The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA
LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK
Sequence Info Allergen Name Length Opt Bits Score E Value
ABY21307 Pla or 3.0101 118 785 147.0 1.3e-37
CAL07989 Pla a 3.0101 118 781 146.3 2.1e-37
A0A059STC4 Pun g 1.0101 120 488 95.1 5.6e-22
Q9M5X8 Pru av 3 117 480 93.7 1.4e-21
Q9M5X6 Pyr c 3 115 474 92.6 2.9e-21
A0AT29 Len c 3.0101 118 466 91.2 7.9e-21
Q9M5X7 Mal d 3 115 457 89.6 2.3e-20
XP_019446786 Lup an 3.0101 116 445 87.5 9.9e-20
A0A059SSZ0 Pun g 1.0201 120 443 87.2 1.3e-19
ANC85018 Art an 3.0102 117 440 86.7 1.8e-19
ANC85023 Art gm 3.0102 117 439 86.5 2.1e-19
Q4PLT6 Fra a 3.0202 117 437 86.1 2.6e-19
AAK28533 Cor a 8 115 436 86.0 2.9e-19
ANC85022 Art gm 3.0101 117 436 86.0 3e-19
ANC85017 Art an 3.0101 117 434 85.6 3.8e-19
ANC85021 Art ca 3.0101 117 434 85.6 3.8e-19
Q8VX12 Fra a 3.0101 117 434 85.6 3.8e-19
Q4PLU0 Fra a 3.0201 117 433 85.4 4.3e-19
A0A059ST23 Pun g 1.0301 120 431 85.1 5.6e-19
Q0Z8V0 Rub i 3.0101 117 429 84.7 6.9e-19
A0A161AT60 Pis s 3.0101 120 428 84.6 8e-19
P93224 Sola l 3.0101 114 426 84.2 9.8e-19
AAB42069 Lyc e 3 114 426 84.2 9.8e-19
QIN55516 Art ca 3.0102 117 424 83.9 1.3e-18
ANC85020 Art ar 3.0102 116 423 83.7 1.4e-18
ACE07187 Art v 3.0202 116 423 83.7 1.4e-18
ANC85027 Art si 3.0102 116 423 83.7 1.4e-18
ACN11576 Pru du 3.0101 123 423 83.7 1.5e-18
ANC85025 Art la 3.0102 115 421 83.3 1.8e-18
EU564847 Art v 3.0301 117 420 83.2 2.1e-18
Q4PLT9 Fra a 3.0102 117 419 83.0 2.3e-18
P85894 Mor n 3.0101 91 417 82.6 2.4e-18
CAB96876 Pru p 3 91 417 82.6 2.4e-18
P81402 Pru p 3 91 416 82.4 2.7e-18
P81651 Pru ar 3 91 416 82.4 2.7e-18
AAL25839 Hev b 12 116 416 82.5 3.3e-18
ADC80502 Pha v 3.0101 115 408 81.1 8.7e-18
ADC80503 Pha v 3.0201 118 407 80.9 1e-17
EU564845 Art v 3.0201 114 404 80.4 1.4e-17
ANC85019 Art ar 3.0101 116 404 80.4 1.4e-17
ANC85024 Art la 3.0101 116 404 80.4 1.4e-17
ACV04796 Api g 2 118 404 80.4 1.4e-17
P82534 Pru d 3 91 401 79.8 1.7e-17
W0U0V5 Can s 3.0101 91 401 79.8 1.7e-17
ABX56711 Ara h 9.0101 116 401 79.8 2e-17
ANC85026 Art si 3.0101 116 397 79.1 3.3e-17
P19656-1 Zea m 14.0101 120 390 77.9 8e-17
P19656-2 Zea m 14.0102 128 385 77.1 1.5e-16
AAA32970 Hor v 1 117 379 76.0 3e-16
CAA42832 Hor v 1 134 375 75.3 5.4e-16
A0A510A9S3 Ara h 17.0101 93 365 73.5 1.3e-15
ABX75045 Ara h 9.0201 92 358 72.3 3.1e-15
CAH69206 Tri tu 14.0101 115 352 71.3 7.7e-15
P82007 Hel a 3.0101 116 317 65.2 5.4e-13
19846220 Tri a 14.0101 90 315 64.8 5.5e-13
ABU95411 Sin a 3.0101 92 308 63.5 1.3e-12
NP_001316123 Sola l 7.0101 115 295 61.3 7.7e-12
O04403 Par j 2 133 235 50.9 1.2e-08
P55958 Par j 2 133 226 49.3 3.7e-08
Q40905 Par j 1 138 216 47.6 1.3e-07
O04004 Amb a 6 118 212 46.8 1.8e-07
O04404 Par j 1 176 206 45.9 5.3e-07
P43217 Par j 1 139 203 45.3 6.2e-07
CAI94601 Par j 1.0103 139 199 44.6 1e-06
CAA54587 Par j 1.0101 133 172 39.9 2.6e-05
P0C088 Art v 3.0101 37 154 36.5 7.6e-05
10998016 Cas s 8 36 126 31.6 0.0022
P80274 Vit v 1 37 114 29.5 0.0096
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 147.0 bits 785,  Expect = 1e-37
 Identities = 118/118 100%, Positives = 118/118 100%, Gaps = 0/118 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA
Sbjct  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK
Sbjct  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 2. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 146.3 bits 781,  Expect = 2e-37
 Identities = 117/118 99%, Positives = 118/118 100%, Gaps = 0/118 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLT+LRSGGAVAPACCNGVKA
Sbjct  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKA 60
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK
Sbjct  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 3. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 95.1 bits 488,  Expect = 6e-22
 Identities = 73/118 61%, Positives = 89/118 75%, Gaps = 2/118 1%
Query  1    MAFSRVAKLACLLLACMVATAPHA-EAAITCGTVVTRLTPCLTYLRS-GGAVAPACCNGV 58
            M  S + KLAC ++A  +  AP A EAA+TCG V + L PC+ Y RS GGAV PACC+G+
Sbjct  1    MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGI 60
Query  59   KALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            K L+  A+TTPDRQA C CLK+ASTSISGI  G  ASL  KCGVN+PYKISP+ DC++VK
Sbjct  61   KTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 4. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 93.7 bits 480,  Expect = 1e-21
 Identities = 67/117 57%, Positives = 86/117 73%, Gaps = 1/117 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S + KLA ++  CMV + P A+A +TCG V + L PC+ Y+R GGAV PACCNG++ 
Sbjct  1    MACSAMTKLALVVALCMVVSVPIAQA-LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRN 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +NN AKTT DRQ AC CLK  S S+ G+   NAA+L GKCGVN+PYKISP+ +C+ VK
