The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDD
DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMN
YYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNP
VYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNES
GKQLVASQVIPANWAPMAVYRSFVQYSS
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72984 Ory s 1 268 1870 358.8 1.2e-100
AAF72987 Ory s 1 275 1416 274.0 4e-75
AAF72985 Ory s 1 286 1301 252.5 1.2e-68
AAF72989 Ory s 1 271 1221 237.6 3.6e-64
AAB61710 Ory s 1 261 1208 235.2 1.8e-63
AAD10496 Tri a ps93 271 1105 215.9 1.2e-57
ACA23876 Pas n 1.0101 265 1062 207.9 3e-55
P58738 Zea m 1 269 1062 207.9 3.1e-55
AAF72990 Ory s 1 269 1043 204.3 3.6e-54
AAF72991 Ory s 1 267 1042 204.2 4.1e-54
AAF72988 Ory s 1 327 1013 198.6 2.3e-52
AAF72983 Ory s 1 267 988 194.1 4.4e-51
A0A4D6G2J8 Uro m 1.0201 229 974 191.5 2.2e-50
QCX36431 Zoy m 1.0101 272 973 191.3 3.1e-50
CAA10140 Hol l 1 263 953 187.5 4e-49
P43216 Hol l 1 265 953 187.5 4e-49
A0A4D6FZ45 Uro m 1.0101 262 951 187.2 5.2e-49
AAL14079 Cyn d 1.0203 262 951 187.2 5.2e-49
CAA10520 Poa p a 263 950 187.0 5.9e-49
P43213 Phl p 1 263 945 186.1 1.1e-48
AAL14078 Cyn d 1 262 941 185.3 1.9e-48
O04701 Cyn d 1 246 939 185.0 2.2e-48
CAA93121 Hol l 1.0102 248 938 184.8 2.6e-48
AAL14077 Cyn d 1.0202 262 938 184.7 2.8e-48
Q41260 Pha a 1 269 932 183.6 6.3e-48
CAB63699 Lol p 1.0103 263 927 182.7 1.2e-47
CAA81613 Phl p 1.0101 263 925 182.3 1.5e-47
AAA63279 Lol p 1.0101 263 920 181.4 2.9e-47
AAA63278 Lol p 1.0102 252 915 180.5 5.2e-47
P14946 Lol p 1 263 914 180.3 6.2e-47
AAF80379 Cyn d 1.0204 244 912 179.9 7.3e-47
AAK96255 Cyn d 1.0201 244 911 179.7 8.3e-47
AAA50175 Gly m 2 277 877 173.3 8e-45
Q07154 Zea m 1 191 873 172.8 8.3e-45
ABC58726 Sor h 1.0101 239 874 172.8 9.7e-45
AAF72986 Ory s 1 275 818 162.3 1.6e-41
Q40638 Ory s 1 263 803 159.5 1.1e-40
CAB37496 Ara t expansin 265 481 99.4 1.4e-22
AAG13596 Ory s 1 275 390 82.4 1.9e-17
BAA85432 Ory s 1 284 366 77.9 4.4e-16
P43214 Phl p 2 122 227 52.3 9.4e-09
CAA10348 Poa p 2 122 227 52.3 9.4e-09
CAA10346 Cyn d 2 122 226 52.2 1.1e-08
CAA10345 Dac g 2 122 226 52.2 1.1e-08
P93124 Dac g 3 96 189 45.4 9.3e-07
2JNZ_A Phl p 3.0101 108 181 43.8 3.1e-06
P14947 Lol p 2 97 179 43.5 3.5e-06
CAA51775 Lol p 2 88 169 41.7 1.1e-05
AAP80171 Cyn d 15 112 166 41.0 2.2e-05
P14948 Lol p 3 97 157 39.4 6e-05
CAA90746 Tri a 3 118 148 37.6 0.00025
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 358.8 bits 1870,  Expect = 1e-100
 Identities = 268/268 100%, Positives = 268/268 100%, Gaps = 0/268 0%
Query  1    MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDD 60
            MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDD
Sbjct  1    MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDD 60
Query  61   DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMN 120
            DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMN
Sbjct  61   DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMN 120
Query  121  YYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNP 180
            YYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNP
Sbjct  121  YYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNP 180
Query  181  VYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNES 240
            VYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNES
Sbjct  181  VYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNES 240
Query  241  GKQLVASQVIPANWAPMAVYRSFVQYSS 268
            GKQLVASQVIPANWAPMAVYRSFVQYSS
Sbjct  241  GKQLVASQVIPANWAPMAVYRSFVQYSS 268

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 274.0 bits 1416,  Expect = 4e-75
 Identities = 204/262 77%, Positives = 226/262 86%, Gaps = 7/262 2%
Query  6    SKKAAVAALFSFLVVTCVAGARPGNFSASDFTA-DPNWEVARATWYGAPTGAGPDDDGGA 64
            SK AA+ A++S LVV       P N++ SD +A    W  ARATWYGAPTGAGPDD+GGA
Sbjct  7    SKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGA 66
Query  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
            CGFKN NQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC   P+CSGN ETVIITDMNYYPV
Sbjct  67   CGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPV 126
Query  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFA 184
            ++YHFDLSGTAFGAMAKPG ND+LRH+GIIDIQF+RVPCN+PGLK+ FHVEEGSNPVYFA
Sbjct  127  ARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYFA 186
Query  185  VLVEYEDGDGDVVQVDLMEANSQS------WTPMRESWGSIWRLDSNHRLTAPFSLRITN 238
            VLVEYED DGDVVQVDLME+ S        WTPMRESWGSIWRLDSNHRL APFSLRI +
Sbjct  187  VLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRS 246
Query  239  ESGKQLVASQVIPANWAPMAVYRSFVQYS 267
            +SGK LVA+ VIPANW+P + YRS VQ+S
Sbjct  247  DSGKTLVANNVIPANWSPNSNYRSIVQFS 275

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 252.5 bits 1301,  Expect = 1e-68
 Identities = 195/260 75%, Positives = 220/260 84%, Gaps = 28/260 10%
Query  4    SISKKAAVAALFSFLVVTCVAGARPGNFSASDFTAD------------------PNWEVA 45
            S+S  AA A ++S+L V   A A   +F+A+D  AD                  P W  A
Sbjct  3    SLSSLAAAAVFLSLLAVGHCAAA---DFNATDADADFAGNGWDFNSSDAAVYWGP-WTKA 58
Query  46   RATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHP 105
            RATWYG P GAGPDD+GGACGFK+TNQYPF SMTSCGN+P+FKDGKGCGSCY+IRC    
Sbjct  59   RATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQ 118
Query  106  ACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNF 165
            +CSG  ETVIITDMNYYPV+ +HFDLSGTAFG +AKPG ND+LRH+GIIDI+F RVPC F
Sbjct  119  SCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEF 178
Query  166  PGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQ------SWTPMRESWGSI 219
            PGLK+ FHVEE SNPVYFAVLVEYEDGDGDVVQVDLME+ +        WTPMRESWGSI
Sbjct  179  PGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSI 238
Query  220  WRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQYS 267
            WRLD+NHRL APFS+RI NESGK LVA+ VIPANW P   YRSFVQYS
Sbjct  239  WRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS 286

