The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL
NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK
Sequence Info Allergen Name Length Opt Bits Score E Value
EU564847 Art v 3.0301 117 791 145.5 3.5e-37
ANC85025 Art la 3.0102 115 763 140.7 9.8e-36
ANC85023 Art gm 3.0102 117 722 133.6 1.3e-33
ANC85022 Art gm 3.0101 117 707 131.1 7.8e-33
ANC85026 Art si 3.0101 116 702 130.2 1.4e-32
ANC85027 Art si 3.0102 116 700 129.9 1.8e-32
ANC85020 Art ar 3.0102 116 700 129.9 1.8e-32
ACE07187 Art v 3.0202 116 700 129.9 1.8e-32
ANC85024 Art la 3.0101 116 687 127.6 8.5e-32
ANC85019 Art ar 3.0101 116 687 127.6 8.5e-32
QIN55516 Art ca 3.0102 117 687 127.6 8.5e-32
ANC85021 Art ca 3.0101 117 685 127.3 1.1e-31
ANC85017 Art an 3.0101 117 685 127.3 1.1e-31
EU564845 Art v 3.0201 114 675 125.5 3.5e-31
ANC85018 Art an 3.0102 117 655 122.1 3.8e-30
AAK28533 Cor a 8 115 420 81.7 5.6e-18
ABY21307 Pla or 3.0101 118 420 81.7 5.6e-18
CAL07989 Pla a 3.0101 118 416 81.0 9e-18
Q4PLT6 Fra a 3.0202 117 413 80.5 1.3e-17
XP_019446786 Lup an 3.0101 116 402 78.6 4.8e-17
Q8VX12 Fra a 3.0101 117 402 78.6 4.8e-17
A0AT29 Len c 3.0101 118 400 78.3 6.1e-17
Q4PLU0 Fra a 3.0201 117 396 77.6 9.8e-17
Q4PLT9 Fra a 3.0102 117 394 77.2 1.2e-16
P85894 Mor n 3.0101 91 391 76.5 1.6e-16
Q9M5X8 Pru av 3 117 391 76.7 1.8e-16
A0A161AT60 Pis s 3.0101 120 387 76.1 2.9e-16
AAL25839 Hev b 12 116 384 75.5 4.1e-16
Q0Z8V0 Rub i 3.0101 117 382 75.2 5.2e-16
Q9M5X6 Pyr c 3 115 378 74.5 8.3e-16
A0A059SSZ0 Pun g 1.0201 120 375 74.0 1.2e-15
ADC80503 Pha v 3.0201 118 374 73.8 1.4e-15
ABX56711 Ara h 9.0101 116 368 72.8 2.7e-15
ADC80502 Pha v 3.0101 115 366 72.4 3.5e-15
Q9M5X7 Mal d 3 115 361 71.6 6.3e-15
AAB42069 Lyc e 3 114 359 71.2 8e-15
P93224 Sola l 3.0101 114 359 71.2 8e-15
A0A059STC4 Pun g 1.0101 120 356 70.7 1.2e-14
ACN11576 Pru du 3.0101 123 345 68.9 4.4e-14
A0A059ST23 Pun g 1.0301 120 344 68.7 4.9e-14
W0U0V5 Can s 3.0101 91 343 68.3 4.9e-14
P81651 Pru ar 3 91 342 68.1 5.5e-14
CAB96876 Pru p 3 91 336 67.1 1.1e-13
P19656-1 Zea m 14.0101 120 336 67.3 1.3e-13
P81402 Pru p 3 91 335 66.9 1.3e-13
P19656-2 Zea m 14.0102 128 331 66.5 2.3e-13
P82534 Pru d 3 91 328 65.7 2.9e-13
ABX75045 Ara h 9.0201 92 327 65.5 3.3e-13
NP_001316123 Sola l 7.0101 115 323 65.0 5.8e-13
A0A510A9S3 Ara h 17.0101 93 317 63.8 1.1e-12
ACV04796 Api g 2 118 314 63.5 1.7e-12
ABU95411 Sin a 3.0101 92 313 63.1 1.8e-12
AAA32970 Hor v 1 117 313 63.3 1.9e-12
CAA42832 Hor v 1 134 309 62.8 3.3e-12
19846220 Tri a 14.0101 90 303 61.4 5.7e-12
CAH69206 Tri tu 14.0101 115 297 60.6 1.3e-11
P82007 Hel a 3.0101 116 277 57.1 1.4e-10
P0C088 Art v 3.0101 37 244 50.5 4.5e-09
O04403 Par j 2 133 219 47.3 1.5e-07
P55958 Par j 2 133 205 44.9 7.9e-07
Q40905 Par j 1 138 202 44.4 1.1e-06
P43217 Par j 1 139 202 44.4 1.2e-06
CAI94601 Par j 1.0103 139 198 43.7 1.9e-06
O04004 Amb a 6 118 196 43.2 2.2e-06
O04404 Par j 1 176 189 42.4 6e-06
CAA54587 Par j 1.0101 133 188 41.9 6e-06
10998016 Cas s 8 36 124 29.8 0.0073
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 145.5 bits 791,  Expect = 4e-37
 Identities = 117/117 100%, Positives = 117/117 100%, Gaps = 0/117 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL
Sbjct  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK
Sbjct  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 2. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 140.7 bits 763,  Expect = 1e-35
 Identities = 110/115 95%, Positives = 114/115 99%, Gaps = 0/115 0%
Query  3    IKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 62
            +KMMKVFC+MVVCMVV +SYAE+ALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND
Sbjct  1    MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 60
Query  63   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK
Sbjct  61   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 3. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 133.6 bits 722,  Expect = 1e-33
 Identities = 103/117 88%, Positives = 112/117 95%, Gaps = 0/117 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMKVFC+MVVCMVVS+SYAE+ALTCSDVS KISPCLS+LK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGL 60
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTACNCLK SFKSNKDLKSD AV LPSKCG+N+PYK+SLETDCNKVK
Sbjct  61   NDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 4. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 131.1 bits 707,  Expect = 8e-33
 Identities = 100/117 85%, Positives = 110/117 94%, Gaps = 0/117 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMKVFC+MVVCMVVS+SYAE+ALTCSDVS KISPC S+LK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGL 60
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTACNCLK SFKSNKD+KSD A  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  61   NDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 5. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 130.2 bits 702,  Expect = 1e-32
