The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSSSNSSTPSIPP
PVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNV
NLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFD
LSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYE
NGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES
GKTLIADQVIPADWQPNTVYSSIVQFD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72988 Ory s 1 327 2314 234.6 4.1e-63
AAF72987 Ory s 1 275 1332 141.0 5.1e-35
AAF72985 Ory s 1 286 1259 134.1 6.5e-33
AAB61710 Ory s 1 261 1235 131.8 3e-32
AAF72989 Ory s 1 271 1174 126.0 1.7e-30
AAD10496 Tri a ps93 271 1147 123.4 1e-29
AAF72984 Ory s 1 268 1013 110.6 7e-26
AAF72986 Ory s 1 275 848 95.0 3.8e-21
ACA23876 Pas n 1.0101 265 825 92.7 1.7e-20
P58738 Zea m 1 269 820 92.3 2.4e-20
AAF72991 Ory s 1 267 813 91.6 3.8e-20
AAF72990 Ory s 1 269 804 90.8 6.9e-20
AAF72983 Ory s 1 267 799 90.3 9.5e-20
A0A4D6G2J8 Uro m 1.0201 229 781 88.5 2.8e-19
P43213 Phl p 1 263 777 88.2 4e-19
CAA81613 Phl p 1.0101 263 761 86.6 1.2e-18
P43216 Hol l 1 265 760 86.6 1.2e-18
CAA93121 Hol l 1.0102 248 758 86.3 1.4e-18
CAA10140 Hol l 1 263 756 86.2 1.6e-18
CAA10520 Poa p a 263 750 85.6 2.4e-18
Q41260 Pha a 1 269 742 84.8 4.1e-18
CAB63699 Lol p 1.0103 263 739 84.5 4.9e-18
AAA63278 Lol p 1.0102 252 736 84.2 5.9e-18
AAA63279 Lol p 1.0101 263 733 84.0 7.3e-18
P14946 Lol p 1 263 733 84.0 7.3e-18
ABC58726 Sor h 1.0101 239 718 82.5 1.9e-17
O04701 Cyn d 1 246 716 82.3 2.2e-17
AAL14079 Cyn d 1.0203 262 715 82.3 2.4e-17
A0A4D6FZ45 Uro m 1.0101 262 715 82.3 2.4e-17
AAL14078 Cyn d 1 262 711 81.9 3.1e-17
AAL14077 Cyn d 1.0202 262 706 81.4 4.4e-17
AAA50175 Gly m 2 277 702 81.1 5.9e-17
AAK96255 Cyn d 1.0201 244 698 80.6 7.1e-17
AAF80379 Cyn d 1.0204 244 698 80.6 7.1e-17
Q40638 Ory s 1 263 696 80.5 8.4e-17
QCX36431 Zoy m 1.0101 272 690 79.9 1.3e-16
Q07154 Zea m 1 191 578 69.0 1.7e-13
BAA85432 Ory s 1 284 386 51.0 6.8e-08
CAB37496 Ara t expansin 265 362 48.7 3.2e-07
AAG13596 Ory s 1 275 311 43.8 9.4e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 234.6 bits 2314,  Expect = 4e-63
 Identities = 327/327 100%, Positives = 327/327 100%, Gaps = 0/327 0%
Query  1    MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSSSNSSTPSIPP 60
            MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSSSNSSTPSIPP
Sbjct  1    MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSSSNSSTPSIPP 60
Query  61   PVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNV 120
            PVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNV
Sbjct  61   PVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNV 120
Query  121  NLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFD 180
            NLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFD
Sbjct  121  NLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFD 180
Query  181  LSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYE 240
            LSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYE
Sbjct  181  LSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYE 240
Query  241  NGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES 300
            NGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES
Sbjct  241  NGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES 300
Query  301  GKTLIADQVIPADWQPNTVYSSIVQFD 327
            GKTLIADQVIPADWQPNTVYSSIVQFD
Sbjct  301  GKTLIADQVIPADWQPNTVYSSIVQFD 327