Sbjct  60   INNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 5. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 92.6 bits 474,  Expect = 3e-21
 Identities = 69/115 60%, Positives = 83/115 72%, Gaps = 3/115 2%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S V KLA ++  CM  +  HA   ITC  V   L PC+ Y+RSGGAV PACCNG+K 
Sbjct  1    MASSAVIKLALVVALCMAVSVAHA---ITCSQVSANLAPCINYVRSGGAVPPACCNGIKT 57
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +N  AKTTPDRQAAC CLK  + S+SG+  GNA SL GKCGVN+PYKIS + +C+ VK
Sbjct  58   INGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 6. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 91.2 bits 466,  Expect = 8e-21
 Identities = 68/115 59%, Positives = 83/115 72%, Gaps = 1/115 0%
Query  4    SRVAKLACLLLA-CMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALN 62
            +R  KLAC++L  CMV  AP AE AI+CG V + L+PCLTYL  G   +P CC GVK L 
Sbjct  2    ARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLL 61
Query  63   NDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
              A TTPDRQAAC CLK+A+ SI+ +   NAA+L GKCGVN+PYKIS T +C+ VK
Sbjct  62   AAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 7. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 89.6 bits 457,  Expect = 2e-20
 Identities = 66/115 57%, Positives = 82/115 71%, Gaps = 3/115 2%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S V KLA ++  CM  +  HA   ITCG V + L PC+ Y+RSGGAV PACCNG++ 
Sbjct  1    MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRT 57
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +N  A+TT DRQ AC CLK  + SISG+   NAA L GKCGVN+PYKIS + +C+ VK
Sbjct  58   INGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 8. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 87.5 bits 445,  Expect = 1e-19
 Identities = 62/113 54%, Positives = 76/113 67%, Gaps = 0/113 0%
Query  6    VAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDA 65
            + KLAC +L CMV  +     AITCG V   L  CL YLRSGGAV   CCNG+K + N A
Sbjct  4    IVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLA 63
Query  66   KTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            KTTPDR+ AC CLK A+ +  G+   NA SL GKCGVN+PYKIS + +C+ +K
Sbjct  64   KTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 9. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 87.2 bits 443,  Expect = 1e-19
 Identities = 67/117 57%, Positives = 83/117 70%, Gaps = 4/117 3%
Query  1    MAFSR-VAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAP--ACCNG 57
            MA  R +  L   L+ CMV  A   E+A+TCG V + LTPC+ Y R G   AP  ACC+G
Sbjct  1    MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR-GVVAAPSAACCSG 59
Query  58   VKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
            V++LNN AKTTPDRQ AC CLK  + SI+GI  G   +L GKCGV++PYKISP+ DCS+V
Sbjct  60   VRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRV 119
Query  118  K 118
            K
Sbjct  120  K 120

Sequence Alignment: 10. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 86.7 bits 440,  Expect = 2e-19
 Identities = 61/114 53%, Positives = 81/114 71%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV T+ +AEAA+TC  V  +++PC ++L  GG V   CC GVK LN+ 
Sbjct  4    KMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLNDA 63
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQAAC CLKT+  S +  +  NAA L  KCGVN+PYKIS   DC+KVK
Sbjct  64   AKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 11. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 86.5 bits 439,  Expect = 2e-19
 Identities = 59/114 51%, Positives = 81/114 71%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV ++ +AEAA+TC  V  +++PCL++L+ GG V   CC GVK LN+ 
Sbjct  4    KMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLNDA 63
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT+  S   ++  NA  L  KCGVN+PYKIS   DC+KVK
Sbjct  64   AKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 12. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 86.1 bits 437,  Expect = 3e-19
 Identities = 63/117 53%, Positives = 83/117 70%, Gaps = 1/117 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S   KL+ + L C+V   P A+A ITCG V + ++PC+ Y++SGGAV  ACCNG+++
Sbjct  1    MAISTAMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRS 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            LN+ AKTT DRQ  C CLK AS +I G+    AA L GKCGVN+PYKIS + +C+ VK
Sbjct  60   LNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 13. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 86.0 bits 436,  Expect = 3e-19
 Identities = 57/111 51%, Positives = 80/111 72%, Gaps = 0/111 0%
Query  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