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 237.6 bits 1221,  Expect = 4e-64
 Identities = 166/227 73%, Positives = 189/227 83%, Gaps = 2/227 0%
Query  42   WEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC 101
            W  A+ATWYG P GAG  D+GGACGFK  NQYPF  MTSCGN+P++K GKGCGSCY++RC
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  102  VNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRV 161
              +PACSGN +TV ITDMNY+P+S+YHFDLSG AFG +AKPG+ D LR AGIID+QF RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  162  PCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQS--WTPMRESWGSI 219
            PC FPGLKV FHVEEGS+PVY+AVLVEYE+GDGDV QVDL EA +    WTPMRESWGS+
Sbjct  163  PCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSV 222
Query  220  WRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQYSS 268
            WRLDSNHRL APFS+RI ++SGK LVA  VIP NW P   YRSFVQYSS
Sbjct  223  WRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 235.2 bits 1208,  Expect = 2e-63
 Identities = 165/226 73%, Positives = 192/226 84%, Gaps = 5/226 2%
Query  41   NWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIR 100
            +W  A+ATWYG P GAGPDD+GGACGFKNTNQYPF SMTSCGNEP+F+DGKGCG+CYQIR
Sbjct  30   DWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIR 89
Query  101  CVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKR 160
            C N+P+CSG P TVIITDMNYYPV++YHFDLSGTAFGAMA+PG NDQLRHAGIIDIQF+R
Sbjct  90   CTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRR 149
Query  161  VPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEA-----NSQSWTPMRES 215
            VPC   GL V FHVE GSNPVY+AVLVE+ + DG VVQ+D+ME+      ++ WTPMR S
Sbjct  150  VPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRS 209
Query  216  WGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQY 266
            WGSIWRLD+NHRL  P SLR+ +ESG+ ++A QVIPANW     Y S VQ+
Sbjct  210  WGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 6. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 215.9 bits 1105,  Expect = 1e-57
 Identities = 157/264 59%, Positives = 200/264 75%, Gaps = 8/264 3%
Query  1    MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDD 60
            MA   S   A+ AL+S L  +  +        A  +T+   W  A+ATWYGAP GAGPDD
Sbjct  1    MAGVSSNAIALVALLSMLFTSVRSAVNYDTAVARSYTS--GWLPAKATWYGAPNGAGPDD 58
Query  61   DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC--VNHPACSGNPETVIITD 118
            +GGACGFKN NQYP SSM +CGNEPIF  G+GCG CY+I+C   N+P+CSG P  ++ITD
Sbjct  59   NGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITD 118
Query  119  MNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGS 178
            MNYYPV++YH+DLSGTAFG+MAK G ND+LRHAGIID+QF+RVPCNFPG+KVTFHV+ GS
Sbjct  119  MNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPGMKVTFHVQRGS 178
Query  179  NPVYFAVLVEYEDGDGDVVQVDLMEA-NSQS---WTPMRESWGSIWRLDSNHRLTAPFSL 234
            NP Y+AVLVEY + DG VV+++LM+  N +    W  MR SWGS+WR+D+N  +  PFS+
Sbjct  179  NPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSI 238
Query  235  RITNESGKQLVASQVIPANWAPMAVYRSFVQY 266
            RIT+++GK LVA+  IPA W     Y S +Q+
Sbjct  239  RITSDTGKTLVANNAIPAYWQQDHAYWSNLQF 270

Sequence Alignment: 7. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 207.9 bits 1062,  Expect = 3e-55
 Identities = 151/260 58%, Positives = 191/260 73%, Gaps = 6/260 2%
Query  4    SISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPN--WEVARATWYGAPTGAGPDDD 61
            S++K  AVAA+++ LV     G  P      + T + N  W  A+ATWYG P GAGPDD+
Sbjct  3    SLAKIVAVAAVLAALVAGGSCGP-PKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDDN 61
Query  62   GGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNY 121
            GGACG KN N  P++  T+CGN PIFKDGKGCGSCY+IRC N P CSG P TV ITDMNY
Sbjct  62   GGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRC-NKPECSGQPVTVFITDMNY 120
Query  122  YPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNP 180
             P++ YHFDLSG AFGAMAKPG ND+LRH GI D++F+RV C + G  K+ FHVE+GSNP
Sbjct  121  EPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNP 180
Query  181  VYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNES 240
             Y+A+LV++   DGD+V ++L E  S  W PM+ SWG+IWR+D+   L  PFS+R+T+ES
Sbjct  181  NYLAMLVKFVADDGDIVLMELKE-KSSDWKPMKLSWGAIWRMDTPKALVPPFSIRLTSES 239
Query  241  GKQLVASQVIPANWAPMAVYRSFVQY 266
            GK+++A  VIP NW P  VY S VQ+
Sbjct  240  GKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 8. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 207.9 bits 1062,  Expect = 3e-55
 Identities = 146/265 55%, Positives = 190/265 71%, Gaps = 4/265 1%
Query  1    MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPN--WEVARATWYGAPTGAGP 58
            M   ++    V A+++ LV     G  P      + T + N  W  ARATWYG P GAG 
Sbjct  1    MGSLVNNIMVVGAVLAALVAGGSCGP-PKVPPGPNITTNYNGKWLTARATWYGQPNGAGA 59
Query  59   DDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITD 118
             D+GGACG KN N  P+S MT+CGN PIFKDGKGCGSCY++RC   P CSGNP TV ITD
Sbjct  60   PDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITD 119
Query  119  MNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEG 177
            MNY P++ YHFDLSG AFG++AKPG ND++RH GI+D++F+RV C +P G K+ FH+E+G
Sbjct  120  MNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKG 179
Query  178  SNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRIT 237
             NP Y+AVLV+Y   DGD+V +++ +  S  W PM+ SWG+IWR+D+   L  PFS+R+T
Sbjct  180  CNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT 239
Query  238  NESGKQLVASQVIPANWAPMAVYRSFVQY 266
            +ESGK+++A  VIPANW P AVY S VQ+
Sbjct  240  SESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 9. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 204.3 bits 1043,  Expect = 4e-54
 Identities = 144/237 60%, Positives = 178/237 75%, Gaps = 3/237 1%
Query  28   PGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIF 87
            PG    +++ A P W  ARATWYG P G+G  D+GGACG KN N  P++ M SCGN PIF
Sbjct  31   PGPNITTNYNA-P-WLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIF 88
Query  88   KDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQ 147
            KDG+GCGSCY+++C    ACS  P TV ITDMNY P+S YHFD+SG AFGAMA PG+  +
Sbjct  89   KDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETE 148
Query  148  LRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANS 206
            LR AGIID+QF+RV C +PG  KVTFHVE+GSNP Y+AVLV++   DGDV+Q+DL EA  
Sbjct  149  LRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGL 208
Query  207  QSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQY 266
             +W PM+ SWG+IWR+D+   L APFS+R+T ESGK L+A  VIP NW P A+Y S VQ+
Sbjct  209  PAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 10. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 204.2 bits 1042,  Expect = 4e-54
 Identities = 150/262 57%, Positives = 189/262 72%, Gaps = 6/262 2%
Query  1    MAFSISKKAAVAALFSFLVVTC-VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGP 58
            MA S    A V A      V+C      PG N +A+       W  AR TWYG P GAGP
Sbjct  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAA---YGKQWLEARGTWYGKPKGAGP 57
Query  59   DDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITD 118
            DD+GGACG+K+ ++ PF  M SCGN+PIFKDGKGCGSC++++C    ACS  P  + ITD
Sbjct  58   DDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITD 117
Query  119  MNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEG 177
            MN  P++ YHFDLSG AFGAMAK G++++LR AGIID+QF+RV C +PG  KVTFHVE+G
Sbjct  118  MNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKG 177
Query  178  SNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRIT 237
            SNP YFAVLV+Y  GDGDVV+V+L E  S+ W P+ ESWG+IWR+D+   L  PFSLR+T
Sbjct  178  SNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVT 237
Query  238  NESGKQLVASQVIPANWAPMAVYRSFVQ 265
             ES ++LVA+ VIP NW   A+Y+S +Q
Sbjct  238  TESDQKLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 198.6 bits 1013,  Expect = 2e-52
 Identities = 184/238 77%, Positives = 202/238 84%, Gaps = 10/238 4%
Query  29   GNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFK 88
            G+ + S       W  ARATWYGAP GAGPDD+GGACGFKN N  PFS+MTSCGNEP+FK
Sbjct  79   GSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFK 138
Query  89   DGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQL 148
            DGKGCGSCYQIRCV HPACSG PETVIITDMNYYPVS YHFDLSGTAFGAMAK  +ND+L
Sbjct  139  DGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDEL 198
Query  149  RHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQS 208
            RHAGIIDIQF+RVPC +PGL VTFHVE+GSNPVY A+LVEYE+GDGDVVQVDLME+   +
Sbjct  199  RHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYST 258
Query  209  ----------WTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMA 258
                      WTPMRESWGSIWRLD+NH L  PFSLRITNESGK L+A QVIPA+W P  
Sbjct  259  GGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNT 318
Query  259  VYRSFVQY 266
            VY S VQ+
Sbjct  319  VYSSIVQF 326

