The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREE
EREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPH
YIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASL
LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYA
NEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV
TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINY
ERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEK
EVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS
Sequence Info Allergen Name Length Opt Bits Score E Value
V9VGU0 Pin k 2.0101 463 3094 711.6 2.2e-206
AAK15089 Ses i 3 585 1042 243.8 1.8e-65
A0A2I4E5L6 Jug r 6.0101 502 1040 243.3 2.1e-65
Q9SPL4 Mac i 1.0201 666 1039 243.1 3.4e-65
AAF18269 Jug r 2 593 1022 239.2 4.4e-64
Q9SPL3 Mac i 1.0101 625 1020 238.7 6.4e-64
AAM54366 Jug n 2 481 1001 234.5 9.6e-63
EF116865 Pis v 3.0101 519 978 229.2 4e-61
B3STU4 Car i 2.0101 792 972 227.8 1.6e-60
AAB23463 Gly m conglycinin 439 737 174.3 1.1e-44
AAL86739 Cor a 11 448 710 168.1 8.2e-43
AAM73730 Ana o 1.0101 538 672 159.4 4.1e-40
AAM73729 Ana o 1.0102 536 671 159.2 4.8e-40
P09799 Gos h 2 605 663 157.4 1.9e-39
P09801 Gos h 1 588 636 151.2 1.3e-37
Q198W3 Vig r 2.0101 453 510 122.5 4.4e-29
B1NPN8 Vig r 2.0201 454 509 122.3 5.2e-29
Q9FZP9 Gly m 5.0201 559 492 118.4 9.6e-28
O22120 Gly m 5.0101 543 485 116.8 2.8e-27
CAA35691 Gly m conglycinin 605 485 116.8 3.2e-27
CAD87731 Len c 1.0102 415 386 94.3 1.3e-20
CAF25232 Pis s 1.0101 415 386 94.3 1.3e-20
CAD87730 Len c 1.0101 418 380 92.9 3.3e-20
ACB05815 Lup an 1.0101 611 381 93.1 4.4e-20
CAF25233 Pis s 1.0102 415 374 91.6 8.5e-20
A0A0S3B0K0 Coc n 1.0101 490 372 91.1 1.4e-19
P43237 Ara h 1 614 365 89.4 5.5e-19
P43238 Ara h 1 626 362 88.7 9.1e-19
BAB21619 Gly m Bd28K 473 338 83.3 2.9e-17
AAA33947 Gly m conglycinin 218 325 80.7 8.5e-17
AAB01374 Gly m conglycinin 639 286 71.4 1.5e-13
DQ631677 Pis v 2.0201 472 165 43.9 2.2e-05
P09800 Gos h 4 516 138 37.7 0.0017
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 711.6 bits 3094,  Expect = 2e-206
 Identities = 463/463 100%, Positives = 463/463 100%, Gaps = 0/463 0%
Query  1    MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREE 60
            MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREE
Sbjct  1    MAFVSLLTILLAISSSSVALTEPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREE 60
Query  61   EREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPH 120
            EREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPH
Sbjct  61   EREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPH 120
Query  121  YIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASL 180
            YIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASL
Sbjct  121  YIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASL 180
Query  181  LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYA 240
            LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYA
Sbjct  181  LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYA 240
Query  241  NEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV 300
            NEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV
Sbjct  241  NEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDV 300
Query  301  TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINY 360
            TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINY
Sbjct  301  TVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINY 360
Query  361  ERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEK 420
            ERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEK
Sbjct  361  ERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEK 420
Query  421  EVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS 463
            EVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS
Sbjct  421  EVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRSSS 463

Sequence Alignment: 2. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 243.8 bits 1042,  Expect = 2e-65
 Identities = 174/406 42%, Positives = 265/406 65%, Gaps = 30/406 7%
Query  33   FPEQHGRGHHGVFPEEHGRGHHRGGRE--EEREEN-----PYVFHSDRFRIRASSEAGEI 85
            + EQ+GR        E GRG    GRE  EE+EE      PYVF    F     ++ G +
Sbjct  163  YREQQGR--------EGGRGEMYEGREREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRM 214
Query  86   RALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNEL 145
            R L  F + SELL GI  YRV  +E +P T ++P++ DA+ +++V  GRG I+ V+Q+  
Sbjct  215  RVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRR 274
Query  146  VKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETV 205
                +++GD++ + +G T YL+N D++  L +A LL+  ST  GE+E F+ AGG NPE+ 
Sbjct  275  ESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTP-GEFELFFGAGGENPESF 333
Query  206  YSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRR--GG---FSAESTS 260
            + +FSD++LEAAFNT   +L+ IFG +R+GVI  A+EEQ+R M R   GG   F  ES  
Sbjct  334  FKSFSDEILEAAFNTRRDRLQRIFGQQRQGVIVKASEEQVRAMSRHEEGGIWPFGGESKG 393
Query  261  ASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTK 320
                    N+  Q+P   N  G++          L  +D+TV +  +  G MTAP +N+K
Sbjct  394  T------INIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSK 447
Query  321  ATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHP 380
            AT IA+V++GEG  EMACPH+ +  G      RG    +Y+RV +RL  GTV ++PAGHP
Sbjct  448  ATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRP--SYQRVASRLTRGTVVIIPAGHP 505
Query  381  ITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQ 440
               +AS+N  L++L F++N + NE+  LAG+ NV+  LE+E + L+F +P   E+EEV +
Sbjct  506  FVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKELAFGMP-AREVEEVSR 564
Query  441  AQKDQVILRGPQRQRR 456
            +Q+++  ++GP++Q++
Sbjct  565  SQQEEFFFKGPRQQQQ 580

Sequence Alignment: 3. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 243.3 bits 1040,  Expect = 2e-65
 Identities = 166/412 40%, Positives = 247/412 59%, Gaps = 14/412 3%
Query  48   EHGRGHHRGGREEE-----REENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGIS 102
            E G     G  EEE      EENPYVF  + F  R  ++ G I+ L  F + S+LL GI 
Sbjct  77   EEGSSREEGYEEEELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIE 136
Query  103  RYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGH 162
             +RV  +E  P T + P + DA+ +++V  GR  I  V++ +     +E+GD+  +P+G 
Sbjct  137  NFRVAILEANPQTFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGT 196
Query  163  TFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDV 222
              YL+N D++  L I  +LR  S + G +E F+ +GG +PE+ Y AFS +VLEAA+ T  
Sbjct  197  PVYLINRDENEKLYIVKILRPVS-VPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRR 255
Query  223  QKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSAESTS-ASEQPKPFNLRNQKPDFENDN 281
             +LE +FG + +GVI  A++EQIR M +    +        +   PFNL +++P   N  
Sbjct  256  DQLEKLFGKQTQGVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQF 315
Query  282  GRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHL 341
            GR+    PK+   L  +D+ V F  +  G+M  P +N++AT I++V+EGEG  EMACPHL
Sbjct  316  GRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHL 375
Query  342  ------GQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILW 395
                  GQ  G  S R R     +Y+++R RLR G V+V PAGHP+  IAS N  L++L 
Sbjct  376  SSSGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLC 435
Query  396  FDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQR 455
            FD+N  GN R  LAGKNN++  +EKE + L+FN P   E+E++++ Q  +  + GP RQ 
Sbjct  436  FDVNAQGNIRFPLAGKNNIVNEFEKEAKELAFNFP-AREVEKIFRNQDQEFFFPGPSRQP 494
Query  456  RDEPRS 461
             +  R+
Sbjct  495  EEGGRA 500