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 141.0 bits 1332,  Expect = 5e-35
 Identities = 186/234 79%, Positives = 205/234 87%, Gaps = 4/234 1%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G GWL ARATWYGAP GAGPDDNGGACGFKNVN  PFS+MTSCGNEP+FKDGKGCGSCYQ
Sbjct  41   GSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQ 100
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            IRC   P+CSG  ETVIITDMNYYPV+ YHFDLSGTAFGAMAK   ND+LRH+GIIDIQF
Sbjct  101  IRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQF 160
Query  209  RRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGV 268
            RRVPC YPGL + FHVE+GSNPVY A+LVEYE+ DGDVVQVDLMES+ + GG     TGV
Sbjct  161  RRVPCNYPGLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGA----TGV 216
Query  269  WTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
            WTPMRESWGSIWRLD+NH LQ PFSLRI ++SGKTL+A+ VIPA+W PN+ Y SIVQF
Sbjct  217  WTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 134.1 bits 1259,  Expect = 6e-33
 Identities = 173/233 74%, Positives = 198/233 84%, Gaps = 4/233 1%
Query  90   GGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQI 149
            G W  ARATWYG PNGAGPDDNGGACGFK+ N  PF +MTSCGN+PLFKDGKGCGSCY+I
Sbjct  53   GPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKI 112
Query  150  RCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFR 209
            RC    +CSG  ETVIITDMNYYPV+ +HFDLSGTAFG +AK   ND+LRH+GIIDI+F 
Sbjct  113  RCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFT 172
Query  210  RVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVW 269
            RVPC++PGL + FHVE+ SNPVY A+LVEYE+GDGDVVQVDLMES+ +     G PTG W
Sbjct  173  RVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTA----HGPPTGKW 228
Query  270  TPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
            TPMRESWGSIWRLDTNH LQ PFS+RI NESGKTL+A+ VIPA+W+PNT Y S VQ+
Sbjct  229  TPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 131.8 bits 1235,  Expect = 3e-32
 Identities = 173/230 75%, Positives = 194/230 84%, Gaps = 5/230 2%
Query  92   WLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIRC 151
            WL A+ATWYG PNGAGPDDNGGACGFKN N  PF +MTSCGNEPLF+DGKGCG+CYQIRC
Sbjct  31   WLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRC 90
Query  152  VGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRV 211
              +P+CSG P TVIITDMNYYPV+ YHFDLSGTAFGAMA+   ND+LRHAGIIDIQFRRV
Sbjct  91   TNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRV 150
Query  212  PCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTP 271
            PC + GL V FHVE GSNPVY+A+LVE+ N DG VVQ+D+MES  S     G PT VWTP
Sbjct  151  PCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPS-----GKPTRVWTP 205
Query  272  MRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
            MR SWGSIWRLD NH LQGP SLR+ +ESG+T+IA QVIPA+W+ NT Y S VQF
Sbjct  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 126.0 bits 1174,  Expect = 2e-30
 Identities = 162/246 65%, Positives = 193/246 78%, Gaps = 8/246 3%
Query  73   IPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCG 132
            +   G   +   + GG   W NA+ATWYG PNGAG  DNGGACGFK VN  PF  MTSCG
Sbjct  24   VQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCG 83
Query  133  NEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKD 192
            N+PL+K GKGCGSCY++RC  +PACSG  +TV ITDMNY+P+S YHFDLSG AFG +AK 
Sbjct  84   NQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKP 143
Query  193  NRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLM 252
             R D+LR AGIID+QF RVPC++PGL V FHVE+GS+PVY+A+LVEYENGDGDV QVDL 
Sbjct  144  GRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLK 203
Query  253  ESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPA 312
            E+    GG      G WTPMRESWGS+WRLD+NH L+ PFS+RI ++SGKTL+A  VIP 
Sbjct  204  EA--GAGG------GRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPL 255
Query  313  DWQPNTVYSSIVQF 326
            +W PNT Y S VQ+
Sbjct  256  NWTPNTFYRSFVQY 269

Sequence Alignment: 6. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 123.4 bits 1147,  Expect = 1e-29
 Identities = 153/230 66%, Positives = 192/230 83%, Gaps = 8/230 3%
Query  91   GWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR 150
            GWL A+ATWYGAPNGAGPDDNGGACGFKNVN  P S+M +CGNEP+F  G+GCG CY+I+
Sbjct  39   GWLPAKATWYGAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIK 98
Query  151  C--VGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            C    +P+CSG P  ++ITDMNYYPV+ YH+DLSGTAFG+MAK   ND LRHAGIID+QF
Sbjct  99   CEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQF 158
Query  209  RRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGV 268
            RRVPC +PG+ VTFHV++GSNP Y+A+LVEY N DG VV+++LM++      ++G PTG 
Sbjct  159  RRVPCNFPGMKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQT------MNGRPTGY 212
Query  269  WTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
            W  MR SWGS+WR+DTN P+QGPFS+RIT+++GKTL+A+  IPA WQ +  Y S +QF
Sbjct  213  WQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWSNLQF 270

Sequence Alignment: 7. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 110.6 bits 1013,  Expect = 7e-26
 Identities = 184/238 77%, Positives = 202/238 84%, Gaps = 10/238 4%
Query  79   GSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFK 138
            G+ + S       W  ARATWYGAP GAGPDD+GGACGFKN N  PFS+MTSCGNEP+FK
Sbjct  29   GNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFK 88
Query  139  DGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDEL 198
            DGKGCGSCYQIRCV HPACSG PETVIITDMNYYPVS YHFDLSGTAFGAMAK  +ND+L
Sbjct  89   DGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQL 148
Query  199  RHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYST 258
            RHAGIIDIQF+RVPC +PGL VTFHVE+GSNPVY A+LVEYE+GDGDVVQVDLME+   +
Sbjct  149  RHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQS 208
Query  259  GGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNT 318
                      WTPMRESWGSIWRLD+NH L  PFSLRITNESGK L+A QVIPA+W P  
Sbjct  209  ----------WTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMA 258
Query  319  VYSSIVQF 326
            VY S VQ+
Sbjct  259  VYRSFVQY 266