 Identities = 99/116 85%, Positives = 110/116 94%, Gaps = 1/116 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMKVFC+MVVCMVVS+SYAE ALTCSDVS KISPCL+YLK+GGEVPA+CC GVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTAC CLK SFK+NKDLKSD+AVPLPSKCG+ +PYKLS+ETDCNKVK
Sbjct  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 6. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 129.9 bits 700,  Expect = 2e-32
 Identities = 100/116 86%, Positives = 109/116 93%, Gaps = 1/116 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMK FC MVVCMV+S+SYAE ALTCSDVS KI+PCL+YLK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKFFCAMVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGL 59
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTACNCLK SFKSNKDLKSDFA  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  60   NDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 7. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 129.9 bits 700,  Expect = 2e-32
 Identities = 100/116 86%, Positives = 109/116 93%, Gaps = 1/116 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMK FC MVVCMV+S+SYAE ALTCSDVS KI+PCL+YLK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKFFCAMVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGL 59
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTACNCLK SFKSNKDLKSDFA  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  60   NDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 8. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 129.9 bits 700,  Expect = 2e-32
 Identities = 100/116 86%, Positives = 109/116 93%, Gaps = 1/116 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMK FC MVVCMV+S+SYAE ALTCSDVS KI+PCL+YLK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKFFCAMVVCMVLSSSYAE-ALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGL 59
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTACNCLK SFKSNKDLKSDFA  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  60   NDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 9. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 127.6 bits 687,  Expect = 8e-32
 Identities = 99/116 85%, Positives = 107/116 92%, Gaps = 1/116 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMK FC MVVCMVVS+SYAE AL CSDVS KIS CLSYLK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKFFCAMVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGL 59
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTACNCLK +FKSNKD+KSDFA  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  60   NDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 10. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 127.6 bits 687,  Expect = 8e-32
 Identities = 99/116 85%, Positives = 107/116 92%, Gaps = 1/116 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMK FC MVVCMVVS+SYAE AL CSDVS KIS CLSYLK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKFFCAMVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGL 59
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQTACNCLK +FKSNKD+KSDFA  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  60   NDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 11. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 127.6 bits 687,  Expect = 8e-32
 Identities = 96/117 82%, Positives = 108/117 92%, Gaps = 0/117 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMKVFC+M+VCMVV +SYAE+ALTCSDVS KI+PCLS+LK+GGEVPADCCTGVKGL
Sbjct  1    MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGL 60
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KT PDRQ ACNCLK +FKSNKDLKSD AV LPSKCG+N+PYK+SLETDCN VK
Sbjct  61   NDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 12. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 127.3 bits 685,  Expect = 1e-31
 Identities = 97/117 82%, Positives = 108/117 92%, Gaps = 0/117 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMKVFC+MVVCMVVS+SYAE+ALTCSDVS KI PC S+LK+GGEV ADCCTGVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGL 60
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQ ACNCLK +FKSNKD+KSD AV LPSKCG+N+PYK+SLETDCNKVK
Sbjct  61   NDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 13. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 127.3 bits 685,  Expect = 1e-31
 Identities = 97/117 82%, Positives = 108/117 92%, Gaps = 0/117 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMKVFC+MVVCMVVS+SYAE+ALTCSDVS KI PC S+LK+GGEV ADCCTGVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGL 60
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQ ACNCLK +FKSNKD+KSD AV LPSKCG+N+PYK+SLETDCNKVK
Sbjct  61   NDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 14. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 125.5 bits 675,  Expect = 4e-31
