The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE
EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG
Sequence Info Allergen Name Length Opt Bits Score E Value
P59747 Sco j 1 109 697 106.7 1.5e-25
A0A1B1V0G7 Ras k 1.0101 109 665 102.3 3e-24
Q90YK7 The c 1 109 604 94.0 1e-21
CAQ72969 Seb m 1.0201 110 598 93.1 1.8e-21
Q6ITU9 Lat c 1.0201 109 576 90.1 1.4e-20
CAC83658 Cyp c 1.01 109 568 89.0 3.1e-20
FM202668 Xip g 1.0101 109 568 89.0 3.1e-20
CAC83659 Cyp c 1.02 109 562 88.2 5.4e-20
XP_026772003 Pan h 1.0101 109 558 87.7 7.9e-20
QCY53440 Cten i 1.0101 109 557 87.5 8.7e-20
CAQ72971 Clu h 1.0201 110 548 86.3 2.1e-19
CAM56786 Gad m 1.0202 109 542 85.5 3.6e-19
Q5IRB2 Lat c 1.0101 109 542 85.5 3.6e-19
Q90YK9 Gad m 1.0201 109 539 85.1 4.8e-19
AAK63087 Gad m 1.0201 109 539 85.1 4.8e-19
CAQ72972 Clu h 1.0301 109 534 84.4 7.8e-19
AAK63086 Gad m 1.0101 109 527 83.4 1.5e-18
CAQ72967 Thu a 1.0101 109 524 83.0 2e-18
CAM56785 Gad m 1.0102 109 521 82.6 2.7e-18
FM177701 Sar sa 1.0101 109 518 82.2 3.5e-18
CAQ72970 Clu h 1.0101 109 513 81.5 5.7e-18
CAA66404 Sal s 1 108 506 80.5 1.1e-17
Q91483 Sal s 1 107 499 79.6 2.1e-17
CAQ72968 Seb m 1.0101 109 493 78.7 3.8e-17
AM904681 Lep w 1.0101 109 482 77.2 1.1e-16
XP_019397705 Cro p 1.0101 109 478 76.7 1.6e-16
Q91482 Sal s 1 109 458 73.9 1.1e-15
CAC95152 Ran e 2 109 454 73.4 1.6e-15
P02622 Gad c 1 113 416 68.2 5.9e-14
P86431 Onc m 1.0101 108 405 66.7 1.6e-13
P86432 Onc m 1.0201 107 401 66.1 2.4e-13
XP_026803769 Pan h 1.0201 109 386 64.1 1e-12
C1L370 Gal d 8.0101 110 384 63.8 1.2e-12
XP_019400389 Cro p 2.0101 110 380 63.3 1.8e-12
CAC83046 Ran e 1 110 364 61.1 8.1e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 106.7 bits 697,  Expect = 1e-25
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG 109
            EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG 109

Sequence Alignment: 2. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 102.3 bits 665,  Expect = 3e-24
 Identities = 101/109 92%, Positives = 106/109 97%, Gaps = 0/109 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFASVLKDAE+TAALDGCKA GSFDHKKFFKACGL+GKS D+VKKAFAIIDQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG 109
            EEELKLFLQNFKAGAR LSDAETKAFLKAGD+DGDGKIG+DEFAAMIKG
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIKG 109

Sequence Alignment: 3. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 94.0 bits 604,  Expect = 1e-21
 Identities = 90/108 83%, Positives = 100/108 92%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +LKDAEV AAL+ CK+AGSFDH KFFK+CGL+GKS+D+VKKAF IIDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            EEELKLFLQNF A ARALSDAETKAFLKAGDSDGDGKIG+DEFAAM+K
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108

Sequence Alignment: 4. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 93.1 bits 598,  Expect = 2e-21
 Identities = 93/108 86%, Positives = 99/108 91%, Gaps = 1/108 0%
Query  1    MAFASV-LKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFI 59
            MAFASV LKDA++ AALDGCK AG F+HK FFK CGLSGKS+DEVKKAFAIIDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            EEEELKLFLQ FKAGARALSDAETK FLKAGDSDGDGKIG DE+AAM+K
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 5. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 90.1 bits 576,  Expect = 1e-20
 Identities = 84/108 77%, Positives = 96/108 88%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAF++VL D++V AALDGCK AG+FDHKKFF ACGLS K++D+VKKAFAIIDQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            EEELKLFLQNFKA AR L+D ET  FLKAGD+DGDGKIG DEF A++K
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 6. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 89.0 bits 568,  Expect = 3e-20
 Identities = 83/108 76%, Positives = 97/108 89%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA++TAAL GC+AA SFD+K FF   GLS K+ D++KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNF AGARAL+DAETKAFLKAGDSDGDGKIG+DEFAA++K
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 7. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 89.0 bits 568,  Expect = 3e-20
 Identities = 85/107 79%, Positives = 98/107 91%, Gaps = 0/107 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA VL DA+V AAL+ CK AG+FD+KKFFK+CGL+ KSTD+VKKAFAIIDQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMI 107
            E+ELKLFLQNFKA AR L+DAET+AFLKAGDSDGDGKIG +EFAA++
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALV 107