Sequence Alignment: 8. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 95.0 bits 848,  Expect = 4e-21
 Identities = 131/252 51%, Positives = 173/252 68%, Gaps = 20/252 7%
Query  61   PVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKN- 119
            P+   P +      + G  S+   S G G GW +  ATWYG P G G +  GGACG+++ 
Sbjct  16   PILSLPVSGYEQNYTAGRRSTM--SLGRGYGWSSGGATWYGGPQGDGSE--GGACGYQSA 71
Query  120  VNLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLY-- 177
            V   PFS+M + G   LFK+GKGCGSCYQI+C G+ ACSG P TV+ITD     V L   
Sbjct  72   VGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSCPGGVCLNEA 131
Query  178  -HFDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAIL 236
             HFD+SGTAFGAMA     D LR AG++ IQ++RVPC++  + V F V+ GSNP Y+AIL
Sbjct  132  AHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNVAFKVDAGSNPYYLAIL 190
Query  237  VEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTN--HPLQGPFSL 294
            V+Y NGDGD+  V +M++R   GG      G W  M++SWG+ WRL++N   PL  PFS+
Sbjct  191  VQYANGDGDLAAVHIMKAR---GG------GGWKAMQQSWGATWRLNSNTGKPLSPPFSI 241
Query  295  RITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
            R+T+ SGK L+A+ VIP+ WQ    Y S V +
Sbjct  242  RLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273

Sequence Alignment: 9. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 92.7 bits 825,  Expect = 2e-20
 Identities = 149/240 62%, Positives = 184/240 76%, Gaps = 17/240 7%
Query  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
            PP   PG   +   +G     WL A+ATWYG PNGAGPDDNGGACG KNVNLPP++  T+
Sbjct  25   PPKVPPGPNITTNYNG----KWLPAKATWYGQPNGAGPDDNGGACGIKNVNLPPYNGFTA 80
Query  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
            CGN P+FKDGKGCGSCY+IRC   P CSG P TV ITDMNY P++ YHFDLSG AFGAMA
Sbjct  81   CGNPPIFKDGKGCGSCYEIRC-NKPECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMA 139
Query  191  KDNRNDELRHAGIIDIQFRRVPCQYPG-LTVTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
            K   ND+LRH GI D++FRRV C+Y G   + FHVE+GSNP Y+A+LV++   DGD+V +
Sbjct  140  KPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLM 199
Query  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
            +L E            +  W PM+ SWG+IWR+DT   L  PFS+R+T+ESGK +IA  V
Sbjct  200  ELKEK-----------SSDWKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDV 248
Query  310  IPADWQPNTVYSSIVQF 326
            IP +W+P+TVY+S VQF
Sbjct  249  IPVNWKPDTVYNSNVQF 265

Sequence Alignment: 10. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 92.3 bits 820,  Expect = 2e-20
 Identities = 148/242 61%, Positives = 186/242 76%, Gaps = 15/242 6%
Query  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
            PP   PG   +   +G     WL ARATWYG PNGAG  DNGGACG KNVNLPP+S MT+
Sbjct  26   PPKVPPGPNITTNYNG----KWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTA 81
Query  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
            CGN P+FKDGKGCGSCY++RC   P CSG P TV ITDMNY P++ YHFDLSG AFG++A
Sbjct  82   CGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLA 141
Query  191  KDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
            K   ND++RH GI+D++FRRV C+YP G  + FH+E+G NP Y+A+LV+Y   DGD+V  
Sbjct  142  KPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIV-- 199
Query  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
             LME       +    +  W PM+ SWG+IWR+DT   L+GPFS+R+T+ESGK +IA  V
Sbjct  200  -LME-------IQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDV 251
Query  310  IPADWQPNTVYSSIVQF 326
            IPA+W+P+ VY+S VQF
Sbjct  252  IPANWRPDAVYTSNVQF 268

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 91.6 bits 813,  Expect = 4e-20
 Identities = 146/243 60%, Positives = 184/243 75%, Gaps = 15/243 6%
Query  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
            PP   PG       +   G  WL AR TWYG P GAGPDDNGGACG+K+++  PF  M S
Sbjct  24   PPKVPPGP----NITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNS 79
Query  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
            CGN+P+FKDGKGCGSC++++C    ACS  P  + ITDMN  P++ YHFDLSG AFGAMA
Sbjct  80   CGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMA 139
Query  191  KDNRNDELRHAGIIDIQFRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
            K+ +++ELR AGIID+QFRRV C+YPG T VTFHVE+GSNP Y A+LV+Y  GDGDVV+V
Sbjct  140  KEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKV 199
Query  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
            +L E         G+    W P+ ESWG+IWR+DT  PL+GPFSLR+T ES + L+A+ V
Sbjct  200  ELKEK--------GSEE--WKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDV 249
Query  310  IPADWQPNTVYSSIVQFD 327
            IP +W+ N +Y S +Q D
Sbjct  250  IPDNWKANALYKSEIQVD 267