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 194.1 bits 988,  Expect = 4e-51
 Identities = 134/252 53%, Positives = 181/252 71%, Gaps = 4/252 1%
Query  11   VAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNT 70
            VAA+ S   V+C     P   + +    D  W  A+ATWYGAP GAGP D+GGACG+K+ 
Sbjct  13   VAAMVS--AVSCGPPKVPPGPNITTSYGD-KWLEAKATWYGAPKGAGPKDNGGACGYKDV 69
Query  71   NQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFD 130
            ++ PF  M SCGN+PIFKDGKGCGSC++I+C    ACS  P  + +TDMN  P++ YHFD
Sbjct  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFD 129
Query  131  LSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEY 189
            LSG AFGAMAK G++++LR AGIID QF+RV C +P   K+TFH+E+ SNP Y+A+LV+Y
Sbjct  130  LSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKY 189
Query  190  EDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQV 249
              GDGDVV+V++ E  S+ W  ++ESWG+IWR+D+   L  PFS+R+T E G++++A   
Sbjct  190  VAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA 249
Query  250  IPANWAPMAVYRSFVQ 265
            IP  W   +VY+S VQ
Sbjct  250  IPDGWKADSVYKSNVQ 265

Sequence Alignment: 13. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 191.5 bits 974,  Expect = 2e-50
 Identities = 130/227 57%, Positives = 169/227 74%, Gaps = 3/227 1%
Query  39   DPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQ 98
            D  W  A+ATWYG PTGAGPDD+GGACG+K+ N+ PF+SM +CGN PIFKDG GCGSCY+
Sbjct  1    DGKWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYE 60
Query  99   IRCVNHPA-CSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQ 157
            I+C + PA CSG P  V ITD NY P++ YHFDL+GTAFGAMAK G+ ++LR AGIID+Q
Sbjct  61   IKC-DKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQ 119
Query  158  FKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESW 216
            F+RV C +P   K+ FHVE+G NP YFA+L++Y  GDGD+V VD+ E  S+ + P++ SW
Sbjct  120  FRRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSW 179
Query  217  GSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQY 266
            G+IWR+DS   +  P ++R+T+E G  LV    IP  W    VY S +Q+
Sbjct  180  GAIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 14. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 191.3 bits 973,  Expect = 3e-50
 Identities = 140/255 54%, Positives = 180/255 70%, Gaps = 8/255 3%
Query  9    AAVAALFSFLV--VTCVAGARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGA 64
            AAVA L+S +V    C  G +PG N +A   T +  W+ A+AT+YG+ P GA PDDDGGA
Sbjct  13   AAVAVLLSAMVGSALCEIGDKPGPNITA---TYNEEWQDAKATFYGSNPRGAAPDDDGGA 69
Query  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
            CG+KN ++ PF  MT CGNEPIFKDG GCGSC++I+C     CS  P  + ITD NY  +
Sbjct  70   CGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHI 129
Query  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYF 183
            + YHFDLSG AFG+MAK GQ D LR AG + +QF+RV C +P   K+TFHVE+G N  Y+
Sbjct  130  AAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYL 189
Query  184  AVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ 243
            A+LVEY  GDGD+V VD+    S  + PM+ SWG+IWR+D    L  PF++R+T+ESG +
Sbjct  190  ALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAK 249
Query  244  LVASQVIPANWAPMAVYRSFVQY 266
            LV   VIPA+W P   Y S +QY
Sbjct  250  LVQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 15. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 187.5 bits 953,  Expect = 4e-49
 Identities = 133/249 53%, Positives = 177/249 71%, Gaps = 7/249 2%
Query  11   VAALFSFLVVTC--VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGF 67
            V ALF+ ++ T   +A   PG N +A   T    W  A++TWYG PTGAGP D+GGACG+
Sbjct  10   VVALFAVFLGTAHGIAKVPPGPNITA---TYGDKWLDAKSTWYGKPTGAGPKDNGGACGY 66
Query  68   KNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKY 127
            K+ ++ PFS MT CGN PIFK G+GCGSC++I+C    +CSG P  V ITD N  P++ Y
Sbjct  67   KDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEPIAAY 126
Query  128  HFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVL 186
            H+DLSG AFGAMAK G+  +LR AG ++++F+RV C +P G KVTFHVE+GSNP Y+A+L
Sbjct  127  HLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALL 186
Query  187  VEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVA 246
            V+Y DGDGDVV VD+ E     W  ++ESWG++WR+D+  +LT PF++R T E G ++ A
Sbjct  187  VKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEA 246
Query  247  SQVIPANWAPMAVYRS 262
              VIP  W     Y S
Sbjct  247  EDVIPEGWKADTAYES 262