 Identities = 97/114 85%, Positives = 105/114 92%, Gaps = 1/114 0%
Query  3    IKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 62
            +KMMK FC MVVCMVVS+SYAE AL CSDVS KIS CLSYLK+GGEVPADCCTGVKGLND
Sbjct  1    MKMMKFFCAMVVCMVVSSSYAE-ALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 59
Query  63   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            A KTTPDRQTACNCLK +FKSNKD+KSDFA  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  60   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 15. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 122.1 bits 655,  Expect = 4e-30
 Identities = 90/117 76%, Positives = 106/117 90%, Gaps = 0/117 0%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
            MA+KMMKVFC+MVVCMVV++SYAE+ALTC+DV+ KISPC S+L+KGGEVP DCCTGVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGL 60
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            NDA KTTPDRQ ACNCLK SFKS+ ++K + A  LPSKCG+N+PYK+SLETDCNKVK
Sbjct  61   NDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 16. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 81.7 bits 420,  Expect = 6e-18
 Identities = 53/112 47%, Positives = 79/112 70%, Gaps = 0/112 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
            +K+ C +++CM+V+   A ++LTC  +   ++PC+ YLK GG +P  CC GV+ +NDA++
Sbjct  4    LKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASR 63
Query  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            TT DRQ+ACNCLK + K    L  ++A  LP KCG+N+PYK+S  T+CN VK
Sbjct  64   TTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 17. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 81.7 bits 420,  Expect = 6e-18
 Identities = 56/114 49%, Positives = 78/114 68%, Gaps = 0/114 0%
Query  4    KMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDA 63
            ++ K+ C+++ CMV +  +AE+A+TC  V T+++PCL+YL+ GG V   CC GVK LN+ 
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
Query  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
             KTTPDRQ AC CLK +  S   ++   A  L  KCG+NLPYK+S   DC+KVK
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 18. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 81.0 bits 416,  Expect = 9e-18
 Identities = 55/114 48%, Positives = 78/114 68%, Gaps = 0/114 0%
Query  4    KMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDA 63
            ++ K+ C+++ CMV +  +AE+A+TC  V T+++PCL++L+ GG V   CC GVK LN+ 
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNND 64
Query  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
             KTTPDRQ AC CLK +  S   ++   A  L  KCG+NLPYK+S   DC+KVK
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 19. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 80.5 bits 413,  Expect = 1e-17
 Identities = 59/116 50%, Positives = 82/116 70%, Gaps = 2/116 1%
Query  1    MAIKM-MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKG 59
            MAI   MK+  + ++C+VV+   A+ A+TC  V++ ISPC++Y+K GG VPA CC G++ 
Sbjct  1    MAISTAMKLSLVALLCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGAVPAACCNGIRS 59
Query  60   LNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            LN A KTT DRQT CNCLK +  + K L  ++A  LP KCG+N+PYK+S  T+C  VK
Sbjct  60   LNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 20. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 78.6 bits 402,  Expect = 5e-17
 Identities = 52/113 46%, Positives = 77/113 68%, Gaps = 0/113 0%
Query  5    MMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDAT 64
            ++K+ C +++CMVV ++    A+TC  V+  ++ CL+YL+ GG VPA CC G+K + +  
Sbjct  4    IVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLA 63
Query  65   KTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            KTTPDR+TACNCLKA+  +   L    A  LP KCG+N+PYK+S  T+C  +K
Sbjct  64   KTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 21. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 78.6 bits 402,  Expect = 5e-17
 Identities = 55/111 49%, Positives = 78/111 70%, Gaps = 1/111 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
            MK+  + ++C+VV+   A+ A+TC  V++ ISPCL+Y+K GG VPA CC+G++ LN   K
Sbjct  7    MKLSLVALLCIVVALPIAQ-AITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAK 65
Query  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            TT DRQ ACNCLK +    K L  ++A  LP KCG+++PYK+S  T+C  VK
Sbjct  66   TTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 22. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 78.3 bits 400,  Expect = 6e-17
 Identities = 59/111 53%, Positives = 78/111 70%, Gaps = 3/111 2%
Query  6    MKVFCI-MVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDA 63
            MK+ C+ +V+CMVV    AE A++C  V++ +SPCL+YL  GG  P+  CC GVK L  A