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 90.8 bits 804,  Expect = 7e-20
 Identities = 149/242 61%, Positives = 182/242 75%, Gaps = 15/242 6%
Query  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
            PP   PG   +   +      WL ARATWYG P G+G  DNGGACG KNVNLPP++ M S
Sbjct  26   PPKVPPGPNITTNYNA----PWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMIS 81
Query  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
            CGN P+FKDG+GCGSCY+++C    ACS  P TV ITDMNY P+S YHFD+SG AFGAMA
Sbjct  82   CGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMA 141
Query  191  KDNRNDELRHAGIIDIQFRRVPCQYPG-LTVTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
               +  ELR AGIID+QFRRV C+YPG   VTFHVE+GSNP Y+A+LV++   DGDV+Q+
Sbjct  142  CPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQM 201
Query  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
            DL E+        G P   W PM+ SWG+IWR+DT  PL+ PFS+R+T ESGK+LIA  V
Sbjct  202  DLQEA--------GLPA--WRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDV 251
Query  310  IPADWQPNTVYSSIVQF 326
            IP +W P+ +Y S VQF
Sbjct  252  IPVNWMPDAIYVSNVQF 268

Sequence Alignment: 13. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 90.3 bits 799,  Expect = 1e-19
 Identities = 140/241 58%, Positives = 181/241 75%, Gaps = 15/241 6%
Query  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
            PP   PG   +       G  WL A+ATWYGAP GAGP DNGGACG+K+V+  PF  M S
Sbjct  24   PPKVPPGPNITTSY----GDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNS 79
Query  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
            CGN+P+FKDGKGCGSC++I+C    ACS  P  + +TDMN  P++ YHFDLSG AFGAMA
Sbjct  80   CGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMA 139
Query  191  KDNRNDELRHAGIIDIQFRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
            KD +++ELR AGIID QFRRV C+YP  T +TFH+E+ SNP Y+A+LV+Y  GDGDVV+V
Sbjct  140  KDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEV 199
Query  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
            ++ E         G+    W  ++ESWG+IWR+DT  PL+GPFS+R+T E G+ +IA+  
Sbjct  200  EIKEK--------GSEE--WKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDA 249
Query  310  IPADWQPNTVYSSIVQ 325
            IP  W+ ++VY S VQ
Sbjct  250  IPDGWKADSVYKSNVQ 265

Sequence Alignment: 14. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 88.5 bits 781,  Expect = 3e-19
 Identities = 134/226 59%, Positives = 176/226 77%, Gaps = 13/226 5%
Query  90   GGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQI 149
            G WL+A+ATWYG P GAGPDDNGGACG+K+VN  PF++M +CGN P+FKDG GCGSCY+I
Sbjct  2    GKWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEI 61
Query  150  RCVGHPA-CSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            +C   PA CSG P  V ITD NY P++ YHFDL+GTAFGAMAK    ++LR AGIID+QF
Sbjct  62   KC-DKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQF 120
Query  209  RRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP  T + FHVE+G NP Y A+L++Y  GDGD+V VD+ E         G+   
Sbjct  121  RRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEK--------GSEE- 171
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
             + P++ SWG+IWR+D+  P++GP ++R+T+E G TL+ D  IP  W+ +TVY+S +QF
Sbjct  172  -FIPLKHSWGAIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 15. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 88.2 bits 777,  Expect = 4e-19
 Identities = 137/237 57%, Positives = 171/237 72%, Gaps = 16/237 6%
Query  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
            P +P PG   +       G  WL+A++TWYG P GAGP DNGGACG+K+V+ PPFS MT 
Sbjct  25   PKVP-PGPNIT----ATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTG 79
Query  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
            CGN P+FK G+GCGSC++I+C    ACSG P  V ITD N  P++ YHFDLSG AFGAMA
Sbjct  80   CGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMA 139
Query  191  KDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
            K     +LR AG +++QFRRV C+YP G  VTFHVE+GSNP Y+A+LV+Y NGDGDVV V
Sbjct  140  KKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAV 199
Query  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
            D+ E      G D      W  ++ESWG+IWR+DT   L GPF++R T E G    A+ V
Sbjct  200  DIKEK-----GKDK-----WIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDV 249
Query  310  IPADWQPNTVYSS 322
            IP  W+ +T Y S
Sbjct  250  IPEGWKADTSYES 262

Sequence Alignment: 16. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 86.6 bits 761,  Expect = 1e-18
 Identities = 134/237 56%, Positives = 169/237 71%, Gaps = 16/237 6%
Query  71   PPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTS 130
            P +P PG   +       G  WL+A++TWYG P  AGP DNGGACG+K+V+ PPFS MT 
Sbjct  25   PKVP-PGPNIT----ATYGDKWLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTG 79
Query  131  CGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMA 190
            CGN P+FK G+GCGSC++I+C    ACSG P  V ITD N  P++ YHFDLSG AFG+MA
Sbjct  80   CGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMA 139
Query  191  KDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQV 249
            K     +LR AG ++IQFRRV C+YP G  VTFHVE+GSNP Y+A+LV++  GDGDVV V
Sbjct  140  KKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAV 199
Query  250  DLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQV 309
            D+ E      G D      W  ++ESWG+IWR+DT   L+GPF++R T E G    A  V
Sbjct  200  DIKEK-----GKDK-----WIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDV 249
Query  310  IPADWQPNTVYSS 322
            IP  W+ +T Y S
Sbjct  250  IPEGWKADTAYES 262