Sequence Alignment: 16. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 187.5 bits 953,  Expect = 4e-49
 Identities = 133/249 53%, Positives = 178/249 71%, Gaps = 7/249 2%
Query  11   VAALFSFLVVTC--VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGF 67
            VAALF+ ++ +   +A   PG N +A   T    W  A++TWYG PTGAGP D+GGACG+
Sbjct  12   VAALFAVFLGSAHGIAKVPPGPNITA---TYGDEWLDAKSTWYGKPTGAGPKDNGGACGY 68
Query  68   KNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKY 127
            K+ ++ PFS MT CGN PIFKDG+GCGSC++I+C    +CSG P TV ITD N  P++ Y
Sbjct  69   KDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIAPY 128
Query  128  HFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVL 186
            HFDLSG AFG+MAK G+  +LR AG ++++F+RV C +P G K TFHVE+GSNP Y+A+L
Sbjct  129  HFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALL 188
Query  187  VEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVA 246
            V+Y DGDGDVV VD+ E     W  ++ESWG++WR+D+  +LT PF++R T E G +  A
Sbjct  189  VKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEA 248
Query  247  SQVIPANWAPMAVYRS 262
              VIP  W     Y +
Sbjct  249  EDVIPEGWKADTAYEA 264

Sequence Alignment: 17. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 187.2 bits 951,  Expect = 5e-49
 Identities = 134/255 52%, Positives = 181/255 70%, Gaps = 8/255 3%
Query  9    AAVAALFSFLV--VTCVAGARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGA 64
            A VA +++ +V    C  G +PG N +A   T    W  A+AT+YG+ P GA PDD GGA
Sbjct  3    AVVAVVLASMVGGALCAMGDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
Query  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
            CG+K+ ++ PF SMT CGNEPIFKDG GCGSCY+I+C     CSG P  + ITD NY  +
Sbjct  60   CGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
Query  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYF 183
            + YHFDLSG AFGAMAK G+ D+LR AG + +QF+RV C +P   K+ FHVE+GSNP Y+
Sbjct  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYL 179
Query  184  AVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ 243
            A+LV+Y  GDG++V VD+    S  + PM++SWG+IWR+D    L  PF++R+T+ESG +
Sbjct  180  ALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
Query  244  LVASQVIPANWAPMAVYRSFVQY 266
            +    VIP +W P  VY+S +Q+
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 18. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 187.2 bits 951,  Expect = 5e-49
 Identities = 134/255 52%, Positives = 181/255 70%, Gaps = 8/255 3%
Query  9    AAVAALFSFLV--VTCVAGARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGA 64
            A VA +++ +V    C  G +PG N +A   T    W  A+AT+YG+ P GA PDD GGA
Sbjct  3    AVVAVVLASMVGGALCAMGDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
Query  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
            CG+K+ ++ PF SMT CGNEPIFKDG GCGSCY+I+C     CSG P  + ITD NY  +
Sbjct  60   CGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
Query  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYF 183
            + YHFDLSG AFGAMAK G+ D+LR AG + +QF+RV C +P   K+ FHVE+GSNP Y+
Sbjct  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYL 179
Query  184  AVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ 243
            A+LV+Y  GDG++V VD+    S  + PM++SWG+IWR+D    L  PF++R+T+ESG +
Sbjct  180  ALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
Query  244  LVASQVIPANWAPMAVYRSFVQY 266
            +    VIP +W P  VY+S +Q+
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 19. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 187.0 bits 950,  Expect = 6e-49
 Identities = 135/249 54%, Positives = 175/249 70%, Gaps = 7/249 2%
Query  11   VAALFSFLVVTC--VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGF 67
            V ALF+ ++ T   +A   PG N +A   T    W  A++TWYG PTGAGP D+GGACG+
Sbjct  10   VVALFAVFLGTAHGIAKVPPGPNITA---TYGDKWLDAKSTWYGKPTGAGPKDNGGACGY 66
Query  68   KNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKY 127
            K+ ++ PFS MT CGN PIFK G+GCGSC++I+C    +CSG P  V ITD N  P++ Y
Sbjct  67   KDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEEPIAAY 126
Query  128  HFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVL 186
            HFDLSG AFGAMAK G+  +LR AG ++++F+RV C +P G KVTFHVE+GSNP Y+A+L
Sbjct  127  HFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALL 186
Query  187  VEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVA 246
            V+Y  GDGDVV VD+ E     W  ++ESWGSIWR+D+  +LT PF++R T E G +  A
Sbjct  187  VKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEA 246
Query  247  SQVIPANWAPMAVYRS 262
              VIP  W     Y S
Sbjct  247  EDVIPEGWKADTAYAS 262

Sequence Alignment: 20. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 186.1 bits 945,  Expect = 1e-48
 Identities = 133/249 53%, Positives = 173/249 69%, Gaps = 7/249 2%
Query  11   VAALFSFLVVTC--VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGF 67
            V  LF+ ++ +   +    PG N +A   T    W  A++TWYG PTGAGP D+GGACG+
Sbjct  10   VVVLFAVFLGSAYGIPKVPPGPNITA---TYGDKWLDAKSTWYGKPTGAGPKDNGGACGY 66
Query  68   KNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKY 127
            K+ ++ PFS MT CGN PIFK G+GCGSC++I+C    ACSG P  V ITD N  P++ Y
Sbjct  67   KDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPY 126
Query  128  HFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVL 186
            HFDLSG AFGAMAK G   +LR AG +++QF+RV C +P G KVTFHVE+GSNP Y+A+L
Sbjct  127  HFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALL 186
Query  187  VEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVA 246
            V+Y +GDGDVV VD+ E     W  ++ESWG+IWR+D+  +LT PF++R T E G +  A
Sbjct  187  VKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEA 246
Query  247  SQVIPANWAPMAVYRS 262
              VIP  W     Y S
Sbjct  247  EDVIPEGWKADTSYES 262