Sequence Alignment: 4. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 243.1 bits 1039,  Expect = 3e-65
 Identities = 168/424 39%, Positives = 254/424 59%, Gaps = 9/424 2%
Query  36   QHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVS 95
            QHGRG   + P+  G G +  G EE++ +NPY F    +  R  +E G I  L NF   S
Sbjct  222  QHGRGGDLINPQRGGSGRYEEG-EEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRS 280
Query  96   ELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDV 155
            +LL  +  YR+  +E  PN  +LP ++DA  IL VTGGRG +  ++++      LE GDV
Sbjct  281  KLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDV 340
Query  156  FGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLE 215
              +P+G TFYL+N D++  L IA +L+T ST  G+Y+ F+ AGG+NPE   S FS ++LE
Sbjct  341  IRIPAGTTFYLINRDNNERLHIAKFLQTISTP-GQYKEFFPAGGQNPEPYLSTFSKEILE 399
Query  216  AAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSAE--STSASEQPK-PFNLRN 272
            AA+NT  ++L  ++G +R GVI  A++EQIRE+ R    S         E  + P+NL N
Sbjct  400  AALNTQAERLRGVLGQQREGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFN 459
Query  273  QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEG 332
            ++P + N  G+     P+D   L  +DV+V    +  G+M  P  NT++T + +V  GE 
Sbjct  460  KRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEA 519
Query  333  RIEMACPHLGQEHGW--SSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGR 390
             +EMACPHL   HG      R    +D++YE+V+ARL      VVP GHP+  ++S N  
Sbjct  520  DVEMACPHLSGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNEN 579
Query  391  LEILWFDINTSGNEREFLAGKN-NVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILR 449
            L ++ F IN   N   FLAG+  NVLQ +E +   L+F  PR +E+EE++ +Q + + + 
Sbjct  580  LLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPR-KEVEELFNSQDESIFFP 638
Query  450  GPQRQRRDEPRSS 462
            GP+++++   RS+
Sbjct  639  GPRQHQQQSSRST 651

Sequence Alignment: 5. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 239.2 bits 1022,  Expect = 4e-64
 Identities = 173/417 41%, Positives = 257/417 61%, Gaps = 24/417 5%
Query  33   FPEQHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFG 92
            + EQ+GR   G  PE   R   RG  EE++  NPY FHS   R R  SE GE++ L  F 
Sbjct  151  YKEQQGR-ERG--PEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFT 207
Query  93   EVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEE 152
            E +ELL GI  YRV  ++  PNT MLPH+ DA+ +  VT GR  +  V Q       LE 
Sbjct  208  ERTELLRGIENYRVVILDANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLEC 267
Query  153  GDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVY-SAFSD 211
            GDV  VP+G T Y++N D +  L +  LL+  +   G++  +Y AG ++P+  Y   FS+
Sbjct  268  GDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNP-GQFREYYAAGAKSPDQSYLRVFSN 326
Query  212  DVLEAAFNTDVQKLEHIFGAH--RRGVIFYANEEQIREMMRRGGFSAESTSASEQP---- 265
            D+L AA+NT   +LE  F  +  R GVI  A++E++R +      S  + SA ++P    
Sbjct  327  DILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRAL------SQHAMSAGQRPWGRR 380
Query  266  ---KPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKAT 322
                P +L+++ P + N  G+F  A P+++  L  +DV V +  +  G M  P +N+KAT
Sbjct  381  SSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKAT 440
Query  323  SIAIVMEGEGRIEMACPHLG-QEHGWSSPRERGHQDIN--YERVRARLRTGTVYVVPAGH 379
             +  V+EG GR EMACPH+  Q +     RE+  ++    +++V ARL  G ++V+PAGH
Sbjct  441  VVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH 500
Query  380  PITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVL 439
            PI   AS N  L +L FDIN   N+R+FLAG+NN++  LE+E + LSFN+PR EEIEE++
Sbjct  501  PIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNMPR-EEIEEIF 559
Query  440  QAQKDQVILRGPQRQRRDEPR 460
            ++Q +   +   ++ RR + R
Sbjct  560  ESQMESYFVPTERQSRRGQGR 580

Sequence Alignment: 6. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 238.7 bits 1020,  Expect = 6e-64
 Identities = 167/424 39%, Positives = 253/424 59%, Gaps = 9/424 2%
Query  36   QHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVS 95
            QHGRG   + P+  G G +  G EE++ +NPY F    +  R  +E G I  L NF   S
Sbjct  181  QHGRGGDLMNPQRGGSGRYEEG-EEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRS 239
Query  96   ELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDV 155
            +LL  +  YR+  +E  PN  +LP ++DA  IL V GGRG +  ++++      LE GDV
Sbjct  240  KLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDV 299
Query  156  FGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLE 215
              +P+G TFYL+N D++  L IA +L+T ST  G+Y+ F+ AGG+NPE   S FS ++LE
Sbjct  300  IRIPAGTTFYLINRDNNERLHIAKFLQTISTP-GQYKEFFPAGGQNPEPYLSTFSKEILE 358
Query  216  AAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSAE--STSASEQPK-PFNLRN 272
            AA+NT  ++L  ++G +R GVI  A++EQIRE+ R    S         E  + P+NL N
Sbjct  359  AALNTQTERLRGVLGQQREGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFN 418
Query  273  QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEG 332
            ++P + N  G+     P+D   L  +DV+V    +  G+M  P  NT++T + +V  GE 
Sbjct  419  KRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEA 478
Query  333  RIEMACPHLGQEHGW--SSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGR 390
             +EMACPHL   HG      R    ++++YE+VRARL      VV AGHP+  ++S N  
Sbjct  479  DVEMACPHLSGRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNEN 538
Query  391  LEILWFDINTSGNEREFLAGKN-NVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILR 449
            L ++ F IN   N   FLAG+  NVLQ +E +   L+F   R +E+EE++ +Q + + + 
Sbjct  539  LLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAASR-KEVEELFNSQDESIFFP 597
Query  450  GPQRQRRDEPRSS 462
            GP+++++  PRS+
Sbjct  598  GPRQHQQQSPRST 610

Sequence Alignment: 7. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 234.5 bits 1001,  Expect = 1e-62
 Identities = 168/417 40%, Positives = 254/417 60%, Gaps = 24/417 5%
Query  33   FPEQHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFG 92
            + EQ+GR   G  PE   R   +G  EE++  NPY FHS   R R  SE GE++ L  F 
Sbjct  39   YKEQQGR-ERG--PEASPRRESKGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFA 95
Query  93   EVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEE 152
            E +ELL GI  YRV  ++  PNT MLPH+ DA+ ++ VT GR  +  V Q       LE 
Sbjct  96   ERTELLRGIENYRVVILDANPNTFMLPHHKDAESVIVVTRGRATLTLVSQETRESFNLEC 155
Query  153  GDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVY-SAFSD 211
            GDV  VP+G T Y++N D +  L +  LL+  +   G+   +Y AG ++P+  Y   FS+
Sbjct  156  GDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNP-GQVREYYAAGAKSPDQSYLRVFSN 214
Query  212  DVLEAAFNTDVQKLEHIFGAH--RRGVIFYANEEQIREMMRRGGFSAESTSASEQP---- 265
            D+L AA+NT   +LE  F  +  R GVI  A++E++R +      S  + SA ++P    
Sbjct  215  DILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRAL------SQHAMSAGQRPWGRR 268
Query  266  ---KPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKAT 322
                P +L++++P + N  G+F  A P+++  L  +DV V +  +  G M  P +N+KAT
Sbjct  269  SSGGPISLKSERPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKAT 328
Query  323  SIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDIN---YERVRARLRTGTVYVVPAGH 379
             +  V+EG GR EMACPH+  +      R    ++ +   +++V ARL  G ++V+PAGH
Sbjct  329  VVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH 388
Query  380  PITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVL 439
            PI   AS N  L +L F IN   N+R FLAG+N+++  LE+E + LSFN+PR EEIEE++
Sbjct  389  PIAITASQNENLRLLGFGINGENNQRNFLAGQNSIINQLEREAKELSFNMPR-EEIEEIF 447
Query  440  QAQKDQVILRGPQRQRRDEPR 460
            ++Q +   +   ++ RR + R
Sbjct  448  ESQMESYFVPTERQSRRGQGR 468

