MV
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 33. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 65.8 bits 416,  Expect = 3e-13
 Identities = 66/106 62%, Positives = 77/106 72%, Gaps = 0/106 0%
Query  2    AFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIEE 61
            AF G+LS+ADI AA  AC    +FD   F+ KVGL   SAD++KK F I D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   EELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMV 107
            +ELKLFL  F A  RAL+D ETKAFL AGD+DGDG IGVDEF  +V
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 34. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 61.3 bits 382,  Expect = 7e-12
 Identities = 61/107 57%, Positives = 72/107 67%, Gaps = 0/107 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            MA   LL   DI  AL     ADTFDHK FF+ VGL   SA++VKK F ++D D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMV 107
            E+ELK+ L+ F    R L+DKETKAFL A D DGDG IG+DEF  +V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 59.6 bits 369,  Expect = 2e-11
 Identities = 57/107 53%, Positives = 76/107 71%, Gaps = 0/107 0%
Query  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
            M    LL+  DI+ A+ A  A ++F+HK FF+  GL  KS + ++K F+++DQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMV 107
            +EEL L L+ F    R+LSDKET A+LAAGD DGDG IGVDEF  +V
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.