Sequence Alignment: 21. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 185.3 bits 941,  Expect = 2e-48
 Identities = 134/255 52%, Positives = 181/255 70%, Gaps = 8/255 3%
Query  9    AAVAALFSFLV--VTCVAGARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGA 64
            AAVA +++ +V    C  G +PG N +A   T    W  A+AT+YG+ P GA PDD GGA
Sbjct  3    AAVAVVLASMVGGAWCAMGDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
Query  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
            CG+K+ ++ PF  MT CGNEPIFKDG GCGSCY+I+C     CSG P  + ITD NY  +
Sbjct  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
Query  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYF 183
            + YHFDLSG AFGAMAK G+ D+LR AG + +QF+RV C +P   K+TFHVE+GS+P Y+
Sbjct  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYL 179
Query  184  AVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ 243
            A+LV+Y  GDG++V VD+    S  + PM+ SWG+IWR+D    L  PF++R+T+ESG +
Sbjct  180  ALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGH 239
Query  244  LVASQVIPANWAPMAVYRSFVQY 266
            +    VIP +W P  VY+S +Q+
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 22. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 185.0 bits 939,  Expect = 2e-48
 Identities = 133/241 55%, Positives = 173/241 71%, Gaps = 6/241 2%
Query  25   GARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGACGFKNTNQYPFSSMTSCG 82
            G +PG N +A   T    W  ARAT+YG+ P GA PDD GGACG+K+ ++ PF  MT+CG
Sbjct  3    GDKPGPNITA---TYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACG 59
Query  83   NEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKP 142
            NEPIFKDG GC +CY+I+C     CSG P  V ITD NY  ++ YHFDLSG AFGAMAK 
Sbjct  60   NEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKK 119
Query  143  GQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDL 201
            GQ D+LR AG + +QF+RV C +P G K+TFH+E+GSN  Y+A+LV+Y  GDG++V VD+
Sbjct  120  GQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDI 179
Query  202  MEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261
               +S  + PM+ SWG+IWR+D    L  PFS+R+T+E G +LV   VIPANW P  VY 
Sbjct  180  KPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYT 239
Query  262  SFVQYSS 268
            S +Q+ +
Sbjct  240  SKLQFGA 246

Sequence Alignment: 23. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 184.8 bits 938,  Expect = 3e-48
 Identities = 128/237 54%, Positives = 169/237 71%, Gaps = 5/237 2%
Query  23   VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSC 81
            +A   PG N +A   T    W  A++TWYG PTGAGP D+GGACG+K+ ++ PFS MT C
Sbjct  9    IAKVPPGPNITA---TYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGC 65
Query  82   GNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAK 141
            GN PIFKDG+GCGSC++I+C    +CSG P TV ITD N  P++ YHFDLSG AFG+MAK
Sbjct  66   GNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAK 125
Query  142  PGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVD 200
             G+  +LR AG ++++F+RV C +P G K TFHVE+GSNP Y+A+LV+Y DGDGDVV VD
Sbjct  126  KGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVD 185
Query  201  LMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVY 260
            + E     W  ++ESWG++WR+D+  +LT PF++R T E G +  A  VIP  W     Y
Sbjct  186  IKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
Query  261  RS 262
             +
Sbjct  246  EA 247

Sequence Alignment: 24. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 184.7 bits 938,  Expect = 3e-48
 Identities = 132/255 51%, Positives = 179/255 70%, Gaps = 8/255 3%
Query  9    AAVAALFSFLV--VTCVAGARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGA 64
            A VA +++ +V    C  G +PG N +A   T    W  A+AT+YG+ P GA PDD GGA
Sbjct  3    AVVAVVLASMVGGALCAMGDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGA 59
Query  65   CGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPV 124
            CG+K+ ++ PF  MT CGNEPIFKDG  CGSCY+I+C     CSG P  + ITD NY  +
Sbjct  60   CGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHI 119
Query  125  SKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYF 183
            + YHFDLSG AFGAMAK G+ D+LR AG + +QF+RV C +P   K+ FHVE+GSNP Y+
Sbjct  120  AAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYL 179
Query  184  AVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ 243
            A+LV+Y  GDG++V VD+    S  + PM++SWG+IWR+D    L  PF++R+T+ESG +
Sbjct  180  ALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
Query  244  LVASQVIPANWAPMAVYRSFVQY 266
            +    VIP +W P  VY+S +Q+
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 25. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 183.6 bits 932,  Expect = 6e-48
 Identities = 130/249 52%, Positives = 177/249 71%, Gaps = 5/249 2%
Query  4    SISKKAAVAALFSFLVVTC--VAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDD 61
            S S    VAAL++ +V +   +A   PG    +++  D  W  A++TWYG PTGAGP D+
Sbjct  9    SSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEY-GD-KWLDAKSTWYGKPTGAGPKDN 66
Query  62   GGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNY 121
            GGACG+K+ ++ PF+ MT CGN PIFKDG+GCGSC++++C    +CSG P TV ITD N 
Sbjct  67   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNE 126
Query  122  YPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNP 180
             P++ YHFDLSG AFG+MAK G+ + +R AG +++QF+RV C +P G K TFHVE+GSNP
Sbjct  127  EPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNP 186
Query  181  VYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNES 240
             Y+A+LV+Y DGDGDVV VD+ E     W  ++ESWG+IWR+D+  +LT PF++R T E 
Sbjct  187  NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEG 246
Query  241  GKQLVASQVIPANW 254
            G +     VIP  W
Sbjct  247  GTKAEFEDVIPEGW 260

Sequence Alignment: 26. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 182.7 bits 927,  Expect = 1e-47
 Identities = 125/242 51%, Positives = 171/242 70%, Gaps = 5/242 2%
Query  11   VAALFSFLVVTC--VAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFK 68
            V ALF+ ++ +   +A   PG    +++     W  A++TWYG PTGAGP D+GGACG+K
Sbjct  10   VVALFAVFLGSAHGIAKVPPGPNITAEY--GDKWLDAKSTWYGKPTGAGPKDNGGACGYK 67
Query  69   NTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYH 128
            + ++ PF+ MT CGN PIFKDG+GCGSC++I+C    +CSG   TV ITD N  P++ YH
Sbjct  68   DVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYH 127
Query  129  FDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLV 187
            FDLSG AFG+MAK G+  +LR AG +++QF+RV C +P G K TFHVE+ SNP Y+A+LV
Sbjct  128  FDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILV 187
Query  188  EYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVAS 247
            +Y DGDGDVV VD+ E     W  ++ESWG++WR+D+  +LT PF++R T E G +    
Sbjct  188  KYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVE 247
Query  248  QVIPANW 254
             VIP  W
Sbjct  248  DVIPEGW 254

Sequence Alignment: 27. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 182.3 bits 925,  Expect = 2e-47
 Identities = 131/249 52%, Positives = 170/249 68%, Gaps = 7/249 2%
Query  11   VAALFSFLVVTC--VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGF 67
            V ALF+ ++ +   +    PG N +A   T    W  A++TWYG PT AGP D+GGACG+
Sbjct  10   VVALFAVFLGSAHGIPKVPPGPNITA---TYGDKWLDAKSTWYGKPTAAGPKDNGGACGY 66
Query  68   KNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKY 127
            K+ ++ PFS MT CGN PIFK G+GCGSC++I+C    ACSG P  V ITD N  P++ Y
Sbjct  67   KDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAY 126
Query  128  HFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVL 186
            HFDLSG AFG+MAK G   +LR AG ++IQF+RV C +P G KVTFHVE+GSNP Y+A+L
Sbjct  127  HFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALL 186
Query  187  VEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVA 246
            V++  GDGDVV VD+ E     W  ++ESWG+IWR+D+   L  PF++R T E G +  A
Sbjct  187  VKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEA 246
Query  247  SQVIPANWAPMAVYRS 262
              VIP  W     Y S
Sbjct  247  KDVIPEGWKADTAYES 262