Sequence Alignment: 17. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 86.6 bits 760,  Expect = 1e-18
 Identities = 128/222 57%, Positives = 165/222 74%, Gaps = 11/222 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+K+V+ PPFS MT CGN P+FKDG+GCGSC++
Sbjct  40   GDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFE 99
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG P TV ITD N  P++ YHFDLSG AFG+MAK     +LR AG ++++F
Sbjct  100  IKCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKF 159
Query  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP G   TFHVE+GSNP Y+A+LV+Y +GDGDVV VD+ E      G D     
Sbjct  160  RRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK-----GKDK---- 210
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVY 320
             W  ++ESWG++WR+DT   L GPF++R T E G    A+ VIP  W+ +T Y
Sbjct  211  -WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 262

Sequence Alignment: 18. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 86.3 bits 758,  Expect = 1e-18
 Identities = 128/222 57%, Positives = 165/222 74%, Gaps = 11/222 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+K+V+ PPFS MT CGN P+FKDG+GCGSC++
Sbjct  23   GDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFE 82
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG P TV ITD N  P++ YHFDLSG AFG+MAK     +LR AG ++++F
Sbjct  83   IKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKF 142
Query  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP G   TFHVE+GSNP Y+A+LV+Y +GDGDVV VD+ E      G D     
Sbjct  143  RRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK-----GKDK---- 193
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVY 320
             W  ++ESWG++WR+DT   L GPF++R T E G    A+ VIP  W+ +T Y
Sbjct  194  -WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245

Sequence Alignment: 19. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 86.2 bits 756,  Expect = 2e-18
 Identities = 128/224 57%, Positives = 166/224 74%, Gaps = 11/224 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+K+V+ PPFS MT CGN P+FK G+GCGSC++
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFE 97
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG P  V ITD N  P++ YH+DLSG AFGAMAK     +LR AG ++++F
Sbjct  98   IKCTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKF 157
Query  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP G  VTFHVE+GSNP Y+A+LV+Y +GDGDVV VD+ E      G D     
Sbjct  158  RRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEK-----GKDK---- 208
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322
             W  ++ESWG++WR+DT   L GPF++R T E G  + A+ VIP  W+ +T Y S
Sbjct  209  -WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 20. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 85.6 bits 750,  Expect = 2e-18
 Identities = 130/224 58%, Positives = 164/224 73%, Gaps = 11/224 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+K+V+  PFS MT CGN P+FK G+GCGSC++
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFE 97
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG P  V ITD N  P++ YHFDLSG AFGAMAK     +LR AG ++++F
Sbjct  98   IKCTKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKF 157
Query  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP G  VTFHVE+GSNP Y+A+LV+Y  GDGDVV VD+ E      G D     
Sbjct  158  RRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVDIKEK-----GKDK---- 208
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322
             W  ++ESWGSIWR+DT   L GPF++R T E G    A+ VIP  W+ +T Y+S
Sbjct  209  -WIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 21. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 84.8 bits 742,  Expect = 4e-18
 Identities = 124/220 56%, Positives = 162/220 73%, Gaps = 11/220 5%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+K+V+  PF+ MT CGN P+FKDG+GCGSC++
Sbjct  44   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFE 103
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            ++C    +CSG P TV ITD N  P++ YHFDLSG AFG+MAK    + +R AG +++QF
Sbjct  104  LKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQF 163
Query  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP G   TFHVE+GSNP Y+A+LV+Y +GDGDVV VD+ E      G D     
Sbjct  164  RRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEK-----GKDK---- 214
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNT 318
             W  ++ESWG+IWR+DT   L GPF++R T E G     + VIP  W+ +T
Sbjct  215  -WIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWKADT 264

Sequence Alignment: 22. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 84.5 bits 739,  Expect = 5e-18
 Identities = 126/224 56%, Positives = 163/224 72%, Gaps = 11/224 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+K+V+  PF+ MT CGN P+FKDG+GCGSC++
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFE 97
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG   TV ITD N  P++ YHFDLSG AFG+MAK     +LR AG +++QF
Sbjct  98   IKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQF 157
Query  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP G   TFHVE+ SNP Y+AILV+Y +GDGDVV VD+ E      G D     
Sbjct  158  RRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK-----GKDK---- 208
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322
             W  ++ESWG++WR+DT   L GPF++R T E G     + VIP  W+ +T YS+
Sbjct  209  -WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSA 262

Sequence Alignment: 23. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 84.2 bits 736,  Expect = 6e-18
 Identities = 126/224 56%, Positives = 163/224 72%, Gaps = 11/224 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+K+V+  PF+ MT CGN P+FKDG+GCGSC++
Sbjct  27   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFE 86
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG   TV ITD N  P++ YHFDLSG AFG+MAK      +R AG +++QF
Sbjct  87   IKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQF 146
Query  209  RRVPCQYPGLTV-TFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP  T  TFHVE+GSNP Y+AILV+Y +GDGDVV VD+ E      G D     
Sbjct  147  RRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEK-----GKDK---- 197
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322
             W  ++ESWG++WR+DT   L GPF++R T E G     + VIP  W+ +T YS+
Sbjct  198  -WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSA 251