Sequence Alignment: 8. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 88.2 bits 562,  Expect = 5e-20
 Identities = 84/108 77%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA VL DA++TAAL+ CKAA SF+HK FF   GL+ KS D+VKKAFAIIDQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNFKAGARAL+D ETK FLKAGDSDGDGKIG+DEF A++K
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVK 108

Sequence Alignment: 9. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 87.7 bits 558,  Expect = 8e-20
 Identities = 82/108 75%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA VL DA++ AALD CKA GSFDHK FF   GL+GKS D+VKKAF+IIDQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNFK+ ARAL+D ETK FLKAGD+DGDGKIG+DEFA+++K
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVK 108

Sequence Alignment: 10. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 87.5 bits 557,  Expect = 9e-20
 Identities = 84/108 77%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA++ AAL+ CKAA SF+HK FF   GLS KS D+VKKAFAIIDQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNFKA ARAL+DAETK FLKAGDSDGDGKIG+DEFAA++K
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 11. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 86.3 bits 548,  Expect = 2e-19
 Identities = 83/108 76%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA++ AAL  C AA +FDHK FFK  GLSGKS D+VKK F IIDQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            EEELKLFLQNFKAGARALSD ETKAFL AGD+DGDG IG+DEFA M+K
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108

Sequence Alignment: 12. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 85.5 bits 542,  Expect = 4e-19
 Identities = 81/108 75%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA++TAAL  CKA GSFDHK FF   GL+ KS+ ++KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNF AGARALSDAETK FLKAGDSDGDGKIG+DEF AMIK
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 13. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 85.5 bits 542,  Expect = 4e-19
 Identities = 81/108 75%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L +A++TAAL  C+AA SF HK FF   GL+GKS D+VKKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNF A ARAL+DAETK FLKAGDSDGDGKIG+DEFAA++K
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 14. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 85.1 bits 539,  Expect = 5e-19
 Identities = 81/108 75%, Positives = 90/108 83%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA++TAAL  CKA GSFDHK FF   GL+ KS  ++KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNF AGARALSDAETK FLKAGDSDGDGKIG+DEF AMIK
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 15. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 85.1 bits 539,  Expect = 5e-19
 Identities = 81/108 75%, Positives = 90/108 83%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA++TAAL  CKA GSFDHK FF   GL+ KS  ++KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNF AGARALSDAETK FLKAGDSDGDGKIG+DEF AMIK
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 16. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 84.4 bits 534,  Expect = 8e-19
 Identities = 83/107 77%, Positives = 90/107 84%, Gaps = 0/107 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA+ LK+A++TAAL  CK A SFDHK FF   GL GKS DE+KKAF IIDQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMI 107
            EEELKLFLQNF  GARAL+D ETK FLKAGDSD DGKIGIDEFAA+I
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 17. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 83.4 bits 527,  Expect = 2e-18
 Identities = 78/108 72%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA+  AA+  C+AA SF +K FF  CGLSGKS D++KKAF +IDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQ FKAGARAL+DAETKAFLKAGDSDGDG IG+DE+A ++K
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108

Sequence Alignment: 18. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 83.0 bits 524,  Expect = 2e-18
 Identities = 78/108 72%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L +A++TAAL  C+AA SF +K FF   GL+ K+ +++KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNF AGARAL+DAETKAFL AGDSDGDGKIGIDEFAA++K
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108

Sequence Alignment: 19. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 82.6 bits 521,  Expect = 3e-18
 Identities = 77/108 71%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MAFA +L DA+  AA+  C+AA SF +K FF  CGLSGKS D++KKAF +IDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQ FKAGARAL+DAETKAFLKAGDSDGDG IG++E+A ++K
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVK 108

Sequence Alignment: 20. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 82.2 bits 518,  Expect = 4e-18
 Identities = 79/108 73%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA+A ++K+A++TAAL+ CKAA SFDHK FF   G+SGKS DE+KKAFAIIDQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            EEELKLFLQNF   ARAL+D ETK FLKAGD+ GDGKIGIDEF  ++K
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 21. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 81.5 bits 513,  Expect = 6e-18
 Identities = 80/108 74%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA+AS+LK A++ AAL  C+A  SF HK FF   GL+ KS  ++KKAF IIDQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            EEELKLFLQNFKAGARAL+DAETKAFLKAGD+DGDG IG+DEFA MIK
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 22. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 80.5 bits 506,  Expect = 1e-17
 Identities = 79/108 73%, Positives = 89/108 82%, Gaps = 1/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            M+FA  L DA+V AAL  C AA SF+HK FF   GL+ KS+D+VKKAF +IDQDKSGFIE
Sbjct  1    MSFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG 109
            E+ELKLFLQNF A ARAL+DAETKAFL  GD DGDG IG+DEFAAMIKG
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKG 108