Sequence Alignment: 8. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 229.2 bits 978,  Expect = 4e-61
 Identities = 154/395 38%, Positives = 249/395 63%, Gaps = 10/395 2%
Query  59   EEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVML 118
            +EE +ENPYVF  + F  R  +E G++  LP F + S+LL G+ +YR+  +   P   ++
Sbjct  121  QEEEDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVV 180
Query  119  PHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIA 178
            P+++DA  I++V+ GRG I  +++N+     +++GD+  + +G  FY+VN D++  L I 
Sbjct  181  PNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIV 240
Query  179  SLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIF 238
             LL+    + G YE F+  GG NPE+ Y AFS +VLEAA+ T   KLE +F  +  G I 
Sbjct  241  KLLQP-VNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEGAIV 299
Query  239  YANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSV 298
             A++EQIR M RRG   +      +    FNL  + P   N+ G++  +  KD P L  +
Sbjct  300  KASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPPLQEL 359
Query  299  DVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDI 358
            D+ V +  +  G M+ P +N++AT IAIV+ GEGR+E+ACPHL      SS +  G++  
Sbjct  360  DIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHL------SSSKNSGQEKS 413
Query  359  --NYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQ 416
              +Y+++ + +RT +V+VVPAGHP   +AS N  LEIL F++N  GN R  LAGK N+++
Sbjct  414  GPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKKNIIE 473
Query  417  TLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEPRS 461
             +EKE + L+F   +GEE+++V+  Q ++  ++GP+ ++  + R+
Sbjct  474  VMEKEAKELAFKT-KGEEVDKVFGKQDEEFFFQGPKWRQHQQGRA 517

Sequence Alignment: 9. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 227.8 bits 972,  Expect = 2e-60
 Identities = 171/419 40%, Positives = 260/419 62%, Gaps = 30/419 7%
Query  33   FPEQHGRGHHGVFPEEHG-RGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNF 91
            + EQ+GR   G  P++   R   RG  EE++  NPY FHS  +R R  S  GE++ L  F
Sbjct  347  YKEQQGR-EWG--PDQASPRRESRGREEEQQRHNPYYFHSQGLRSRHESGEGEVKYLERF 403
Query  92   GEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLE 151
             E +ELL GI  YRV  +E  PNT +LP++ DA+ ++ VT GR  + +V Q       LE
Sbjct  404  TERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRGRATLTFVSQERRESFNLE 463
Query  152  EGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSD 211
             GDV  VP+G T Y++N D +  L +  LL+  +   G++  +Y AG ++ E+    FS+
Sbjct  464  YGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNP-GQFREYYAAGAQSTESYLRVFSN 522
Query  212  DVLEAAFNTDVQKLEHIFGAH--RRGVIFYANEEQIREMMRRGGFSAESTSASEQP---- 265
            D+L AA+NT   +LE  F  +  R GVI  A++E++R +      S  + SA ++P    
Sbjct  523  DILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRAL------SQHAMSAGQRPWGRR 576
Query  266  ---KPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKAT 322
                P +L++Q+  + N  G+F  A P+++  L  +DV V +  +  G M  P +N+KAT
Sbjct  577  SSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKAT 636
Query  323  SIAIVMEGEGRIEMACPH--LGQEHGWSSPRERGHQDIN---YERVRARLRTGTVYVVPA 377
             +  V+EG GR EMACPH    Q + +   RE+  ++ +   +++V ARL  G ++V+PA
Sbjct  637  VVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPA 696
Query  378  GHPITEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEE 437
            GHPI   AS N  L ++ F IN   N+R FLAG+NN++  LE+E + LSFN+PR EEIEE
Sbjct  697  GHPIAITASQNENLRLVGFGINGKNNQRNFLAGQNNIINQLEREAKELSFNMPR-EEIEE 755
Query  438  VLQAQKDQVIL---RGPQR-QRRDEPRSS 462
            +++ Q +   +   R  +R Q RD P +S
Sbjct  756  IFERQVESYFVPMERQSRRGQGRDHPLAS 784

Sequence Alignment: 10. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 174.3 bits 737,  Expect = 1e-44
 Identities = 127/387 32%, Positives = 224/387 57%, Gaps = 18/387 4%
Query  61   EREENPYVFHS-DRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLP 119
            E E NP+ F S + F+    ++   IR L  F + S  LE +  YR+   + KPNT++LP
Sbjct  28   EDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLP 87
Query  120  HYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIAS 179
            H+ DA ++L+V  GR  +  V  ++     L  GD   +P+G T+YLVN  DH +L+I  
Sbjct  88   HHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIK 147
Query  180  LLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FGA-----HR 233
            L        G Y+ F+++  +  ++    FS ++LE +F+++ +++  + FG      ++
Sbjct  148  LA-IPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
Query  234  RGVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNP 293
             GVI   ++EQIR++ RR   S+  T +SE  +PFNLR++ P + N+ G+F    P+ NP
Sbjct  207  EGVIVELSKEQIRQLSRRAKSSSRKTISSED-EPFNLRSRNPIYSNNFGKFFEITPEKNP 265
Query  294  FLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRER 353
             L  +D+ +    +N G +  P  N+KA  I ++ EG+  IE+    +G +      ++ 
Sbjct  266  QLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIEL----VGIKEQQQKQKQE 321
Query  354  GHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KN 412
              + +  +R RA L    V+V+PA +P    A++N  L  L F IN   N+R FLAG K+
Sbjct  322  -EEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSN--LNFLAFGINAENNQRNFLAGEKD 378
Query  413  NVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRD 457
            NV++ +E++V+ L+F     +++E +L+ Q++   +    +Q+ +
Sbjct  379  NVVRQIERQVQELAFP-GSAQDVERLLKKQRESYFVDAQPQQKEE 422

Sequence Alignment: 11. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 168.1 bits 710,  Expect = 8e-43
 Identities = 159/418 38%, Positives = 246/418 58%, Gaps = 21/418 5%
Query  29   DQGVFPEQHGRGHHGVFPEE-HGRGHHRGGREEE-----REENPYVFHSDRFRIRASSEA 82
            D+  F EQ+ R    +  E+   R +  G   EE     +EENPYVF+ + F  R  +E 
Sbjct  18   DERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYVFQDEHFESRVKTEE 77
Query  83   GEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQ 142
            G ++ L NF + S LL GI  +R+  +E  P+T + P + DA+ +L+V  GR  I  V++
Sbjct  78   GRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGRATITMVRE 137
Query  143  NELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNP 202
             +     +E GD+  +P+G   Y++N D++  L I  +L+  S   G +E FY AGG +P
Sbjct  138  EKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAP-GHFEAFYGAGGEDP 196
Query  203  ETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQIREM-MRRGGFSAESTSA 261
            E+ Y AFS +VLEAA+    ++LE +FG + +G I  A+ E+IR +     G        
Sbjct  197  ESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREKIRALSQHEEGPPRIWPFG 256
Query  262  SEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKA 321
             E   P NL ++ P   N  GR+  A P D+  L  +D+ V F  +  G+M  P +N++A
Sbjct  257  GESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRA 316
Query  322  TSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPI 381
            T I++V+EGEG  EMACPHL    G            +Y+++ ARLR G V+V PAGHP+
Sbjct  317  TKISVVVEGEGFFEMACPHLSSSSG------------SYQKISARLRRGVVFVAPAGHPV 364
Query  382  TEIASTNGRLEILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQA 441
              IAS N  L++L F++N  GN R  LAGK N++  +E++ + L+FN+P   E+E +++ 
Sbjct  365  AVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLP-SREVERIFKN 423
Query  442  QKDQVILRGPQRQRRDEPR 460
            Q     + GP +Q+ +  R
Sbjct  424  QDQAFFFPGPNKQQEEGGR 442