Sbjct  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
Query  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
              TTPDRQ ACNCLK++  S   L ++ A  LP KCG+N+PYK+S  T+CN VK
Sbjct  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 23. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 77.6 bits 396,  Expect = 1e-16
 Identities = 54/111 48%, Positives = 77/111 69%, Gaps = 1/111 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
            MK+  + ++C+VV+   A+ A+TC  V++ ISPC++Y+K GG VPA CC G++ LN A K
Sbjct  7    MKLSLVALLCIVVALPIAQ-AITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAK 65
Query  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            TT DRQ  CNCLK +  + K L   +A  LP KCG+++PYK+S  T+C  VK
Sbjct  66   TTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 24. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 77.2 bits 394,  Expect = 1e-16
 Identities = 53/111 47%, Positives = 77/111 69%, Gaps = 1/111 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
            MK+  + ++C+VV+   A+ A+TC  V++ ISPC++Y+K GG VPA CC+G++ LN   K
Sbjct  7    MKLSLVALLCIVVALPIAQ-AITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAK 65
Query  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            TT DRQ  CNCLK +    K L  ++A  LP KCG+++PYK+S  T+C  VK
Sbjct  66   TTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 25. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 76.5 bits 391,  Expect = 2e-16
 Identities = 51/91 56%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            +TC  VS+ ++PC++YL+ GG VPA+CC GV+ LN+A KTT DRQ ACNCLK++F S K 
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            L  ++A  LP KCG+++PYK+S  TDC  VK
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 26. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 76.7 bits 391,  Expect = 2e-16
 Identities = 54/112 48%, Positives = 77/112 68%, Gaps = 1/112 0%
Query  5    MMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDAT 64
            M K+  ++ +CMVVS   A+ ALTC  VS+ ++PC++Y++ GG VP  CC G++ +N+  
Sbjct  6    MTKLALVVALCMVVSVPIAQ-ALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLA 64
Query  65   KTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            KTT DRQTACNCLK    S   + ++ A  LP KCG+N+PYK+S  T+C  VK
Sbjct  65   KTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 27. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 76.1 bits 387,  Expect = 3e-16
 Identities = 55/114 48%, Positives = 77/114 67%, Gaps = 3/114 2%
Query  4    KMMKVFCI-MVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEV--PADCCTGVKGL 60
            + MK+ C+ +V+CMVV    AE+AL+C  VS  ++PC++YL+       P  CC GVK L
Sbjct  3    RSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKL 62
Query  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
              A  TTPDRQ ACNCLK++  S   L ++ A  LP KCG+++PYK+S  T+CN V+
Sbjct  63   LAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 28. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 75.5 bits 384,  Expect = 4e-16
 Identities = 54/112 48%, Positives = 73/112 65%, Gaps = 1/112 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLNDAT 64
            +K+   +V+CM+V+      A+TC  V + + PCLSYLK  G  P A CC GV+ +N+A 
Sbjct  4    LKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAA 63
Query  65   KTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            KTT DR+TAC CLK++  S K L       LP KCG+N+PYK+SL T+C  VK
Sbjct  64   KTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 29. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 75.2 bits 382,  Expect = 5e-16
 Identities = 52/112 46%, Positives = 75/112 66%, Gaps = 1/112 0%
Query  5    MMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDAT 64
            +MK+  + ++C+VV+   A+ A+TC  V+  ++PC++Y+K GG VPA CC GV+ LN   
Sbjct  6    VMKLALVALLCIVVAVPVAQ-AITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQA 64
Query  65   KTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            KTT DRQ  CNCLK +  S   L   +A  LP KCG+++PYK+S  T+C  VK
Sbjct  65   KTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 30. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 74.5 bits 378,  Expect = 8e-16
 Identities = 52/110 47%, Positives = 74/110 67%, Gaps = 3/110 2%
Query  5    MMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDAT 64
            ++K+  ++ +CM VS ++   A+TCS VS  ++PC++Y++ GG VP  CC G+K +N   
Sbjct  6    VIKLALVVALCMAVSVAH---AITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLA 62
Query  65   KTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            KTTPDRQ ACNCLK    S   +    A  LP KCG+N+PYK+S  T+C  VK
Sbjct  63   KTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 31. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 74.0 bits 375,  Expect = 1e-15