Sequence Alignment: 28. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 181.4 bits 920,  Expect = 3e-47
 Identities = 125/242 51%, Positives = 170/242 70%, Gaps = 5/242 2%
Query  11   VAALFSFLVVTC--VAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFK 68
            V ALF+ ++ +   +A   PG    +++     W  A++TWYG PTGAGP D+GGACG+K
Sbjct  10   VVALFAVFLGSAHGIAKVPPGPNITAEY--GDKWLDAKSTWYGKPTGAGPKDNGGACGYK 67
Query  69   NTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYH 128
            N ++ PF+ MT CGN PIFKDG+GCGSC++I+C    +CSG   TV ITD N  P++ YH
Sbjct  68   NVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYH 127
Query  129  FDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLV 187
            FDLSG AFG+MAK G+   +R AG +++QF+RV C +P   K TFHVE+ SNP Y+A+LV
Sbjct  128  FDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILV 187
Query  188  EYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVAS 247
            +Y DGDGDVV VD+ E     WT ++ESWG++WR+D+  +LT PF++R T E G +    
Sbjct  188  KYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFE 247
Query  248  QVIPANW 254
             VIP  W
Sbjct  248  DVIPEGW 254

Sequence Alignment: 29. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 180.5 bits 915,  Expect = 5e-47
 Identities = 123/240 51%, Positives = 169/240 70%, Gaps = 5/240 2%
Query  13   ALFSFLVVTC--VAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNT 70
            ALF+ ++ +   +A   PG    +++     W  A++TWYG PTGAGP D+GGACG+K+ 
Sbjct  1    ALFAVFLGSAHGIAKVPPGPNITAEY--GDKWLDAKSTWYGKPTGAGPKDNGGACGYKDV 58
Query  71   NQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFD 130
            ++ PF+ MT CGN PIFKDG+GCGSC++I+C    +CSG   TV ITD N  P++ YHFD
Sbjct  59   DKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFD 118
Query  131  LSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEY 189
            LSG AFG+MAK G+   +R AG +++QF+RV C +P   K TFHVE+GSNP Y+A+LV+Y
Sbjct  119  LSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKY 178
Query  190  EDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQV 249
             DGDGDVV VD+ E     W  ++ESWG++WR+D+  +LT PF++R T E G +     V
Sbjct  179  VDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDV 238
Query  250  IPANW 254
            IP  W
Sbjct  239  IPEGW 243

Sequence Alignment: 30. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 180.3 bits 914,  Expect = 6e-47
 Identities = 124/242 51%, Positives = 169/242 69%, Gaps = 5/242 2%
Query  11   VAALFSFLVVTC--VAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFK 68
            V ALF+ ++ +   +A   PG    +++     W  A++TWYG PTGAGP D+GGACG+K
Sbjct  10   VVALFAVFLGSAHGIAKVPPGPNITAEY--GDKWLDAKSTWYGKPTGAGPKDNGGACGYK 67
Query  69   NTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYH 128
            N ++ PF+ MT CGN PIFKDG+GCGSC++I+C    +CSG   TV ITD N  P++ YH
Sbjct  68   NVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYH 127
Query  129  FDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLV 187
            FDLSG AFG+MAK G+   +R AG +++QF+RV C +P   K TFHVE+ SNP Y+A+LV
Sbjct  128  FDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILV 187
Query  188  EYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVAS 247
            +Y DGDGDVV VD+ E     W  ++ESWG++WR+D+  +LT PF++R T E G +    
Sbjct  188  KYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFE 247
Query  248  QVIPANW 254
             VIP  W
Sbjct  248  DVIPEGW 254

Sequence Alignment: 31. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 179.9 bits 912,  Expect = 7e-47
 Identities = 126/239 52%, Positives = 170/239 71%, Gaps = 6/239 2%
Query  25   GARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGACGFKNTNQYPFSSMTSCG 82
            G +PG N +A   T    W  A+AT+YG+ P GA PDD GGACG+K+ ++ PF  MT CG
Sbjct  3    GDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCG 59
Query  83   NEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKP 142
            NEPIFKDG  CGSCY+I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK 
Sbjct  60   NEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKK 119
Query  143  GQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDL 201
            G+ D+LR AG + +QF+RV C +P   K+ FHVE+GS+P Y+A+LV+Y  GDG++V VD+
Sbjct  120  GEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI 179
Query  202  MEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261
                S  + PM++SWG+IWR+D    L  PF++R+T+ESG ++    VIP +W P  VY+
Sbjct  180  KPKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239
Query  262  SFVQY 266
            S +Q+
Sbjct  240  SKIQF 244

Sequence Alignment: 32. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 179.7 bits 911,  Expect = 8e-47
 Identities = 126/239 52%, Positives = 170/239 71%, Gaps = 6/239 2%
Query  25   GARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGACGFKNTNQYPFSSMTSCG 82
            G +PG N +A   T    W  A+AT+YG+ P GA PDD GGACG+K+ ++ PF  MT CG
Sbjct  3    GDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCG 59
Query  83   NEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKP 142
            NEPIFKDG  CGSCY+I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK 
Sbjct  60   NEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKK 119
Query  143  GQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDL 201
            G+ D+LR AG + +QF+RV C +P   K+ FHVE+GS+P Y+A+LV+Y  GDG++V VD+
Sbjct  120  GEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI 179
Query  202  MEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261
                S  + PM++SWG+IWR+D    L  PF++R+T+ESG ++    VIP +W P  VY+
Sbjct  180  KPKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239
Query  262  SFVQY 266
            S +Q+
Sbjct  240  SKIQF 244

Sequence Alignment: 33. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 173.3 bits 877,  Expect = 8e-45
 Identities = 129/256 50%, Positives = 177/256 69%, Gaps = 8/256 3%
Query  11   VAALFSFLVVTCVAGARPGNFSASDFT-ADPNWEVARATWYGAPTGAGPDDDGGACGFKN 69
            +A L  FLV+          ++AS ++ +  +W  A ATWYG   G G   +GGACG+ N
Sbjct  16   IAILSIFLVIPSFCFNPKKLYNASYYSPSSSDWSPAVATWYGPANGDG--SEGGACGYGN 73
Query  70   T-NQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITD--MNYYPVSK 126
               Q PFSS+ S G+  I+  GKGCGSCY+++C  + ACSGNP  V+ITD        ++
Sbjct  74   AVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQ 133
Query  127  YHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVL 186
            YHFDLSG AFGAMA  GQ++ LR+AG I+IQ +R+ CN+PG  + FHV+ GSN  YFA L
Sbjct  134  YHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATL 193
Query  187  VEYEDGDGDVVQVDLMEA-NSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITN-ESGKQL 244
            VEYEDGDGD+ +V+L EA +S SW  M++SWG++W++D    L APFS+++T  ESG+ +
Sbjct  194  VEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTI 253
Query  245  VASQVIPANWAPMAVYRSFVQYSS 268
            VA+ VIPA W P   YRS V +++
Sbjct  254  VANNVIPAGWTPGQTYRSIVNFAT 277