Sequence Alignment: 12. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 159.4 bits 672,  Expect = 4e-40
 Identities = 154/410 37%, Positives = 245/410 59%, Gaps = 13/410 3%
Query  39   RGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELL 98
            RG+H  +  E          EEE +ENPYVF  + F  +  +E G++  LP F + S+LL
Sbjct  127  RGQHN-YKREDDEDEDEDEAEEE-DENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLL 184
Query  99   EGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGV 158
              + +YR+  +   P   ++P ++DA  I++V+ GRG I  + +N+     + +GD+  +
Sbjct  185  HALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSI 244
Query  159  PSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAF 218
             SG  FY+ NND++  L +  +LR  + + G +E F+  GG NPE+ Y AFS ++LEAA+
Sbjct  245  SSGTPFYIANNDENEKLYLVQFLRPVN-LPGHFEVFHGPGGENPESFYRAFSWEILEAAL 303
Query  219  NTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFE 278
             T    LE +F  + +G I  A++EQIR M RRG          E    F L  + P   
Sbjct  304  KTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQS 363
Query  279  NDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMAC 338
            N  G++  A   D P L+ +D+ V +  +  G M+ P +N++AT IAIV+ GEG +E+AC
Sbjct  364  NKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC 423
Query  339  PHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDI 398
            PHL      S P        +Y+++RAR+R  TV++VPAGHP   +AS N  LEI+ F++
Sbjct  424  PHLSSSKS-SHP--------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV 474
Query  399  NTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDE 458
            N  GN R  LAGK N+++ +EKE + L+F +  GEE+++V+  Q ++  ++GP+ ++  E
Sbjct  475  NAEGNIRYTLAGKKNIIKVMEKEAKELAFKM-EGEEVDKVFGKQDEEFFFQGPEWRKEKE 533
Query  459  PRS 461
             R+
Sbjct  534  GRA 536

Sequence Alignment: 13. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 159.2 bits 671,  Expect = 5e-40
 Identities = 153/410 37%, Positives = 245/410 59%, Gaps = 13/410 3%
Query  39   RGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELL 98
            RG+H  +  E          EEE +ENPYVF  + F  +  +E G++  LP F + S+LL
Sbjct  125  RGQHN-YKREDDEDEDEDEAEEE-DENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLL 182
Query  99   EGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGV 158
              + +YR+  +   P   ++P ++DA  I++V+ GRG I  + +N+     + +GD+  +
Sbjct  183  HALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSI 242
Query  159  PSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAF 218
             SG  FY+ NND++  L +  +LR  + + G +E F+  GG NPE+ Y AFS ++LEAA+
Sbjct  243  SSGTPFYIANNDENEKLYLVQFLRPVN-LPGHFEVFHGPGGENPESFYRAFSWEILEAAL 301
Query  219  NTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFE 278
             T    LE +F  + +G I  A++EQ+R M RRG          E    F L  + P   
Sbjct  302  KTSKDTLEKLFEKQDQGTIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQS 361
Query  279  NDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMAC 338
            N  G++  A   D P L+ +D+ V +  +  G M+ P +N++AT IAIV+ GEG +E+AC
Sbjct  362  NKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC 421
Query  339  PHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDI 398
            PHL      S P        +Y+++RAR+R  TV++VPAGHP   +AS N  LEI+ F++
Sbjct  422  PHLSSSKS-SHP--------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV 472
Query  399  NTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDE 458
            N  GN R  LAGK N+++ +EKE + L+F +  GEE+++V+  Q ++  ++GP+ ++  E
Sbjct  473  NAEGNIRYTLAGKKNIIKVMEKEAKELAFKM-EGEEVDKVFGKQDEEFFFQGPEWRKEKE 531
Query  459  PRS 461
             R+
Sbjct  532  GRA 534

Sequence Alignment: 14. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 157.4 bits 663,  Expect = 2e-39
 Identities = 155/400 38%, Positives = 237/400 59%, Gaps = 23/400 5%
Query  59   EEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVML 118
            E+++  NPY FH   F+ R   E G  R L  F +   LL GI+ +R+  +E  PNT +L
Sbjct  175  EQQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVL 234
Query  119  PHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIA 178
            PH+ DA+ I  VT GRG + +V +       +  G V  +P+G T YL N D+   L IA
Sbjct  235  PHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIA 294
Query  179  SLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFG---AHRR- 234
             L R  +   G+++ F+ AG  NP++    FS ++LEA FNT  ++L+ + G   +HRR 
Sbjct  295  VLHRPVNNP-GQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQ 353
Query  235  ---GVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKD 291
               G+   A++EQIR + +  G ++     SE    FNL +Q P + N NGRF  A P++
Sbjct  354  QGQGMFRKASQEQIRALSQ--GATSPRGKGSEG-YAFNLLSQTPRYSNQNGRFYEACPRN 410
Query  292  -NPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLG-QEHGWSS 349
                L  VD +V    +N G++  P +N+KAT + +V EG G +EM CPHL  Q   WSS
Sbjct  411  FQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSS 470
Query  350  --PRERGHQDIN-----YERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDI-NTS 401
                E+  Q++      Y+RVRA+L TG ++VVPAGHP+T +AS N  L +L F + N  
Sbjct  471  REEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQ 530
Query  402  GNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQ-KDQVILRGPQRQRRDEPR 460
             N+R F+AGK N ++  +++ + L+F +     ++EV+    ++   + G  R+  DE R
Sbjct  531  DNKRIFVAGKTNNVRQWDRQAKELAFGV-ESRLVDEVFNNNPQESYFVSGRDRRGFDERR 589
Query  461  SSS 463
             S+
Sbjct  590  GSN 592

Sequence Alignment: 15. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 151.2 bits 636,  Expect = 1e-37
 Identities = 145/392 36%, Positives = 227/392 57%, Gaps = 31/392 7%
Query  59   EEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVML 118
            E+E+  NP+ FH   F+ R   E G  R L  F     +L GI+ +R++ +E  PNT +L
Sbjct  174  EQEQSHNPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVL 233
Query  119  PHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIA 178
            PH+ DA+ I  VT GRG + ++ +       +  G V  VP+G T YL N D+   L IA
Sbjct  234  PHHCDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA 293
Query  179  SLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFG---AHRR- 234
             L R  +  R ++E F+ AG + P++   AFS ++LE AFNT  ++L+ +FG   +HRR 
Sbjct  294  VLHRPVNNPR-QFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQ 352
Query  235  ---GVIFYANEEQIREMMRRGGFSAESTSASEQPKP---FNLRNQKPDFENDNGRFTRAG 288
               G+   A++EQIR +      S E+TS  E+      FNL  + P + N NGRF  A 
Sbjct  353  QGQGMFRKASQEQIRAL------SQEATSPREKSGERFAFNLLYRTPRYSNQNGRFYEAC 406
Query  289  PKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLG------ 342
            P++   L  ++VTV    LN G++  P +N+KAT + +V EG G +EM  PHL       
Sbjct  407  PREFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFE 466
Query  343  --QEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWF---- 396
              +E+     +E   +   Y ++R++L  G ++VVPA  P+T +AS N  L +  F    
Sbjct  467  EEEEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYN 526
Query  397  -DINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQR 455
             +IN   N+R F+AGK N ++  + + + L+F +     ++E++     +  +   QRQR
Sbjct  527  QNINPDHNQRIFVAGKINHVRQWDSQAKELAFGVS-SRLVDEIFNNNPQESYFVSRQRQR 585
Query  456  RDE 458
              E
Sbjct  586  ASE 588