            KL C +L CM+  AP A A++TC  +   LTPC+ YL++GG + P+CC GV+A+N+ ++T
Sbjct  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
Query  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            T DRQ+AC CLK  +  I+G+    AA L GKCGVN+PYKISP+ +C+ VK
Sbjct  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 14. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 86.0 bits 436,  Expect = 3e-19
 Identities = 59/114 51%, Positives = 80/114 70%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV ++ +AEAA+TC  V  +++PC ++L+ GG V   CC GVK LN+ 
Sbjct  4    KMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLNDA 63
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT+  S    +  NAA L  KCGVN+PYKIS   DC+KVK
Sbjct  64   AKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 15. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 85.6 bits 434,  Expect = 4e-19
 Identities = 59/114 51%, Positives = 79/114 69%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV ++ +AEAA+TC  V  ++ PC ++L+ GG V+  CC GVK LN+ 
Sbjct  4    KMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDA 63
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQAAC CLKT   S    +  NA  L  KCGVN+PYKIS   DC+KVK
Sbjct  64   AKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 16. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 85.6 bits 434,  Expect = 4e-19
 Identities = 59/114 51%, Positives = 79/114 69%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV ++ +AEAA+TC  V  ++ PC ++L+ GG V+  CC GVK LN+ 
Sbjct  4    KMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDA 63
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQAAC CLKT   S    +  NA  L  KCGVN+PYKIS   DC+KVK
Sbjct  64   AKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 17. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 85.6 bits 434,  Expect = 4e-19
 Identities = 65/117 55%, Positives = 83/117 70%, Gaps = 1/117 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S   KL+ + L C+V   P A+A ITCG V + ++PCLTY++SGGAV  ACC+G++ 
Sbjct  1    MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCLTYVKSGGAVPAACCSGIRN 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            LN  AKTT DRQAAC CLK A+  I G+    AA L GKCGV++PYKIS T +C+ VK
Sbjct  60   LNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 18. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 85.4 bits 433,  Expect = 4e-19
 Identities = 63/117 53%, Positives = 84/117 71%, Gaps = 1/117 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S   KL+ + L C+V   P A+A ITCG V + ++PC+ Y++SGGAV  ACCNG+++
Sbjct  1    MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRS 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            LN+ AKTT DRQA C CLK AS +I G+    AA L GKCGV++PYKIS + +C+ VK
Sbjct  60   LNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 19. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 85.1 bits 431,  Expect = 6e-19
 Identities = 64/118 54%, Positives = 82/118 69%, Gaps = 2/118 1%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGA--VAPACCNGV 58
            MA S   +LA ++L CM   +  AEA ITCG V + L  C+ Y R  GA  V  ACCNG+
Sbjct  1    MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGI 60
Query  59   KALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            ++LN+ AKTTPDRQAAC CLK+ ++SISGI  G  A   GKCGV++PYKI+P+ +C  VK
Sbjct  61   RSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 20. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 84.7 bits 429,  Expect = 7e-19
 Identities = 64/117 54%, Positives = 81/117 69%, Gaps = 1/117 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S V KLA + L C+V   P A+A ITCG V   + PC+ Y+++GGAV  ACCNGV+ 
Sbjct  1    MACSAVMKLALVALLCIVVAVPVAQA-ITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRN 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            LN+ AKTT DRQ  C CLK A+ SI G+    AA L GKCGV++PYKIS + +C+ VK
Sbjct  60   LNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 21. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 84.6 bits 428,  Expect = 8e-19
 Identities = 63/115 54%, Positives = 83/115 72%, Gaps = 3/115 2%
Query  4    SRVAKLACL-LLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKA 60
            +R  KLAC+ L+ CMV  AP AEAA++CGTV   + PC+TYL++    +P   CC GVK 
Sbjct  2    ARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKK 61
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            L   A TTPDRQAAC CLK+A+ SI  +   NAA+L GKCGV++PYKIS + +C+ V+
Sbjct  62   LLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 22. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 84.2 bits 426,  Expect = 1e-18
 Identities = 61/109 55%, Positives = 76/109 69%, Gaps = 2/109 1%