Sequence Alignment: 34. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 172.8 bits 873,  Expect = 8e-45
 Identities = 113/189 59%, Positives = 148/189 78%, Gaps = 1/189 0%
Query  78   MTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFG 137
            MT+CGN PIFKDGKGCGSCY++RC   P CSGNP TV ITDMNY P++ YHFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  138  AMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLVEYEDGDGDV 196
            ++AKPG ND+LRH GI+D++F+RV C +P G K+ FH+E+G NP Y AVLV++   DGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  197  VQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAP 256
            V +++ +  S  W PM+ SWG+IWR+D+   L  PFS+R+T+ESGK+++A  +IPANW P
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  257  MAVYRSFVQY 266
             AVY S VQ+
Sbjct  181  DAVYTSNVQF 190

Sequence Alignment: 35. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 172.8 bits 874,  Expect = 1e-44
 Identities = 123/222 55%, Positives = 159/222 71%, Gaps = 4/222 1%
Query  37   TADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSC 96
            T   +W   +ATWYG PTGAGPDD+GGACG+K+ N+ PF+SM +CGN PIFKDG  CGSC
Sbjct  13   TYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDGL-CGSC 71
Query  97   YQIRCVN-HPA-CSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGII 154
            ++I+C    PA CSG    V ITDMNY  ++ YHFDL+G AFGAMAK GQ ++L  AGII
Sbjct  72   FEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEKLAKAGII 131
Query  155  DIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRE 214
            D++F+RV C + G KVTFHVE+GSNP Y+A+LV+Y DGDGD+V VD+ E    ++ P++ 
Sbjct  132  DMKFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKH 190
Query  215  SWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVY 260
            SWG+IWR DS   +  P +++IT E G +     VIP  W     Y
Sbjct  191  SWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTY 236

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 162.3 bits 818,  Expect = 2e-41
 Identities = 121/224 54%, Positives = 157/224 70%, Gaps = 10/224 4%
Query  42   WEVARATWYGAPTGAGPDDDGGACGFKNT-NQYPFSSMTSCGNEPIFKDGKGCGSCYQIR 100
            W    ATWYG P G G   +GGACG+++   Q PFSSM + G   +FK+GKGCGSCYQI+
Sbjct  45   WSSGGATWYGGPQGDG--SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
Query  101  CVNHPACSGNPETVIITDMNYYPVS---KYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQ 157
            C  + ACSG P TV+ITD     V      HFD+SGTAFGAMA  G  D+LR AG++ IQ
Sbjct  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
Query  158  FKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEA-NSQSWTPMRESW 216
            +KRVPC F  + V F V+ GSNP Y+A+LV+Y +GDGD+  V +M+A     W  M++SW
Sbjct  163  YKRVPCRF-AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSW 221
Query  217  GSIWRLDSN--HRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQYSS 268
            G+ WRL+SN    L+ PFS+R+T+ SGK LVA+ VIP+ W     YRS V Y++
Sbjct  222  GATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 159.5 bits 803,  Expect = 1e-40
 Identities = 108/207 52%, Positives = 146/207 70%, Gaps = 4/207 1%
Query  42   WEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC 101
            W  AR      P    P D+GGACG+K+ ++ PF  M SCGN+PIFKDGKGCGSC++I+C
Sbjct  41   WLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC 100
Query  102  VNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRV 161
                ACS  P  + +TDMN  P++ YHFDLSG A   MAK G++++LR AGIID QF+RV
Sbjct  101  SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRV 157
Query  162  PCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIW 220
             C +P   K+TFH+E+ SNP Y+A+LV+Y  GDGDVV+V++ E  S+ W  ++ESWG+IW
Sbjct  158  KCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIW 217
Query  221  RLDSNHRLTAPFSLRITNESGKQLVASQVIP 251
            R+D+   L  PFS+R+T E  ++  A   IP
Sbjct  218  RIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 99.4 bits 481,  Expect = 1e-22
 Identities = 80/231 34%, Positives = 127/231 54%, Gaps = 10/231 4%
Query  31   FSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDG 90
            FS+S    D     ++A ++ + +        GAC + +     F+   +     I+KDG
Sbjct  15   FSSSAAACDRCLHSSKAAYFSSASALS----SGACAYGSMATGFFAGHIAAALPSIYKDG 70
Query  91   KGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKP--GQNDQL 148
             GCG+C+Q+RC N   CS    TVI+TD+N    ++  + LS  AF AMAKP  G +  L
Sbjct  71   SGCGACFQVRCKNPTLCSSKGTTVIVTDLN--KTNQTDLVLSSRAFRAMAKPVVGADRDL 128
Query  149  RHAGIIDIQFKRVPCNFPGLKVTFHVEEGS-NPVYFAVLVEYEDGDGDVVQVDLMEANSQ 207
               GI+DI+++RVPC++   K+   VEE S NP Y+A+ + Y+ G  +VV + + +  S 
Sbjct  129  LKQGIVDIEYRRVPCDYGNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSS 188
Query  208  SWTPMRESWGSIWRLDSNHRLTAPFSLRIT-NESGKQLVASQVIPANWAPMAVYRSFVQY 266
             W+ M  S G++W  D        F + +T    GK + + +V+PANW     Y + VQ 
Sbjct  189  HWSYMTRSHGAVWVTDKVPNGALQFRFVVTAGYDGKMVWSQRVLPANWEAGKSYDAGVQI 248
Query  267  S 267
            +
Sbjct  249  T 249

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 82.4 bits 390,  Expect = 2e-17
 Identities = 63/202 31%, Positives = 106/202 52%, Gaps = 9/202 4%
Query  61   DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMN 120
            + G+CG+ +          +  +  +F+ G GCG+C+Q+RC +   CS     V++TD  
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
Query  121  YYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSN 179
                ++  + LS  A+ AMA+PG   QLR    +D+++KRVPC +  G  ++  VEE S 
Sbjct  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
Query  180  PVY-FAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRIT- 237
            P   +++   Y+ G  D+V VD+    S +W  M   +G  W   + +    P+ +R+  
Sbjct  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVV 226
Query  238  --NESGKQLVAS-QVIPANWAPMAVYRSFVQ 265
                 GK + A  +V+P  W    VY + VQ
Sbjct  227  TGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 77.9 bits 366,  Expect = 4e-16
 Identities = 70/210 33%, Positives = 119/210 56%, Gaps = 29/210 13%
Query  41   NWEVARATWYGAPTGAGPDDDGGACGFKNTNQYP-FSSMTSCGNEPIFKDGKGCGSCYQI 99
            +W    AT+YG P+G G DD GGACG+ + +    +S+ T+  + P+F DG GCG CY++
Sbjct  51   DWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYEL 109
Query  100  RCVNHPACSGNPETVIITDMNYYPVSKY--------------HFDLSGTAFGAMAKPGQN 145
            RCV  P C+    +V+IT  N  P + Y              HFD++  +F  +A+    
Sbjct  110  RCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ---- 165
Query  146  DQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEAN 205
               R AGI+ +Q++RVPC   G  V F ++   N  ++ + V    G GDV  + +  + 
Sbjct  166  ---RVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTSG 219
Query  206  SQ-SWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQ--LVASQVIPANWAPMAVYR 261
               +W     +WG  +++ +    +  +++++T  S  Q  ++ S  I   W     Y+
Sbjct  220  GGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQ 278