Sequence Alignment: 16. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 122.5 bits 510,  Expect = 4e-29
 Identities = 133/399 33%, Positives = 234/399 58%, Gaps = 32/399 8%
Query  43   GVFPEEHGRGHHRGGREEEREENPYVFHSDR-FRIRASSEAGEIRALPNFGEVSELLEGI 101
            G+   EH   +     +   + NP+ F+SDR F     ++ G +R +  F + S+ ++ +
Sbjct  23   GIVHREHQESQEES--DSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNL 80
Query  102  SRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSG 161
              YRV   + KPNT++LPH+ DA ++L V  GR  +  V  +      LE+G    +P+G
Sbjct  81   ENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAG 140
Query  162  HTFYLVNNDDHNSLRIASL-LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNT 220
             TF+LVN +D+++LRI  L +   +  R  ++ F+++     ++    FS ++LEA+F++
Sbjct  141  TTFFLVNPNDNDNLRIIKLAIPVNNPHR--FQNFFLSSTEAQQSYLRGFSKNILEASFDS 198
Query  221  DVQKLEHI-FGAHRR----------GVIFYANEEQIREMMRRGGFSAESTSASEQPKPFN 269
            D ++++ + FG  R+          GVI     EQIRE+++    S+    +S Q +PFN
Sbjct  199  DFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSS-QDEPFN 257
Query  270  LRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVME 329
            LRN  P + N  GR+    P+ NP L  +DV +    +  G +  P +N+KA  I ++ E
Sbjct  258  LRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINE 317
Query  330  GEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNG 389
            GE +IE+  P         S +++  + +  +R RA L    V+V+PA +P+   A++N 
Sbjct  318  GEAKIELVGP---------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSN- 367
Query  390  RLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKD-QVI 447
             L  + F IN   N+R FLAG K+NV+  +  EV  +SF    G ++E++++ Q + + +
Sbjct  368  -LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPAS-GNKVEKLIKKQSESHFV 425
Query  448  LRGPQRQRRDE 458
               P++Q+R+E
Sbjct  426  DAQPEQQQREE 436

Sequence Alignment: 17. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 122.3 bits 509,  Expect = 5e-29
 Identities = 132/387 34%, Positives = 231/387 59%, Gaps = 27/387 6%
Query  63   EENPYVFHSDR-FRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHY 121
            + NP+ F+SDR F     ++ G +R L  F + S+ ++ +  YRV  +  KPNT++LPH+
Sbjct  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
Query  122  IDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASL- 180
             DA ++L V  GR  +  V  +      LE+G    +P+G TF+LVN DD+ +LRI  L 
Sbjct  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
Query  181  LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHI-FG--------- 230
            +   +  R  ++ F+++     ++    FS ++LEA+F++D++++  + FG         
Sbjct  163  VPVNNPHR--FQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG 220
Query  231  --AHRRGVIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAG 288
              +++ GVI     EQIRE+ +    S++ + +SE  +PFNLRNQKP + N  GR+    
Sbjct  221  QESQQEGVIVELKREQIRELTKHAKSSSKKSLSSED-QPFNLRNQKPIYSNKLGRWFEIT 279
Query  289  PKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWS 348
            P+ NP L  +D+ +    +  G++  P +N+KA  I ++ EG+  IE+    +GQ     
Sbjct  280  PEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIEL----VGQRE-QQ 334
Query  349  SPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFL 408
              +E   +    +R RA L    V+++PA +P+   A++N  L  + F IN   N+R FL
Sbjct  335  KQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSN--LNFFAFGINAENNQRNFL 392
Query  409  AG-KNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKD-QVILRGPQRQRRDEPR 460
            AG K+NV+  +  EV  ++F    GE+++++++ Q + Q +   P++Q R+E R
Sbjct  393  AGEKDNVISEIPTEVLDVTFPAS-GEKVKKLIKKQSESQFVDAQPEQQEREEAR 445

Sequence Alignment: 18. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 118.4 bits 492,  Expect = 1e-27
 Identities = 123/399 30%, Positives = 230/399 57%, Gaps = 25/399 6%
Query  47   EEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRV 106
            E  G   +R  R   + +NP+ F+S RF+    ++ G +R L  F + S+ L+ +  YR+
Sbjct  131  ESEGSESQREPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRI 189
Query  107  TCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYL 166
                 KPNT++LPH+ DA +++ +  G   +  V  ++     L+ GD + VP+G T+Y+
Sbjct  190  LEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYV 249
Query  167  VNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLE 226
            VN D+  +LR+ +L        G +E F+++  +  ++    FS ++LEA+++T  +++ 
Sbjct  250  VNPDNDENLRMITLA-IPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEIN 308
Query  227  HI-FG---AHRRG-------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKP 275
             + FG    +++G       VI   +++QIRE+ +    S+  T +SE  KPFNLR++ P
Sbjct  309  KVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSED-KPFNLRSRDP 367
Query  276  DFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIE 335
             + N  G++    P+ NP L  +DV +    +N G +  P  N+KA  + ++ EGE  IE
Sbjct  368  IYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIE 427
Query  336  MACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILW 395
            +      Q+      +++  Q +   + RA L    ++V+PAG+P+   A+++  L  + 
Sbjct  428  LVGIKEQQQR-----QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFA 480
Query  396  FDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQR 453
            F IN   N+R FLAG K+NV+  +  +V+ L+F  P   ++IE ++++Q +   +    +
Sbjct  481  FGINAENNQRNFLAGSKDNVISQIPSQVQELAF--PGSAKDIENLIKSQSESYFVDAQPQ 538
Query  454  QRRD 457
            Q+ +
Sbjct  539  QKEE 542

Sequence Alignment: 19. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 116.8 bits 485,  Expect = 3e-27
 Identities = 116/386 30%, Positives = 221/386 57%, Gaps = 22/386 5%
Query  62   REENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHY 121
            + +NP++F S+RF     ++ G IR L  F + S  L+ +  YR+     KPNT++LP++
Sbjct  129  KNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH 188
Query  122  IDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLL 181
             DA +++ +  G   ++ V  ++    +L+ GD + VPSG T+Y+VN D++ +LR+ +L 
Sbjct  189  ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLA 248
Query  182  RTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRG------ 235
                   G +E F+++     ++    FS ++LEA+++T  +++  ++ +   G      
Sbjct  249  -IPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ 307
Query  236  -----VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPK 290
                 VI   ++EQIR + +R   S+  T +SE  KPFNLR++ P + N  G+F    P+
Sbjct  308  RLQESVIVEISKEQIRALSKRAKSSSRKTISSED-KPFNLRSRDPIYSNKLGKFFEITPE 366
Query  291  DNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP 350
             NP L  +D+ +    +N G +  P  N+KA  I ++ EG+  IE+      Q+      
Sbjct  367  KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE----- 421
Query  351  RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG 410
            +++  Q +   + RA L    ++V+PAG+P+   A++N  L  +   IN   N+R FLAG
Sbjct  422  QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAG 479
Query  411  -KNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRD 457
             ++NV+  +  +V+ L+F     + +E++L+ Q++   +    +++ +
Sbjct  480  SQDNVISQIPSQVQELAFP-GSAQAVEKLLKNQRESYFVDAQPKKKEE 526

Sequence Alignment: 20. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 116.8 bits 485,  Expect = 3e-27
 Identities = 116/386 30%, Positives = 221/386 57%, Gaps = 22/386 5%
Query  62   REENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHY 121
            + +NP++F S+RF     ++ G IR L  F + S  L+ +  YR+     KPNT++LP++
Sbjct  191  KNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH 250
Query  122  IDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLL 181
             DA +++ +  G   ++ V  ++    +L+ GD + VPSG T+Y+VN D++ +LR+ +L 
Sbjct  251  ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLA 310
Query  182  RTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRG------ 235
                   G +E F+++     ++    FS ++LEA+++T  +++  ++ +   G      
Sbjct  311  -IPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ 369
Query  236  -----VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPK 290
                 VI   ++EQIR + +R   S+  T +SE  KPFNLR++ P + N  G+F    P+
Sbjct  370  RLQESVIVEISKEQIRALSKRAKSSSRKTISSED-KPFNLRSRDPIYSNKLGKFFEITPE 428
Query  291  DNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP 350
             NP L  +D+ +    +N G +  P  N+KA  I ++ EG+  IE+      Q+      
Sbjct  429  KNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE----- 483
Query  351  RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG 410
            +++  Q +   + RA L    ++V+PAG+P+   A++N  L  +   IN   N+R FLAG
Sbjct  484  QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAG 541
Query  411  -KNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRD 457
             ++NV+  +  +V+ L+F     + +E++L+ Q++   +    +++ +
Sbjct  542  SQDNVISQIPSQVQELAFP-GSAQAVEKLLKNQRESYFVDAQPKKKEE 588