Query  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
            K+AC+++ CMV  APHAE+ ++CG V + L PCL YL   G +   CC GVK L   AKT
Sbjct  6    KIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKT 63
Query  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
              DR+ AC CLK+A+ SI GI  G AA L G CGVN+PYKISP+ DCS V+
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 23. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 84.2 bits 426,  Expect = 1e-18
 Identities = 61/109 55%, Positives = 76/109 69%, Gaps = 2/109 1%
Query  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
            K+AC+++ CMV  APHAE+ ++CG V + L PCL YL   G +   CC GVK L   AKT
Sbjct  6    KIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKT 63
Query  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
              DR+ AC CLK+A+ SI GI  G AA L G CGVN+PYKISP+ DCS V+
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 24. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 83.9 bits 424,  Expect = 1e-18
 Identities = 58/114 50%, Positives = 77/114 67%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV  + +AEAA+TC  V  ++TPCL++L+ GG V   CC GVK LN+ 
Sbjct  4    KMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLNDA 63
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKT PDRQ AC CLKT   S   ++  NA  L  KCGVN+PYKIS   DC+ VK
Sbjct  64   AKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 25. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 83.7 bits 423,  Expect = 1e-18
 Identities = 61/113 53%, Positives = 79/113 69%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C ++ CMV ++ +AEA +TC  V  ++TPCL YL+ GG V   CC GVK LN+ 
Sbjct  4    KMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDA 62
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT+  S   ++   AASL  KCGVN+PYKIS   DC+KVK
Sbjct  63   AKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 26. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 83.7 bits 423,  Expect = 1e-18
 Identities = 61/113 53%, Positives = 79/113 69%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C ++ CMV ++ +AEA +TC  V  ++TPCL YL+ GG V   CC GVK LN+ 
Sbjct  4    KMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDA 62
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT+  S   ++   AASL  KCGVN+PYKIS   DC+KVK
Sbjct  63   AKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 27. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 83.7 bits 423,  Expect = 1e-18
 Identities = 61/113 53%, Positives = 79/113 69%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C ++ CMV ++ +AEA +TC  V  ++TPCL YL+ GG V   CC GVK LN+ 
Sbjct  4    KMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDA 62
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT+  S   ++   AASL  KCGVN+PYKIS   DC+KVK
Sbjct  63   AKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 28. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 83.7 bits 423,  Expect = 2e-18
 Identities = 62/118 52%, Positives = 82/118 69%, Gaps = 5/118 4%
Query  1    MAFS-RVAKLACLL--LACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNG 57
            MA S ++ KL CL+  + CM    P A AA++CG VV  LTPC+ Y+ +GGA+ P+CC G
Sbjct  1    MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTG 60
Query  58   VKALNNDAKTTPDRQAACGCLKTASTSI--SGIQLGNAASLAGKCGVNLPYKISPTIDCS 115
            V++L + A+TT DRQ+ C CLK A   I  +    G AA L GKCGVN+PYKISP+ DC 
Sbjct  61   VRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCK 120
Query  116  KVK 118
             +K
Sbjct  121  TIK 123

Sequence Alignment: 29. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 83.3 bits 421,  Expect = 2e-18
 Identities = 57/114 50%, Positives = 78/114 68%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV  + +AEAA+TC  V T+++PCL+YL+ GG V   CC GVK LN+ 
Sbjct  2    KMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDA 61
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
             KTTPDRQ AC CLK +  S   ++   A  L  KCG+NLPYK+S   DC+KVK
Sbjct  62   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 30. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 83.2 bits 420,  Expect = 2e-18
 Identities = 56/114 49%, Positives = 78/114 68%, Gaps = 0/114 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV +  +AE+A+TC  V T+++PCL+YL+ GG V   CC GVK LN+ 
Sbjct  4    KMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDA 63
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
             KTTPDRQ AC CLK +  S   ++   A  L  KCG+NLPYK+S   DC+KVK
Sbjct  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 31. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 83.0 bits 419,  Expect = 2e-18