Sequence Alignment: 24. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 84.0 bits 733,  Expect = 7e-18
 Identities = 127/224 56%, Positives = 163/224 72%, Gaps = 11/224 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+KNV+  PF+ MT CGN P+FKDG+GCGSC++
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFE 97
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG   TV ITD N  P++ YHFDLSG AFG+MAK      +R AG +++QF
Sbjct  98   IKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQF 157
Query  209  RRVPCQYPGLTV-TFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP  T  TFHVE+ SNP Y+AILV+Y +GDGDVV VD+ E      G D     
Sbjct  158  RRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK-----GKDK---- 208
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322
             WT ++ESWG++WR+DT   L GPF++R T E G     + VIP  W+ +T YS+
Sbjct  209  -WTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSA 262

Sequence Alignment: 25. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 84.0 bits 733,  Expect = 7e-18
 Identities = 126/224 56%, Positives = 162/224 72%, Gaps = 11/224 4%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL+A++TWYG P GAGP DNGGACG+KNV+  PF+ MT CGN P+FKDG+GCGSC++
Sbjct  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFE 97
Query  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            I+C    +CSG   TV ITD N  P++ YHFDLSG AFG+MAK      +R AG +++QF
Sbjct  98   IKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQF 157
Query  209  RRVPCQYPGLTV-TFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
            RRV C+YP  T  TFHVE+ SNP Y+AILV+Y +GDGDVV VD+ E      G D     
Sbjct  158  RRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK-----GKDK---- 208
Query  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322
             W  ++ESWG++WR+DT   L GPF++R T E G     + VIP  W+ +T YS+
Sbjct  209  -WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSA 262

Sequence Alignment: 26. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 82.5 bits 718,  Expect = 2e-17
 Identities = 125/222 56%, Positives = 165/222 74%, Gaps = 14/222 6%
Query  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
            G  WL  +ATWYG P GAGPDDNGGACG+K+VN  PF++M +CGN P+FKDG  CGSC++
Sbjct  15   GSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDGL-CGSCFE 73
Query  149  IRC-VGHPA-CSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDI 206
            I+C    PA CSG    V ITDMNY  ++ YHFDL+G AFGAMAK  + ++L  AGIID+
Sbjct  74   IKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEKLAKAGIIDM 133
Query  207  QFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
            +FRRV C+Y G  VTFHVE+GSNP Y+A+LV+Y +GDGD+V VD+ E     GG      
Sbjct  134  KFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEK----GG------ 182
Query  267  GVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322
              + P++ SWG+IWR D+  P++ P +++IT E G     D VIP  W+ +T Y++
Sbjct  183  DAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTA 238

Sequence Alignment: 27. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 82.3 bits 716,  Expect = 2e-17
 Identities = 134/237 56%, Positives = 178/237 75%, Gaps = 18/237 7%
Query  74   PSPGTGSSNGSSGGGGGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCG 132
            P P   ++ GS       WL ARAT+YG+ P GA PDD+GGACG+K+V+ PPF  MT+CG
Sbjct  6    PGPNITATYGSK------WLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACG 59
Query  133  NEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKD 192
            NEP+FKDG GC +CY+I+C     CSG P  V ITD NY  ++ YHFDLSG AFGAMAK 
Sbjct  60   NEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKK 119
Query  193  NRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDL 251
             + D+LR AG + +QFRRV C+YP G  +TFH+E+GSN  Y+A+LV+Y  GDG++V VD 
Sbjct  120  GQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVD- 178
Query  252  MESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIP 311
                     +    +  + PM+ SWG+IWR+D   PL+GPFS+R+T+E G  L+ D VIP
Sbjct  179  ---------IKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIP 229
Query  312  ADWQPNTVYSSIVQF 326
            A+W+P+TVY+S +QF
Sbjct  230  ANWKPDTVYTSKLQF 244

Sequence Alignment: 28. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 82.3 bits 715,  Expect = 2e-17
 Identities = 131/228 57%, Positives = 174/228 76%, Gaps = 12/228 5%
Query  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF +MT CGNEP+FKDG GCGSCY
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCY 92
Query  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  93   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 152
Query  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
            FRRV C+YP  T + FHVE+GSNP Y+A+LV+Y  GDG++V VD+      + G D    
Sbjct  153  FRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-----KSKGSDE--- 204
Query  267  GVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
              + PM++SWG+IWR+D   PL+GPF++R+T+ESG  +  + VIP DW+P+TVY S +QF
Sbjct  205  --FLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 29. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 82.3 bits 715,  Expect = 2e-17
 Identities = 131/228 57%, Positives = 174/228 76%, Gaps = 12/228 5%
Query  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF +MT CGNEP+FKDG GCGSCY
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCY 92
Query  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  93   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 152
Query  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
            FRRV C+YP  T + FHVE+GSNP Y+A+LV+Y  GDG++V VD+      + G D    
Sbjct  153  FRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-----KSKGSDE--- 204
Query  267  GVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
              + PM++SWG+IWR+D   PL+GPF++R+T+ESG  +  + VIP DW+P+TVY S +QF
Sbjct  205  --FLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 30. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 81.9 bits 711,  Expect = 3e-17
 Identities = 133/226 58%, Positives = 173/226 76%, Gaps = 16/226 7%
Query  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF  MT CGNEP+FKDG GCGSCY
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCY 92
Query  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  93   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 152
Query  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
            FRRV C+YP  T +TFHVE+GS+P Y+A+LV+Y  GDG++V            GVD  P 
Sbjct  153  FRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIV------------GVDIKPK 200
Query  267  G--VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIV 324
            G  V+ PM+ SWG+IWR+D   PL+GPF++R+T+ESG  +  + VIP DW+P+TVY S +
Sbjct  201  GSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKI 260
Query  325  QF 326
            QF
Sbjct  261  QF 262