Sequence Alignment: 21. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 94.3 bits 386,  Expect = 1e-20
 Identities = 132/376 35%, Positives = 219/376 58%, Gaps = 27/376 7%
Query  63   EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI 122
            +ENP++F S+RF+    +E G IR L  F + S+++E +  YR+   + KP+T+ LP+Y 
Sbjct  5    QENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
Query  123  DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR 182
            DA +IL V  G+  +  +  N+     LE GD   +P+G   YL N DD+  LR+  L  
Sbjct  65   DADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA- 123
Query  183  TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG 235
                  G+ E F ++G +N  +  S F+  +LEAAFNTD +++E ++         HRR 
Sbjct  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
Query  236  ------------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGR 283
                        VI   + EQI+E+ +    S++ + +SE  +PFNLR++ P + N  G+
Sbjct  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSES-EPFNLRSRNPIYSNKFGK 242
Query  284  FTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ 343
            F    P+ NP L  +D+ V    +  G++  P++N++A  I  V EG+G  E+       
Sbjct  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNEN 302
Query  344  EHGWSSPRERGHQDIN--YERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTS 401
            +   +   E   ++ +   +R RA+L  G V+VVPAGHP+   AS++  L ++ F IN  
Sbjct  303  QREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSD--LNLIGFGINAK 360
Query  402  GNEREFLAGK-NNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQK 443
             N+R FLAG+ +NV+  +++ V+ L+F      E++ +L  QK
Sbjct  361  NNQRNFLAGEEDNVISQIQRPVKELAFP-GSSREVDRLLTNQK 402

Sequence Alignment: 22. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 94.3 bits 386,  Expect = 1e-20
 Identities = 135/386 34%, Positives = 227/386 58%, Gaps = 31/386 8%
Query  63   EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI 122
            +ENP++F S+RF+    +E G IR L  F + S+++E +  YR+   + KP+T+ LP+Y 
Sbjct  5    QENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYT 64
Query  123  DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR 182
            DA +IL V  G+  +  ++ N+     LE GD   +P+G   YL N DD+  LR+  L  
Sbjct  65   DADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA- 123
Query  183  TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG 235
                  G+ + F ++G +N  ++ S FS ++LEAAFNT+ +++E ++         HRR 
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  236  ------------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGR 283
                        VI   + EQI E+ +    S++ + +SE   PFNLR++ P + N  G+
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESG-PFNLRSRNPIYSNKFGK 242
Query  284  FTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ 343
            F    P+ N  L  +D+ V    +  G++  P++N++A  I  V EG+G  E+      +
Sbjct  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR-NE 301
Query  344  EHGWSSPRERGHQDINYERV---RARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT 400
             +G  + +E  +++   ++V   RA+L  G V+V+PAGHP+   AS++  L ++ F IN 
Sbjct  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSD--LNLIGFGINA 359
Query  401  SGNEREFLAGK-NNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQRQR 455
              NER FLAG+ +NV+  +E+ V+ L+F  P    E++ +L+ QK          QR
Sbjct  360  ENNERNFLAGEEDNVISQVERPVKELAF--PGSSHEVDRLLKNQKQSYFANAQPLQR 414

Sequence Alignment: 23. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 92.9 bits 380,  Expect = 3e-20
 Identities = 133/376 35%, Positives = 221/376 58%, Gaps = 30/376 7%
Query  63   EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI 122
            +ENP++F S+RF+    +E G IR L  F + S+++E +  YR+   + KP+T+ LP++ 
Sbjct  5    QENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFT 64
Query  123  DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR 182
            DA +IL V  G+  +  +  N+     LE GD   +P+G   YL N DD+  LR+  L  
Sbjct  65   DADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA- 123
Query  183  TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG 235
                  G+ + F ++G +N  +  S FS ++LEAAFNT+ +++E ++         HRR 
Sbjct  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
Query  236  ------------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGR 283
                        VI   + EQI E+ +    S++ + +SE  +PFNLR++ P + N  G+
Sbjct  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSES-EPFNLRSRNPIYSNKFGK 242
Query  284  FTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHL-- 341
            F    P+ NP L  +D+ V    +  G++  P++N++A  I  V EG+G  E+       
Sbjct  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNEN 302
Query  342  GQEHGWSSPRERGHQD---INYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDI 398
             QE+   +  E G+++      +R RARL  G V V+PAGHP+   AS++  L ++ F I
Sbjct  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSD--LNLIGFGI 360
Query  399  NTSGNEREFLAGK-NNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQK 443
            N   N+R FLAG+ +NV+  +++ V+ L+F      E++ +L  QK
Sbjct  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFP-GSSREVDRLLTNQK 405

Sequence Alignment: 24. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 93.1 bits 381,  Expect = 4e-20
 Identities = 147/394 37%, Positives = 242/394 61%, Gaps = 45/394 11%
Query  54   HRGGREEE--------REENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYR 105
            HR  RE+E        R+ NPY F S+RF+    +  G+IR L  F + +  LE +  YR
Sbjct  165  HREEREQEQDSRSDSRRQRNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYR 224
Query  106  VTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFY 165
            +   + KPNT++LP + DA +IL V  GR  I  V  ++     LE+GD + +P+G T Y
Sbjct  225  IIEFQSKPNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSY 284
Query  166  LVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKL 225
            ++N DD+ +LR+A L        G+   FY +  ++ ++ +S FS + LEA FNT  +++
Sbjct  285  ILNPDDNQNLRVAKLA-IPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEI 343
Query  226  EHIF-G--------AHRRG---------VIFYANEEQIREMMRRGGFSAESTSASEQPK- 266
            E ++ G         +RRG         VI   +++QI+E+ +     A+S+S   +P  
Sbjct  344  ERVLLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKH----AQSSSGEGKPSE 399
Query  267  --PFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSI 324
              PFNLR+ KP + N  G F    P  NP +  +++++ F  +N G +  P +N+KA  I
Sbjct  400  SGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFI 459
Query  325  AIVMEGEGRIEMAC--PHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPIT 382
             +V EGEG  E+     +  Q+       E+G +++   R   +L  G V+++PAGHP++
Sbjct  460  VVVDEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEV--RRYSDKLSKGDVFIIPAGHPLS 517
Query  383  EIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRG-EEIEEVLQ 440
              AS+N RL  L F IN + N+R FLAG ++NV++ L++EV+ L+F  P   E++E +++
Sbjct  518  INASSNLRL--LGFGINANENQRNFLAGSEDNVIKQLDREVKELTF--PGSIEDVERLIK 573
Query  441  AQKDQVILRG-PQRQRRDE 458
             Q+        PQ+Q++ E
Sbjct  574  NQQQSYFANAQPQQQQQRE 592

Sequence Alignment: 25. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 91.6 bits 374,  Expect = 9e-20
 Identities = 134/386 34%, Positives = 225/386 58%, Gaps = 31/386 8%
Query  63   EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI 122
            +ENP++F S+RF+    +E G IR L  F + S+++E +  YR+   + KP T+ LP+  
Sbjct  5    QENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQCT 64
Query  123  DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR 182
            DA +IL V  G+  +  ++ N+     LE GD   +P+G   YL N DD+  LR+  L  
Sbjct  65   DADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLT- 123
Query  183  TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG 235
                  G+ + F ++G +N  ++ S FS ++LEAAFNT+ +++E ++         HRR 
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  236  ------------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGR 283
                        VI   + EQI E+ +    S++ + +SE   PFNLR++ P + N  G+
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESG-PFNLRSRNPIYSNKFGK 242
Query  284  FTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQ 343
            F    P+ N  L  +D+ V    +  G++  P++N++A  I  V EG+G  E+      +
Sbjct  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR-NE 301
Query  344  EHGWSSPRERGHQDINYERV---RARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINT 400
             +G  + +E  +++   ++V   RA+L  G V+V+PAGHP+   AS++  L ++ F IN 
Sbjct  302  NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSD--LNLIGFGINA 359
Query  401  SGNEREFLAGK-NNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKDQVILRGPQRQR 455
              NER FLAG+ +NV+  +E+ V+ L+F  P    E++ +L+ QK          QR
Sbjct  360  ENNERNFLAGEEDNVISQVERPVKELAF--PGSSHEVDRLLKNQKQSYFANAQPLQR 414