 Identities = 62/117 52%, Positives = 81/117 69%, Gaps = 1/117 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA S   KL+ + L C+V   P A+A ITCG V + ++PC+TY++SGGAV   CC+G++ 
Sbjct  1    MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRN 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            LN  AKTT DRQA C CLK A+  I G+    AA L GKCGV++PYKIS T +C+ VK
Sbjct  60   LNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 32. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 82.6 bits 417,  Expect = 2e-18
 Identities = 58/91 63%, Positives = 68/91 74%, Gaps = 0/91 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            ITCG V + L PC+ YLR+GG V   CCNGV++LNN AKTT DRQAAC CLK+A  SI G
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            + L  AA L GKCGV++PYKISP+ DC  VK
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 33. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 82.6 bits 417,  Expect = 2e-18
 Identities = 55/91 60%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            ITCG V + L PC+ Y+R GGAV PACCNG++ +NN A+TTPDRQAAC CLK  S S+ G
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +   NAA+L GKCGV++PYKIS + +C+ VK
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 34. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 82.4 bits 416,  Expect = 3e-18
 Identities = 55/91 60%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            ITCG V + L PC+ Y+R GGAV PACCNG++ +NN A+TTPDRQAAC CLK  S S+ G
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +   NAA+L GKCGV++PYKIS + +C+ VK
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 35. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 82.4 bits 416,  Expect = 3e-18
 Identities = 56/91 61%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            ITCG V + L PC+ Y+R GGAV PACCNG++ +NN A+TTPDR+ AC CLK  S SISG
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +   NAA+L GKCGVN+PYKIS + +C+ VK
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 36. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 82.5 bits 416,  Expect = 3e-18
 Identities = 58/111 52%, Positives = 77/111 69%, Gaps = 1/111 0%
Query  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA-CCNGVKALNNDAK 66
            K+  +L+ CM+  AP    AITCG V + L PCL+YL++ G   PA CCNGV+ +NN AK
Sbjct  5    KMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAK 64
Query  67   TTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            TT DR+ AC CLK+A+ S+ G+     A L GKCGVN+PYKIS + +C+ VK
Sbjct  65   TTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 37. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 81.1 bits 408,  Expect = 9e-18
 Identities = 51/110 46%, Positives = 76/110 69%, Gaps = 0/110 0%
Query  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
            K+AC+++ CMV    H    +TCG V + L PC+T+L++GG V   CCNGV+ + N A++
Sbjct  5    KFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARS 64
Query  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
            T DR+  C CLKTA+ ++ G+   NA +L GKCGVN+PYKIS + +C+ +
Sbjct  65   TADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 38. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 80.9 bits 407,  Expect = 1e-17
 Identities = 57/109 52%, Positives = 78/109 71%, Gaps = 2/109 1%
Query  10   ACLL-LACMVA-TAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
            AC++ + C+V  TAP A AAI+CG V + L  C+ +L  GG V  +CC+GV++LN  AKT
Sbjct  7    ACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKT 66
Query  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            TPDRQA C CLK+A+ +I G    NA  L GKCGV++PYKIS + +C+ +K
Sbjct  67   TPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 39. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 80.4 bits 404,  Expect = 1e-17
 Identities = 58/113 51%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C ++ CMV ++ +AEA + C  V  +++ CL+YL+ GG V   CC GVK LN+ 
Sbjct  2    KMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDA 60
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT   S    +   AASL  KCGVN+PYKIS   DC+KVK
Sbjct  61   AKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 40. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 80.4 bits 404,  Expect = 1e-17
 Identities = 58/113 51%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C ++ CMV ++ +AEA + C  V  +++ CL+YL+ GG V   CC GVK LN+ 
Sbjct  4    KMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDA 62
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT   S    +   AASL  KCGVN+PYKIS   DC+KVK
Sbjct  63   AKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 41. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 80.4 bits 404,  Expect = 1e-17