Sequence Alignment: 41. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 52.3 bits 227,  Expect = 9e-09
 Identities = 45/117 38%, Positives = 64/117 54%, Gaps = 6/117 5%
Query  138  AMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVV 197
            +MA    +  L  A ++   F    C  P  KVTF VE+GSN  ++AVLV+YE GD  + 
Sbjct  2    SMASSSSSSLLAMA-VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMA 55
Query  198  QVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPM 257
            +V+L E  S  W  M +  G +W +DS   L  PF++R   E G + V   V+P  +   
Sbjct  56   EVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIG 115
Query  258  AVY 260
            A Y
Sbjct  116  ATY 118

Sequence Alignment: 42. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 52.3 bits 227,  Expect = 9e-09
 Identities = 45/117 38%, Positives = 64/117 54%, Gaps = 6/117 5%
Query  138  AMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVV 197
            +MA    +  L  A ++   F    C  P  KVTF VE+GSN  ++AVLV+YE GD  + 
Sbjct  2    SMASSSSSSLLAMA-VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMA 55
Query  198  QVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPM 257
            +V+L E  S  W  M +  G +W +DS   L  PF++R   E G + V   V+P  +   
Sbjct  56   EVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIG 115
Query  258  AVY 260
            A Y
Sbjct  116  ATY 118

Sequence Alignment: 43. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 52.2 bits 226,  Expect = 1e-08
 Identities = 45/117 38%, Positives = 64/117 54%, Gaps = 6/117 5%
Query  138  AMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVV 197
            +MA    +  L  A ++   F    C  P  KVTF VE+GSN  ++AVLV+YE GD  + 
Sbjct  2    SMASSSSSGLLAMA-VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMA 55
Query  198  QVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPM 257
            +V+L E  S  W  M +  G +W +DS   L  PF++R   E G + V   V+P  +   
Sbjct  56   EVELREHGSDEWVAMTKGEGGVWTFDSEEPLKGPFNFRFLTEKGMKNVFDDVVPEKYTIG 115
Query  258  AVY 260
            A Y
Sbjct  116  ATY 118

Sequence Alignment: 44. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 52.2 bits 226,  Expect = 1e-08
 Identities = 45/117 38%, Positives = 64/117 54%, Gaps = 6/117 5%
Query  138  AMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVV 197
            +MA    +  L  A ++   F    C  P  KVTF VE+GSN  ++AVLV+YE GD  + 
Sbjct  2    SMASSSSSGLLAMA-VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMA 55
Query  198  QVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPM 257
            +V+L E  S  W  M +  G +W +DS   L  PF++R   E G + V   V+P  +   
Sbjct  56   EVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIG 115
Query  258  AVY 260
            A Y
Sbjct  116  ATY 118

Sequence Alignment: 45. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 45.4 bits 189,  Expect = 9e-07
 Identities = 29/92 31%, Positives = 54/92 58%, Gaps = 1/92 1%
Query  168  LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHR 227
            +KVTF VE+GS+P  + + ++Y      + +V+L +  S+ W P+ +  G++W + S+  
Sbjct  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
Query  228  LTAPFSLRITNESGKQLVASQVIPANWAPMAVY 260
            LT PF++R  ++ G + V  +VIP  +     Y
Sbjct  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 46. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 43.8 bits 181,  Expect = 3e-06
 Identities = 26/93 27%, Positives = 55/93 59%, Gaps = 1/93 1%
Query  168  LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHR 227
            ++VTF V++GS+P  + + ++Y      + +V+L +  S+ W P+ +  G++W + S+  
Sbjct  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKP 71
Query  228  LTAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261
            L  PF++R  ++ G + V  +VIP  ++    Y+
Sbjct  72   LVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 43.5 bits 179,  Expect = 3e-06
 Identities = 28/91 30%, Positives = 54/91 59%, Gaps = 2/91 2%
Query  170  VTFHVEEGSNPVYFAVLVEY-EDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRL 228
            V F VE+GS+   +A+ ++Y ++GD  + +V+L E  S  W  ++++   +W + S+  L
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDS-MAEVELKEHGSNEWLALKKNGDGVWEIKSDKPL 62
Query  229  TAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261
              PF++R  +E G + V   V+PA++     Y+
Sbjct  63   KGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 48. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 41.7 bits 169,  Expect = 1e-05
 Identities = 26/82 31%, Positives = 50/82 60%, Gaps = 2/82 2%
Query  172  FHVEEGSNPVYFAVLVEY-EDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTA 230
            F VE+GS+   +A+ ++Y ++GD  + +V+L E  S  W  ++++   +W + S+  L  
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDA-MAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  231  PFSLRITNESGKQLVASQVIPANW 254
            PF++R  +E G   V   V+PA++
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADF 84

Sequence Alignment: 49. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 41.0 bits 166,  Expect = 2e-05
 Identities = 31/80 38%, Positives = 48/80 60%, Gaps = 7/80 8%
Query  168  LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHR 227
            + + FHVEE S+P  FA+ ++  D   ++ QVD+ E  + +  PM +S G  W +D    
Sbjct  20   VNIIFHVEE-SSP-KFALSIK--DSAKEITQVDVREHGADNMDPMTKS-GDSWTIDKP-- 72
Query  228  LTAPFSLRITNESGKQLVASQVIPANW 254
            L  P+++R+  E G   V   VIP NW
Sbjct  73   LKGPLNIRLRAEGGGSRVQDDVIPENW 99

Sequence Alignment: 50. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 39.4 bits 157,  Expect = 6e-05
 Identities = 26/91 28%, Positives = 49/91 53%, Gaps = 1/91 1%
Query  169  KVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRL 228
            KV + VE+GS+   + + ++Y      + +V+L +  S+ W PM +  G++W + S   L
Sbjct  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPL 60
Query  229  TAPFSLRITNESGKQLVASQVIPANWAPMAVY 260
            T P ++R  ++ G + V  +VIP  +     Y
Sbjct  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92

Sequence Alignment: 51. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 37.6 bits 148,  Expect = 0.0002
 Identities = 21/86 24%, Positives = 50/86 58%, Gaps = 1/86 1%
Query  168  LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHR 227
            +KV + V++GS+   +A+ ++Y   +  + +V+L +  S+ W P+ +  G +W +  +  
Sbjct  23   VKVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKP 81
Query  228  LTAPFSLRITNESGKQLVASQVIPANW 254
            L  PF++R  +++G + V  +V   ++
Sbjct  82   LVGPFNFRFLSKNGMKKVFDEVFSTDF 108

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.