Sequence Alignment: 26. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 91.1 bits 372,  Expect = 1e-19
 Identities = 135/379 35%, Positives = 214/379 56%, Gaps = 85/379 22%
Query  49   HGRGHHRGGREEEREENPYVFHSDR--FRIRASSEAGEIRALPNFGEVSELLEGISRYR- 105
            +GRG    GRE+  EE       DR  F +R S E  +  A    GEV  L+ G  RYR 
Sbjct  31   QGRGME--GREKRVEEKAPRSPEDRGLFILRRSKEVLKTDA----GEV-RLMMGY-RYRG 82
Query  106  ------VTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVP 159
                  +  I M+PNT+ +P+YIDA  IL+V  G   + Y+ +N+LV+++L+ G V  +P
Sbjct  83   NHSPMHIGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIP 142
Query  160  SGHTFYLVNNDDHNSLRIASLLRTESTMR--GEY-EPFYVAGGRNPETVYSAFSDDVLEA 216
            +G +FY+VN+D    L I   + T  +M   G Y + FYV GG  P +V S F    L A
Sbjct  143  AGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSA 202
Query  217  AFNTDVQKLEHIFGAHRRGVIFYANEE------------QIRE-MMRRGGFSAESTSASE 263
            AFN    +LE I+ ++R G I   N E            Q++E M++     ++    +E
Sbjct  203  AFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAE 262
Query  264  Q--------------------------------PKPFNLRNQKPDFENDNGRFTRAGPKD 291
            Q                                P  +NL + +P ++ND G        D
Sbjct  263  QEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHD 322
Query  292  NPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPR 351
               L   ++ V +  L  G M +P  N  AT   I++ G G I++  P+           
Sbjct  323  YSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPN----------- 371
Query  352  ERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGK 411
              G   +N     A++  G V+ +P   P  +IAS    LE + F  +   N  +FL GK
Sbjct  372  --GTAAMN-----AKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGK 424
Query  412  NNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVIL-RGPQRQ 454
            +++L+++       +F +   E++E +++AQ++ VIL   P+R+
Sbjct  425  SSLLHSMRGPELAAAFGVSE-EQLERIVKAQREAVILPTSPHRE 467

Sequence Alignment: 27. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 89.4 bits 365,  Expect = 6e-19
 Identities = 136/397 34%, Positives = 224/397 56%, Gaps = 39/397 9%
Query  58   REEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVM 117
            REE    NP+ F S RF  R  ++ G IR L  F + S+ ++ +  +R+  IE +PNT++
Sbjct  160  REETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLV 219
Query  118  LPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRI 177
            LP + DA  IL +  G+  +     N      L+EG  + +PSG   Y++N  D+ +LR+
Sbjct  220  LPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRV 279
Query  178  ASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------- 229
            A +    +T  G++E F+ A  R+  +    FS + LEAAFN +  ++  ++        
Sbjct  280  AKISMPVNTP-GQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGE 338
Query  230  ----GAHRR--------GVIFYANEEQIREMMRRGGFSAESTSASEQ-PKPFNLRNQKPD 276
                G  RR        GVI   ++E+++E+ +     ++  S  E    P NLR+ +PD
Sbjct  339  QEERGQRRRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPD 398
Query  277  FENDNGRFTRAGP-KDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIE 335
            + N+ GR+    P K NP L  +D+ +    +  G +  P  N+KA  I +V +G G +E
Sbjct  399  LSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLE 458
Query  336  M-ACPHLGQEHG-----WSSPRERGHQDINYERVR---ARLRTGTVYVVPAGHPITEIAS 386
            + A     Q+ G     W    E   ++ +   VR   ARL+ G V+++PA HP+   AS
Sbjct  459  LVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS 518
Query  387  TNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQKD 444
            +   L +L F IN   N R FLAG K+NV+  +EK+ + L+F  P  GE++E++++ Q++
Sbjct  519  S--ELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAF--PGSGEQVEKLIKNQRE 574
Query  445  QVILRG-PQRQRRDEP 459
               +   PQ Q    P
Sbjct  575  SHFVSARPQSQSPSSP 590

Sequence Alignment: 28. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 88.7 bits 362,  Expect = 9e-19
 Identities = 143/412 34%, Positives = 228/412 55%, Gaps = 44/412 10%
Query  40   GHHGVFPEEHGR-GHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELL 98
            G  G   +E G  G H   REE    NP+ F S RF  R  ++ G IR L  F + S  +
Sbjct  151  GREG--EQEWGTPGSHV--REETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQF 206
Query  99   EGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGV 158
            + +  +R+  IE KPNT++LP + DA  IL +  G+  +     N      L+EG  + +
Sbjct  207  QNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRI 266
Query  159  PSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAF 218
            PSG   Y++N  D+ +LR+A +    +T  G++E F+ A  R+  +    FS + LEAAF
Sbjct  267  PSGFISYILNRHDNQNLRVAKISMPVNTP-GQFEDFFPASSRDQSSYLQGFSRNTLEAAF 325
Query  219  NTDVQKLEHIF------------GAHR---------RGVIFYANEEQIREMMRRGGFSAE 257
            N +  ++  ++            G  R          GVI   ++E++ E+ +     ++
Sbjct  326  NAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSK 385
Query  258  STSASEQP--KPFNLRNQKPDFENDNGRFTRAGP-KDNPFLDSVDVTVGFGVLNPGTMTA 314
              S  E     P NLR  +PD+ N+ G++    P K NP L  +D+ +    +  G +  
Sbjct  386  KGSEEEGDITNPINLREGEPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALML 445
Query  315  PSHNTKATSIAIVMEGEGRIEM-ACPHLGQEHGWSSPRERGHQD---INYE--RVRARLR 368
            P  N+KA  I +V +G G +E+ A     Q+ G     E   ++    N E  R  ARL+
Sbjct  446  PHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLK 505
Query  369  TGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSF 427
             G V+++PA HP+   AS+   L +L F IN   N R FLAG K+NV+  +EK+ + L+F
Sbjct  506  EGDVFIMPAAHPVAINASSE--LHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAF 563
Query  428  NIP-RGEEIEEVLQAQKDQVILRG-PQRQRRDEPRS 461
              P  GE++E++++ QK+   +   PQ Q +  P S
Sbjct  564  --PGSGEQVEKLIKNQKESHFVSARPQSQSQS-PSS 596

Sequence Alignment: 29. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 83.3 bits 338,  Expect = 3e-17
 Identities = 115/378 30%, Positives = 204/378 53%, Gaps = 77/378 20%
Query  42   HGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGI 101
            HGV           GG  +++      + S+  R+   ++AGE+R L + G       G 
Sbjct  13   HGVATTTMAFHDDEGG--DKKSPKSLFLMSNSTRVF-KTDAGEMRVLKSHG-------GR 62
Query  102  SRYR---VTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGV 158
              YR   +  I M+P ++ +P+Y+D+  I+++  G   + ++  +EL +R+L+ GD++ +
Sbjct  63   IFYRHMHIGFISMEPKSLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMI 122
Query  159  PSGHTFYLVNNDDHNSLRIASLLRTESTMRGE-YEPFYVAGGRNPETVYSAFSDDVLEAA 217
            PSG  FYLVN  +   L +   +   +++  E ++ FY+ GG N  +V S F   +LE A
Sbjct  123  PSGSAFYLVNIGEGQRLHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETA 182
Query  218  FNTDVQKLEHIFGAHRRGVIFYAN-------------------EEQIREMMR-------- 250
            FN     +E IF     G I + +                   E+Q+++MM+        
Sbjct  183  FNESRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEE 242
Query  251  ----------------RGGFSAESTSASEQPKPFNLRN-QKPDFENDNGRFTRAGPKDNP 293
                            +     E+   +  P  +NL + +K DF+N  G        + P
Sbjct  243  KQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEYP 302
Query  294  FLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRER 353
             L   D+ V +  L+ G+M AP  N  +    IV+ G G +     H+G  +G      R
Sbjct  303  PLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGEL-----HIGYPNG-----SR 352
Query  354  GHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGKNN 413
                     ++ +++ G V+VVP   P  ++AS +G LE + F  +   N+ +FLAG  +
Sbjct  353  A--------MKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAAS 404
Query  414  VLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVIL 448
            +L+TL       +F +   + +   + AQ + VIL
Sbjct  405  LLRTLMGPELSAAFGVSE-DTLRRAVDAQHEAVIL 438