 Identities = 58/113 51%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C ++ CMV ++ +AEA + C  V  +++ CL+YL+ GG V   CC GVK LN+ 
Sbjct  4    KMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDA 62
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLKT   S    +   AASL  KCGVN+PYKIS   DC+KVK
Sbjct  63   AKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 42. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 80.4 bits 404,  Expect = 1e-17
 Identities = 57/117 48%, Positives = 75/117 64%, Gaps = 0/117 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            M  S+VA    ++L  +V   P     +TCG V  +L  CL YL+ GG  +PACC GVK 
Sbjct  1    MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKG 60
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
            LN+ AKT  DR+ AC CLKT + S+ GI  G A++L GKCG+ +PY ISP+ DCS+V
Sbjct  61   LNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 43. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 79.8 bits 401,  Expect = 2e-17
 Identities = 54/91 59%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            ITCG V + L PC+ Y++ GGAV PACCNG++ +NN A+TT DR+AAC CLK  S SI G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +   NAA+L GKCGVN+PYKIS + +C+ VK
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 44. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 79.8 bits 401,  Expect = 2e-17
 Identities = 54/91 59%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            ITCG V + L PCL+YL+ GGAV   CCN +K+L+  AKT  DRQAAC CLK+A++SI G
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            + +  A+ L GKCGV++PYKISP+ DCS VK
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 45. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 79.8 bits 401,  Expect = 2e-17
 Identities = 54/111 48%, Positives = 75/111 67%, Gaps = 0/111 0%
Query  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
            K+A ++L CM         AI+CG V + L PC+ +L  GGA  PACC+GV+ L    +T
Sbjct  5    KFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRT 64
Query  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            T DRQAAC CLK A+ S+ G+  GNAA+L G+CGV++PYKIS + +C+ +K
Sbjct  65   TADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 46. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 79.1 bits 397,  Expect = 3e-17
 Identities = 54/113 47%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
            ++ K+ C+++ CMV ++ +AEA +TC  V  +++PCL YL+ GG V   CC GVK LN+ 
Sbjct  4    KMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDA 62
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            AKTTPDRQ AC CLK +  +   ++   A  L  KCGV +PYK+S   DC+KVK
Sbjct  63   AKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 47. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 77.9 bits 390,  Expect = 8e-17
 Identities = 55/113 48%, Positives = 82/113 72%, Gaps = 1/113 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA-CCNGVKALNN 63
            ++A +A  ++A ++  A  +EAAI+CG V + + PC++Y R  G+   A CC+GV++LNN
Sbjct  6    QLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
Query  64   DAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
             A+TT DR+AAC CLK A+  +SG+  GNAAS+  KCGV++PY IS + DCS+V
Sbjct  66   AARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 48. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 77.1 bits 385,  Expect = 2e-16
 Identities = 54/112 48%, Positives = 81/112 72%, Gaps = 1/112 0%
Query  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA-CCNGVKALNN 63
            ++A +A  ++A ++  A  +EAAI+CG V + + PC++Y R  G+   A CC+GV++LNN
Sbjct  6    QLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
Query  64   DAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSK 116
             A+TT DR+AAC CLK A+  +SG+  GNAAS+  KCGV++PY IS + DCS+
Sbjct  66   AARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118

Sequence Alignment: 49. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 76.0 bits 379,  Expect = 3e-16
 Identities = 53/116 45%, Positives = 76/116 65%, Gaps = 1/116 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA ++V  +A  L+  M+  AP A  A+ CG V +++ PCLTY++ G   +  CCNGV+ 
Sbjct  1    MARAQVLLMAAALVL-MLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRD 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
            L+N A+++ DRQ  C CLK  +  I  + L NAAS+  KC VN+PY ISP IDCS++
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 50. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 75.3 bits 375,  Expect = 5e-16
 Identities = 53/115 46%, Positives = 75/115 65%, Gaps = 1/115 0%
Query  1    MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKA 60
            MA ++V  +A  L+  M+  AP A  A+ CG V +++ PCLTY++ G   +  CCNGV+ 