Sequence Alignment: 23. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 79.6 bits 499,  Expect = 2e-17
 Identities = 78/107 72%, Positives = 88/107 82%, Gaps = 1/107 0%
Query  2    AFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEE 61
            +FA  L DA+V AAL  C AA SF+HK FF   GL+ KS+D+VKKAF +IDQDKSGFIEE
Sbjct  1    SFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   EELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG 109
            +ELKLFLQNF A ARAL+DAETKAFL  GD DGDG IG+DEFAAMIKG
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKG 107

Sequence Alignment: 24. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 78.7 bits 493,  Expect = 4e-17
 Identities = 75/109 68%, Positives = 87/109 79%, Gaps = 0/109 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA+A+ L  A++TAAL  C    +F HK FF   GLS KS D++K AF +IDQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG 109
            EEELKLFLQNF A ARAL++AET AFLKAGDSDGDG IG+DEFAAM+KG
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVKG 109

Sequence Alignment: 25. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 77.2 bits 482,  Expect = 1e-16
 Identities = 75/107 70%, Positives = 86/107 80%, Gaps = 1/107 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            M FA  L  AE+ AALDGC AA SFD+KKFF ACGL+ KS +EVK AF  IDQD+SGFIE
Sbjct  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+ELKLFLQNF A ARAL+D ET  FLKAGD DGDGKIGI+EF  +++
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107

Sequence Alignment: 26. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 76.7 bits 478,  Expect = 2e-16
 Identities = 69/108 63%, Positives = 86/108 79%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA   +L   ++ AAL  C+AA SF++K FF   GL GKS D+VKK F I+DQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            E+EL+LFL+NF + ARAL+DAETKAFL AGD+DGDGKIG+DEF A++K
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108

Sequence Alignment: 27. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 73.9 bits 458,  Expect = 1e-15
 Identities = 70/108 64%, Positives = 84/108 77%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA A + K+A++  AL+ CKAA +F  K FF   G++ KS D+VKKAF +IDQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
             EELKLFLQNF   AR L+DAETKAFLKAGD+DGDG IGIDEFA ++K
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 28. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 73.4 bits 454,  Expect = 2e-15
 Identities = 66/108 61%, Positives = 87/108 80%, Gaps = 0/108 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            M+   ++ + ++ AAL+  KAAGSF++K FF+  GL+GKS  + KK F I+D+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            ++EL LFLQNF+A AR LSDAET AFLKAGDSDGDGKIG++EF A++K
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVK 108

Sequence Alignment: 29. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 68.2 bits 416,  Expect = 6e-14
 Identities = 64/106 60%, Positives = 76/106 71%, Gaps = 0/106 0%
Query  2    AFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEE 61
            AF  +L +A++ AA   C   GSFD   F+   GL   S DE+KK F I D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   EELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMI 107
            +ELKLFL  F A  RAL+DAETKAFLKAGDSDGDGKIG+DEF A++
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 30. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 66.7 bits 405,  Expect = 2e-13
 Identities = 61/107 57%, Positives = 79/107 73%, Gaps = 0/107 0%
Query  2    AFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEE 61
            A A + K+A++  AL+ CKAA SF+ K FF   G++ K  D+VKK   ++DQD SGF+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   EELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            EELKLFLQNF      L+DAETKAFLKAGD+DGDG +G+DEFA ++K
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 31. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 66.1 bits 401,  Expect = 2e-13
 Identities = 63/106 59%, Positives = 77/106 72%, Gaps = 1/106 0%
Query  2    AFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEE 61
            +FA  L DA+V AAL  C AA SF+HK FF        S D++KK    +DQDKSGF+EE
Sbjct  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   EELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108
            +ELKLFLQNF A ARAL+DAETK    AGD+DGDG +G+DEFA ++K
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 32. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 64.1 bits 386,  Expect = 1e-12
 Identities = 59/107 55%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA   +LK  ++  ALD  K A +FDHKKFF+  GL   S + VKK F+++D D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMI 107
            E+ELK+ L+ F    R L+D ETKAFL A D DGDGKIGIDEF A++
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 33. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 63.8 bits 384,  Expect = 1e-12
 Identities = 60/107 56%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA   VL   ++  A+    AA SF++KKFF+  GL  KS ++VKK F I+D+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMI 107
            EEELK+ L+ F    R LSD ETKA+L AGD DGDGKIG DEFA M+
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 34. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 63.3 bits 380,  Expect = 2e-12
 Identities = 58/107 54%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            MA   +L   ++  A+    AA SF+HKKFF+  GL  KS D+VKK F I+D+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMI 107
            E+ELK  L+ F   AR LSD ETK +L AGD DGDGKIG+DEF +++
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 61.1 bits 364,  Expect = 8e-12
 Identities = 53/107 49%, Positives = 73/107 68%, Gaps = 0/107 0%
Query  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
            M    +L   +++ A+    A  SF+HKKFF+ CGL  KS + ++K F ++DQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMI 107
            +EEL L L+ F    R+LSD ET A+L AGD DGDGKIG+DEF  ++
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.