Sequence Alignment: 31. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 81.4 bits 706,  Expect = 4e-17
 Identities = 130/228 57%, Positives = 172/228 75%, Gaps = 12/228 5%
Query  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF  MT CGNEP+FKDG  CGSCY
Sbjct  33   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCY 92
Query  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  93   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 152
Query  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
            FRRV C+YP  T + FHVE+GSNP Y+A+LV+Y  GDG++V VD+      + G D    
Sbjct  153  FRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDI-----KSKGSDE--- 204
Query  267  GVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
              + PM++SWG+IWR+D   PL+GPF++R+T+ESG  +  + VIP DW+P+TVY S +QF
Sbjct  205  --FLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 32. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 81.1 bits 702,  Expect = 6e-17
 Identities = 119/224 53%, Positives = 162/224 72%, Gaps = 15/224 6%
Query  92   WLNARATWYGAPNGAGPDDNGGACGFKN-VNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR 150
            W  A ATWYG  NG G +  GGACG+ N V  PPFS++ S G+  ++  GKGCGSCY+++
Sbjct  48   WSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVK 105
Query  151  CVGHPACSGLPETVIITD--MNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
            C G+ ACSG P  V+ITD        + YHFDLSG AFGAMA   +++ LR+AG I+IQ 
Sbjct  106  CTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQH 165
Query  209  RRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGV 268
            RR+ C YPG ++ FHV+ GSN  Y A LVEYE+GDGD+ +V+L E+      +D   +G 
Sbjct  166  RRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEA------LD---SGS 216
Query  269  WTPMRESWGSIWRLDTNHPLQGPFSLRITN-ESGKTLIADQVIPADWQPNTVYSSIVQF 326
            W  M++SWG++W++D   PL+ PFS+++T  ESG+T++A+ VIPA W P   Y SIV F
Sbjct  217  WDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 33. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 80.6 bits 698,  Expect = 7e-17
 Identities = 131/226 57%, Positives = 171/226 75%, Gaps = 16/226 7%
Query  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF  MT CGNEP+FKDG  CGSCY
Sbjct  15   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCY 74
Query  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  75   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 134
Query  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
            FRRV C+YP  T + FHVE+GS+P Y+A+LV+Y  GDG++V            GVD  P 
Sbjct  135  FRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV------------GVDIKPK 182
Query  267  GV--WTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIV 324
            G   + PM++SWG+IWR+D   PL+GPF++R+T+ESG  +  D VIP DW+P+TVY S +
Sbjct  183  GSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKI 242
Query  325  QF 326
            QF
Sbjct  243  QF 244

Sequence Alignment: 34. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 80.6 bits 698,  Expect = 7e-17
 Identities = 131/226 57%, Positives = 171/226 75%, Gaps = 16/226 7%
Query  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF  MT CGNEP+FKDG  CGSCY
Sbjct  15   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCY 74
Query  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  75   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 134
Query  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
            FRRV C+YP  T + FHVE+GS+P Y+A+LV+Y  GDG++V            GVD  P 
Sbjct  135  FRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV------------GVDIKPK 182
Query  267  GV--WTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIV 324
            G   + PM++SWG+IWR+D   PL+GPF++R+T+ESG  +  D VIP DW+P+TVY S +
Sbjct  183  GSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKI 242
Query  325  QF 326
            QF
Sbjct  243  QF 244

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 80.5 bits 696,  Expect = 8e-17
 Identities = 125/231 54%, Positives = 164/231 70%, Gaps = 20/231 8%
Query  62   VAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVN 121
            V+P+P A  P +P PG   +       G  WL AR      P    P DNGGACG+K+V+
Sbjct  17   VSPSP-AGHPKVP-PGPNITTSY----GDKWLEARPPGMVRPRVLAPKDNGGACGYKDVD 70
Query  122  LPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDL 181
              PF  M SCGN+P+FKDGKGCGSC++I+C    ACS  P  + +TDMN  P++ YHFDL
Sbjct  71   KAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDL 130
Query  182  SGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYE 240
            SG A   MAKD +++ELR AGIID QFRRV C+YP  T +TFH+E+ SNP Y+A+LV+Y 
Sbjct  131  SGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYV 187
Query  241  NGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES 300
             GDGDVV+V++ E         G+    W  ++ESWG+IWR+DT  PL+GPFS+R+T E 
Sbjct  188  AGDGDVVEVEIKEK--------GSEE--WKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
Query  301  GKTLIADQVIP 311
             +   A+  IP
Sbjct  238  ARRSSAEDAIP 248