Sbjct  1    MARAQVLLMAAALVL-MLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRD 59
Query  61   LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSK 116
            L+N A+++ DRQ  C CLK  +  I  + L NAAS+  KC VN+PY ISP IDCS+
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSR 115

Sequence Alignment: 51. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 73.5 bits 365,  Expect = 1e-15
 Identities = 51/92 55%, Positives = 67/92 72%, Gaps = 1/92 1%
Query  27   AITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSI- 85
            AI C  V   + PC+ YL+SGG V+  CC+G++ +N  AKTT DRQA C CLK+A+ S+ 
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  86   SGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            S I   NAASL GKCGV++PYKIS +I+CS +K
Sbjct  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 52. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 72.3 bits 358,  Expect = 3e-15
 Identities = 47/91 51%, Positives = 66/91 72%, Gaps = 0/91 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            ++CG V + L PC+T+L  GG  +  CC+GV+ L   AKTT DRQAAC CLK A+ S+ G
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            +  GNAA+L G+CGV++PYKIS + +C+ +K
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 53. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 71.3 bits 352,  Expect = 8e-15
 Identities = 52/113 46%, Positives = 84/113 74%, Gaps = 7/113 6%
Query  1    MAFSRVAKLACL-LLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV-APACCNGV 58
            MA S VA++  + ++A M+      EAA++CG V + L+PC++Y R  GA  + ACC+GV
Sbjct  1    MARSAVAQVVLVAVVAAMLLAV--TEAAVSCGQVSSALSPCISYARGNGASPSAACCSGV 58
Query  59   KALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
            ++L + A++T D+QAAC C+K+A+   +G+  G AA +  KCGV++PY IS ++DCSK++
Sbjct  59   RSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 54. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 65.2 bits 317,  Expect = 5e-13
 Identities = 48/108 44%, Positives = 67/108 62%, Gaps = 4/108 3%
Query  6    VAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDA 65
            VA LA +++A ++    H   AITC  V   LTPCL YLRSGG   PACC G K L    
Sbjct  8    VAILAMIVMAQLMV---HPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGAT 64
Query  66   KTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
            +T  DR+ AC C KTA+  +  ++   A+SL GKCG++    I+P ++C+ +
Sbjct  65   RTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 55. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 64.8 bits 315,  Expect = 6e-13
 Identities = 44/90 48%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
            I CG V + + PCL+Y++ G   +  CC+GVK L+N A++  DRQ+AC CLK  +  I  
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
Query  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
            +   NA S+  KCGVNLPY IS  IDCS+V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 56. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 63.5 bits 308,  Expect = 1e-12
 Identities = 43/92 46%, Positives = 57/92 61%, Gaps = 0/92 0%
Query  27   AITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSIS 86
            A++CGTV + L  C+ YL     +   CC GV  LNN A+TTPDRQ AC CL  A+ S  
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  87   GIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118
             +    AA+L   CGVN+PYKIS + +C+ V+
Sbjct  61   SLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 57. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 61.3 bits 295,  Expect = 8e-12
 Identities = 43/111 38%, Positives = 65/111 58%, Gaps = 1/111 0%
Query  6    VAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDA 65
            +A L  ++LA +   A  A  AITCG V   L PC+ +L  GG    ACC+GV+ LN + 
Sbjct  4    IAILVLVVLA-VFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNT 62
Query  66   KTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117
            +++ DR+ AC C+K A+     ++   A SL  KCG++L   IS T++C  +
Sbjct  63   QSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 58. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 50.9 bits 235,  Expect = 1e-08
 Identities = 40/98 40%, Positives = 60/98 61%, Gaps = 7/98 7%
Query  18   VATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAAC 75
            +A+AP A     CG VV  + PCL +++ G    P+  CC+G K L+ + KTT  ++ AC
Sbjct  24   LASAP-APGEGPCGKVVHHIMPCLKFVK-GEEKEPSKSCCSGTKKLSEEVKTTEQKREAC 81
Query  76   GCLKTASTSISGIQLGNAASLAGKCGVN--LPYKISPTIDCSKVK 118
             C+  A+  ISGI+    A +  KCG+   LP  I+   DCSK++
Sbjct  82   KCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 49.3 bits 226,  Expect = 4e-08
 Identities = 40/95 42%, Positives = 58/95 61%, Gaps = 9/95 9%