 Identities = 52/106 49%, Positives = 73/106 68%, Gaps = 1/106 0%
Query  12   MVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLNDATKTTPDR 70
            + +CMVV+ S  ESA+TC  V++ ++PC+ Y +     P A CC+GV+ LN+A KTTPDR
Sbjct  14   LFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDR 73
Query  71   QTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            QTACNCLK   +S   +       LP KCG+++PYK+S  TDC++VK
Sbjct  74   QTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 32. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 73.8 bits 374,  Expect = 1e-15
 Identities = 50/108 46%, Positives = 78/108 72%, Gaps = 2/108 1%
Query  10   CIM-VVCMVVSTS-YAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTT 67
            C++ V+C+VV T+  A +A++C  V++ ++ C+ +L KGG VPA CC+GV+ LN A KTT
Sbjct  8    CVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKTT 67
Query  68   PDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            PDRQ  CNCLK++  +   + ++ A  LP KCG+++PYK+S  T+C  +K
Sbjct  68   PDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 33. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 72.8 bits 368,  Expect = 3e-15
 Identities = 48/112 42%, Positives = 74/112 66%, Gaps = 0/112 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
            +K   +M+VCM +  +   +A++C  V++ ++PC+ +L KGG  P  CC+GV+GL  A +
Sbjct  4    LKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALR 63
Query  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            TT DRQ ACNCLKA+  S + L    A  LP +CG+++PYK+S  T+C  +K
Sbjct  64   TTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 34. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 72.4 bits 366,  Expect = 3e-15
 Identities = 44/111 39%, Positives = 73/111 65%, Gaps = 0/111 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
            +K  C++V+CMVV  ++    +TC  V + + PC+++L+ GG VPA CC GV+ + ++ +
Sbjct  4    VKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSAR 63
Query  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116
            +T DR+  CNCLK +  + + L  + A  LP KCG+N+PYK+S  T+C  +
Sbjct  64   STADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 35. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 71.6 bits 361,  Expect = 6e-15
 Identities = 48/108 44%, Positives = 72/108 66%, Gaps = 3/108 2%
Query  7    KVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKT 66
            K+  ++ +CM VS ++A   +TC  V++ ++PC+ Y++ GG VP  CC G++ +N   +T
Sbjct  8    KLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLART 64
Query  67   TPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            T DRQTACNCLK    S   +  + A  LP KCG+N+PYK+S  T+C  VK
Sbjct  65   TADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 36. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 71.2 bits 359,  Expect = 8e-15
 Identities = 53/109 48%, Positives = 74/109 67%, Gaps = 2/109 1%
Query  7    KVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKT 66
            K+ C +V CMVV   +AES L+C +V++ ++PCL YL+  G +   CC GVKGL  A KT
Sbjct  6    KIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKT 63
Query  67   TPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
              DR+TAC CLK++  S K + +  A  LP  CG+N+PYK+S  TDC+ V+
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 37. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 71.2 bits 359,  Expect = 8e-15
 Identities = 53/109 48%, Positives = 74/109 67%, Gaps = 2/109 1%
Query  7    KVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKT 66
            K+ C +V CMVV   +AES L+C +V++ ++PCL YL+  G +   CC GVKGL  A KT
Sbjct  6    KIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKT 63
Query  67   TPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
              DR+TAC CLK++  S K + +  A  LP  CG+N+PYK+S  TDC+ V+
Sbjct  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 38. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 70.7 bits 356,  Expect = 1e-14
 Identities = 47/113 41%, Positives = 73/113 64%, Gaps = 2/113 1%
Query  5    MMKVFC-IMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKK-GGEVPADCCTGVKGLND 62
            + K+ C +  V +V +    E+A+TC  V++ ++PC+ Y +  GG VP  CC+G+K L+ 
Sbjct  6    LFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDG 65
Query  63   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
              +TTPDRQ  C CLK++  S   +   +   LP+KCG+N+PYK+S  TDC +VK
Sbjct  66   MARTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 39. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 68.9 bits 345,  Expect = 4e-14
 Identities = 46/114 40%, Positives = 72/114 63%, Gaps = 4/114 3%
Query  4    KMMKVFCIMVV--CMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLN 61
            +++K+ C++ V  CM V    A +A++C  V   ++PC++Y+  GG +   CCTGV+ L 