Sequence Alignment: 30. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 80.7 bits 325,  Expect = 9e-17
 Identities = 59/198 29%, Positives = 110/198 55%, Gaps = 12/198 6%
Query  250  RRGGFSAESTSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNP 309
            +R   S+  T +SE  KPFNL ++ P +    G+F    P+ NP L  +D+ +    +N 
Sbjct  2    KRAKSSSRKTISSED-KPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  310  GTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRT 369
            G +  P  N+KA  I ++ EG+  IE+      Q+      +++  Q +   + RA L  
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE-----QQQEEQPLEVRKYRAELSE 115
Query  370  GTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFN 428
              ++V+PAG+P+   A++N  L  +   IN   N+R FLAG ++NV+  +  +V+ L+F 
Sbjct  116  QDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAF- 172
Query  429  IP-RGEEIEEVLQAQKDQVILRGPQRQRRD 457
             P   + +E++L+ Q++   +     ++ +
Sbjct  173  -PGSAQAVEKLLKNQRESYFVDAQPNEKEE 201

Sequence Alignment: 31. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 71.4 bits 286,  Expect = 2e-13
 Identities = 123/399 30%, Positives = 231/399 57%, Gaps = 43/399 10%
Query  47   EEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRV 106
            E  G   +R  R   + +NP+ F+S RF+    ++ G +R L  F + S+ L+ +  YR+
Sbjct  193  ESEGSESQREPRRH-KNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRI 251
Query  107  TCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYL 166
                 KPNT++LPH+ DA +++ +  G   +  V  ++     L+ GD + VP+G TFY+
Sbjct  252  LEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYV 311
Query  167  VNNDDHNSLRIASLLR-------TESTMR-----------GEYEPFYVAGGRNPETVYSA 208
            VN D+  +LR+ +           +  +R           G +E F+++  +  ++    
Sbjct  312  VNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQG 371
Query  209  FSDDVLEAAFNTDVQKLEHI-FG---AHRRG-------VIFYANEEQIREMMRRGGFSAE 257
            FS ++LEA+++T  +++  + FG    +++G       VI   +++QIRE+ +    S+ 
Sbjct  372  FSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSR 431
Query  258  STSASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSH 317
             T +SE  KPFNL ++ P + N  G++     + NP L  +DV +    +N G +  P  
Sbjct  432  KTISSED-KPFNLGSRDPIYSNKLGKLFEITQR-NPQLRDLDVFLSVVDMNEGALFLPHF 489
Query  318  NTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPA 377
            N+KA  + ++ EGE  IE+      Q+      +++  Q +   + RA L    ++V+PA
Sbjct  490  NSKAIVVLVINEGEANIELVGIKEQQQR-----QQQEEQPLEVRKYRAELSEQDIFVIPA 544
Query  378  GHPITEIASTNGRLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRG-EEI 435
            G+P+   A+++  L  + F IN   N+R FLAG K+NV+  +  +V+ L+F  PR  ++I
Sbjct  545  GYPVMVNATSD--LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAF--PRSAKDI 600
Query  436  EEVLQAQKDQVILRGPQRQRRD 457
            E ++++Q +   +    +Q+ +
Sbjct  601  ENLIKSQSESYFVDAQPQQKEE 622

Sequence Alignment: 32. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 43.9 bits 165,  Expect = 2e-05
 Identities = 82/293 27%, Positives = 149/293 50%, Gaps = 54/293 18%
Query  141  QQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIA--SLLRTESTMRGEYEPFYVAG 198
            +Q++ V R + EGD+  +P+G   ++ NN     + +A   +  +E+ +      F + G
Sbjct  146  EQHQKV-RHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGG 204
Query  199  ---------------------GRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHR-RGV 236
                                 G+    + SAF +++L  +FN D Q ++ +    + RG+
Sbjct  205  SPQQEIQGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQSFNIDTQLVKKLQREEKQRGI 264
Query  237  IFYANEE-QIREMMRRGG-FSAESTSASEQPKPFNLRNQKP---DFEND-NGRFTRAGPK 290
            I    E+ Q+    R+   +S      +     + L    P   D  N   GR T     
Sbjct  265  IVRVKEDLQVLSPQRQEKEYSDNGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINAL 324
Query  291  DNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSP 350
            + P L  + ++V  GVL    + AP  N  A SI  +  G GR+++       E+G S  
Sbjct  325  NLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIV-----SENGESVF 379
Query  351  RERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNER-EFLA 409
             E              +R G + VVP    + + AS++G +E  W    T+G  +   LA
Sbjct  380  DEE-------------IREGQLVVVPQNFAVVKRASSDG-FE--WVSFKTNGLAKISQLA 423
Query  410  GKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRR 456
            G+ +V++ L  +V + SF+I R E+   + +++ +  I+    R +R
Sbjct  424  GRISVMRGLPLDVIQNSFDISR-EDAWNLKESRSEMTIFAPGSRSQR 469

Sequence Alignment: 33. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 37.7 bits 138,  Expect = 0.002
 Identities = 95/304 31%, Positives = 148/304 48%, Gaps = 88/304 28%
Query  114  NTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVK--RKLEEG--DVF--GVPSGHTFYLV 167
            + V LP  + A WI+    GR  +  V   ++     +L+E     F  G P G      
Sbjct  157  DVVALPAGV-AHWIF--NNGRSQLVLVALVDVGNDANQLDENFRKFFLAGSPQGGVVRGG 213
Query  168  NNDDHNSLRIASLLRTESTMRGEYEPFYV--AGGRNPETVYSAFSDDVLEAAFNTDVQ-- 223
             + D N        R   T RGE E      +GG N   V S F D++L  AF  D +  
Sbjct  214  QSRDRNQ-------RQSRTQRGEREEEESQESGGNN---VLSGFRDNLLAQAFGIDTRLA 263
Query  224  --------------KLEHIF-----GAHRRGVIFYANEEQIREMMRRGGFSAESTSASEQ 264
                          ++EH F     G  R+G      EE+  +  RR     E +   E+
Sbjct  264  RKLQNERDNRGAIVRMEHGFEWPEEGQRRQGREEEGEEEREPKWQRRQESQEEGSEEEER 323
Query  265  PK-----------------PFNLRNQKPD-----FENDNGRFTRAGPKDNPFLDSVDVTV 302
             +                    L+++ P      F    GR T     + P L  + ++ 
Sbjct  324  EERGRGRRRSGNGLEETFCSMRLKHRTPASSADVFNPRGGRITTVNSFNLPILQYLQLSA 383
Query  303  GFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINYER 362
              GVL    + AP  N  A SI  +  G GRI++       E+G         + I  E+
Sbjct  384  ERGVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIV-----SENG---------EAIFDEQ 429
Query  363  VRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNER-EFLAGKNNVLQTLEKE 421
            V      G V  VP  H + + A   GR    W    T+ N +   +AG+ ++++ L  +
Sbjct  430  VE----RGQVITVPQNHAVVKKA---GRRGFEWIAFKTNANAKISQIAGRVSIMRGLPVD 482
Query  422  VRHLSFNIPRGEEIEEVLQAQKDQVILRGPQR 453
            V   SF I R E +   L+  + +V +  P++
Sbjct  483  VLANSFGISREEAMR--LKHNRQEVSVFSPRQ 512

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.