Query  19   ATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACG 76
            A AP  EA   CG VV  + PCL +++ G    P+  CC+G K L+ + KTT  ++ AC 
Sbjct  27   APAPGEEA---CGKVVQDIMPCLHFVK-GEEKEPSKECCSGTKKLSEEVKTTEQKREACK 82
Query  77   CLKTASTSISGIQLGNAASLAGKCGVN--LPYKISPTIDCSKVK 118
            C+  A+  ISGI+    A +  KC +   LP  I+   DCSK++
Sbjct  83   CIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 47.6 bits 216,  Expect = 1e-07
 Identities = 42/94 44%, Positives = 55/94 58%, Gaps = 9/94 9%
Query  18   VATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAAC 75
            VA AP   +  TCGTVV  L PCL +++ G    P+  CC+G K L+ + KT P R  AC
Sbjct  28   VAPAPAPGSEETCGTVVGALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHAC 86
Query  76   GCLKTASTSISGIQLGNAASLAGK-CGV---NLPYKISPTIDC 114
             C++TA  + S I  G   S   K CG+    LP  I   +DC
Sbjct  87   ECIQTAMKTYSDID-GKLVSEVPKHCGIVDSKLP-PIDVNMDC 127

Sequence Alignment: 61. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 46.8 bits 212,  Expect = 2e-07
 Identities = 38/89 42%, Positives = 51/89 57%, Gaps = 5/89 5%
Query  26   AAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSI 85
            A+ TC TV   L PC  +L +G   + ACC GV  LNN  KT  DR A C C+K  + SI
Sbjct  26   ASPTCDTVQNILAPCAGFL-TGQEPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI 84
Query  86   SGIQLGNAASLAGKCGV--NLPYKISPTIDCSKV 117
            +         L+ KCGV  ++P  +   +DCSK+
Sbjct  85   A-YDPKRMPLLSTKCGVKPDFP-AVDKNLDCSKL 116

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 45.9 bits 206,  Expect = 5e-07
 Identities = 44/105 41%, Positives = 58/105 55%, Gaps = 9/105 8%
Query  7    AKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNND 64
            A LA   LA +   AP   +  TCGTVV  L PCL +++ G    P+  CC+G K L+ +
Sbjct  18   AGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGE 76
Query  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGK-CGV---NLPYKISPTIDC 114
             KT   R  AC C++TA  + S I  G   S   K CG+    LP  I   +DC
Sbjct  77   TKTGLQRVHACECIQTAMKTYSDID-GKLVSEVPKHCGIVDSKLP-PIDVNMDC 128

Sequence Alignment: 63. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 45.3 bits 203,  Expect = 6e-07
 Identities = 38/86 44%, Positives = 51/86 59%, Gaps = 9/86 10%
Query  29   TCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSIS 86
            TCGT+V  L PCL +++ G    P+  CC+G K L+ + KT P R  AC C++TA  + S
Sbjct  3    TCGTMVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
Query  87   GIQLGNAASLAGK-CGV---NLPYKISPTIDCSKV 117
             I  G   S   K CG+    LP  I   +DC  V
Sbjct  62   DID-GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 64. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 44.6 bits 199,  Expect = 1e-06
 Identities = 37/83 44%, Positives = 50/83 60%, Gaps = 9/83 10%
Query  29   TCGTVVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSIS 86
            TCGT+V  L PCL +++ G    P+  CC+G K L+ + KT P R  AC C++TA  + S
Sbjct  3    TCGTMVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYS 61
Query  87   GIQLGNAASLAGK-CGV---NLPYKISPTIDC 114
             I  G   S   K CG+    LP  I   +DC
Sbjct  62   DID-GKLVSEVPKHCGIVDSKLP-PIDVNMDC 91

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 39.9 bits 172,  Expect = 3e-05
 Identities = 34/82 41%, Positives = 47/82 57%, Gaps = 9/82 10%
Query  33   VVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQL 90
            +V  L PCL +++ G    P+  CC+G K L+ + KT P R  AC C++TA  + S I  
Sbjct  1    MVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID- 58
Query  91   GNAASLAGK-CGV---NLPYKISPTIDCSKV 117
            G   S   K CG+    LP  I   +DC  V
Sbjct  59   GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 66. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 36.5 bits 154,  Expect = 8e-05
 Identities = 19/37 51%, Positives = 26/37 70%, Gaps = 0/37 0%
Query  27   AITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNN 63
            A+TC  V  +++PCL+YL+ GG V   CC GVK LN+
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND 37

Sequence Alignment: 67. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 31.6 bits 126,  Expect = 0.002
 Identities = 19/33 57%, Positives = 21/33 63%, Gaps = 2/33 6%
Query  27   AITCGTVVTRLTPCLTYLRSGGAVAP--ACCNGVK 59
            +ITC  V   L PCLTYL+S G   P   CC GVK
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

Sequence Alignment: 68. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 29.5 bits 114,  Expect = 0.01
 Identities = 15/28 53%, Positives = 21/28 75%, Gaps = 1/28 3%
Query  28   ITCGTVVTRLTPCLTYLRSGGAV-APACC 55
            +TCG V + L+PC+ YL+  GAV A +CC
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCC 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.