Sequence Alignment: 36. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 79.9 bits 690,  Expect = 1e-16
 Identities = 129/225 57%, Positives = 169/225 75%, Gaps = 12/225 5%
Query  92   WLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIR 150
            W +A+AT+YG+ P GA PDD+GGACG+KNV+  PF  MT CGNEP+FKDG GCGSC++I+
Sbjct  46   WQDAKATFYGSNPRGAAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIK 105
Query  151  CVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFRR 210
            C     CS  P  + ITD NY  ++ YHFDLSG AFG+MAK  + D LR AG + +QFRR
Sbjct  106  CKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRR 165
Query  211  VPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVW 269
            V C+YP  T +TFHVE+G N  Y+A+LVEY  GDGD+V VD+        G D      +
Sbjct  166  VKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKPK-----GSD-----EF 215
Query  270  TPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326
             PM+ SWG+IWR+D   PL+GPF++R+T+ESG  L+ + VIPADW+PNT Y+S +Q+
Sbjct  216  LPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 37. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 69.0 bits 578,  Expect = 2e-13
 Identities = 113/189 59%, Positives = 149/189 78%, Gaps = 11/189 5%
Query  128  MTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFG 187
            MT+CGN P+FKDGKGCGSCY++RC   P CSG P TV ITDMNY P++ YHFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  188  AMAKDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDV 246
            ++AK   ND+LRH GI+D++FRRV C+YP G  + FH+E+G NP Y+A+LV++   DGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  247  VQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIA 306
            V   LME       +    +  W PM+ SWG+IWR+DT   L+GPFS+R+T+ESGK +IA
Sbjct  121  V---LME-------IQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIA 170
Query  307  DQVIPADWQPNTVYSSIVQF 326
              +IPA+W+P+ VY+S VQF
Sbjct  171  KDIIPANWRPDAVYTSNVQF 190

Sequence Alignment: 38. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 51.0 bits 386,  Expect = 7e-08
 Identities = 85/228 37%, Positives = 128/228 56%, Gaps = 42/228 18%
Query  74   PSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGF-KNVNLPPFSAMTSCG 132
            P+PG  +   +S      W +  AT+YG P+G G DD GGACG+  N  +  +S  T+  
Sbjct  39   PAPGAVTPYKTSD-----WHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAAL 92
Query  133  NEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLY--------------H 178
            + PLF DG GCG CY++RCV  P C+    +V+IT  N  P + Y              H
Sbjct  93   STPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHH 152
Query  179  FDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVE 238
            FD++  +F  +A+       R AGI+ +Q+RRVPCQ  G  V F + QG N  ++ + V 
Sbjct  153  FDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTG-GVRFCL-QG-NHYWLLLYVM 202
Query  239  YENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITN 298
               G GDV  + +   + S GG      G W     +WG  +++         +++++T 
Sbjct  203  NVGGAGDVSSLSV---KTSGGG------GAWIQAAHNWGITYQVFAALDNSDGLTVKLTT 253
Query  299  ESG--KTLIADQVIPADWQPNTVYSSIVQF 326
             S   +T+I    I   W     Y     F
Sbjct  254  YSTPQQTIIVSDAISPWWITGLCYQGSNNF 283

Sequence Alignment: 39. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 48.7 bits 362,  Expect = 3e-07
 Identities = 74/201 36%, Positives = 116/201 57%, Gaps = 20/201 9%
Query  111  NGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMN 170
            + GAC + ++    F+   +     ++KDG GCG+C+Q+RC     CS    TVI+TD+N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  171  YYPVSLYHFDLSGTAFGAMAKD--NRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGS 228
                +   + LS  AF AMAK     + +L   GI+DI++RRVPC Y    +   VE+ S
Sbjct  101  --KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGNKKMNVRVEESS 158
Query  229  -NPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDT--N 285
             NP Y+AI + Y+ G  +VV + + +     G      +  W+ M  S G++W  D   N
Sbjct  159  KNPNYLAIKLLYQGGQTEVVAIYIAQ----VG------SSHWSYMTRSHGAVWVTDKVPN 208
Query  286  HPLQGPFSLRIT-NESGKTLIADQVIPADWQPNTVYSSIVQ 325
              LQ  F + +T    GK + + +V+PA+W+    Y + VQ
Sbjct  209  GALQ--FRFVVTAGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 43.8 bits 311,  Expect = 9e-06
 Identities = 66/202 32%, Positives = 108/202 53%, Gaps = 19/202 9%
Query  111  NGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMN 170
            N G+CG+ ++         +  +  LF+ G GCG+C+Q+RC     CS     V++TD  
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
Query  171  YYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSN 229
                +   + LS  A+ AMA+     +LR    +D++++RVPC+Y  G  ++  VE+ S 
Sbjct  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
Query  230  PVY-MAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPL 288
            P   ++I   Y+ G  D+V VD+     +T G     +  W  M   +G  W   T +  
Sbjct  169  PPRELSIRFLYQGGQTDIVAVDV-----ATVG-----SSNWKFMTRDYGPAW--STAQAP 216
Query  289  QGPFSLRIT---NESGKTLIAD-QVIPADWQPNTVYSSIVQ 325
             GP+ +R+       GK + AD +V+P  W    VY + VQ
Sbjct  217  AGPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.