Sbjct  6    QLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLY 65
Query  62   DATKTTPDRQTACNCLKASFKS--NKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
               +TT DRQ+ CNCLK +       +  + +A  LP KCG+N+PYK+S  TDC  +K
Sbjct  66   SLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 40. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 68.7 bits 344,  Expect = 5e-14
 Identities = 45/112 40%, Positives = 72/112 64%, Gaps = 2/112 1%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGE--VPADCCTGVKGLNDA 63
            +++   ++VCM V+++ AE+ +TC  VS+ ++ C+ Y +  G   VP  CC G++ LN A
Sbjct  7    LRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSA 66
Query  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
             KTTPDRQ AC CLK+   S   +   +    P KCG+++PYK++  T+C+ VK
Sbjct  67   AKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 41. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 68.3 bits 343,  Expect = 5e-14
 Identities = 46/91 50%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            +TC  V++ ++PCLSYLK GG VP  CC  +K L+ A KT  DRQ AC CLK++  S K 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            +  ++A  LP KCG+++PYK+S  TDC+ VK
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 42. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 68.1 bits 342,  Expect = 6e-14
 Identities = 43/91 47%, Positives = 62/91 68%, Gaps = 0/91 0%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+  +TTPDR+TACNCLK    S   
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            +  + A  LP KCG+N+PYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 43. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 67.1 bits 336,  Expect = 1e-13
 Identities = 42/91 46%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+  +TTPDRQ ACNCLK    S   
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            +  + A  LP KCG+++PYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 44. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 67.3 bits 336,  Expect = 1e-13
 Identities = 47/113 41%, Positives = 76/113 67%, Gaps = 2/113 1%
Query  4    KMMKVFCIMVVCMVV-STSYAESALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLN 61
            + + V    VV +V+ + + +E+A++C  V++ I+PC+SY +  G  P A CC+GV+ LN
Sbjct  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
Query  62   DATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116
            +A +TT DR+ ACNCLK +      L +  A  +PSKCG+++PY +S  TDC++V
Sbjct  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 45. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 66.9 bits 335,  Expect = 1e-13
 Identities = 42/91 46%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+  +TTPDRQ ACNCLK    S   
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            +  + A  LP KCG+++PYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 46. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 66.5 bits 331,  Expect = 2e-13
 Identities = 46/112 41%, Positives = 75/112 66%, Gaps = 2/112 1%
Query  4    KMMKVFCIMVVCMVV-STSYAESALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLN 61
            + + V    VV +V+ + + +E+A++C  V++ I+PC+SY +  G  P A CC+GV+ LN
Sbjct  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
Query  62   DATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNK 115
            +A +TT DR+ ACNCLK +      L +  A  +PSKCG+++PY +S  TDC++
Sbjct  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118

Sequence Alignment: 47. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 65.7 bits 328,  Expect = 3e-13
 Identities = 42/91 46%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            +TC  VS+ ++PC++Y+K GG VP  CC G++ +N+  +TT DR+ ACNCLK    S   
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            +  + A  LP KCG+N+PYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 48. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 65.5 bits 327,  Expect = 3e-13
 Identities = 43/91 47%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            L+C  V++ ++PC+++L KGG     CC+GV+GL  A KTT DRQ ACNCLKA+  S   
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            L    A  LP +CG+++PYK+S  T+C  +K
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 49. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 65.0 bits 323,  Expect = 6e-13
 Identities = 43/114 37%, Positives = 72/114 63%, Gaps = 0/114 0%
Query  3    IKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 62
            +K + ++ ++V+ +      A  A+TC  V   ++PC+ +L +GGE  A CC+GV+ LN 
Sbjct  1    MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNG 60
Query  63   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116
             T+++ DR+TACNC+KA+     +LK D A  LPSKCG++L   +S   +C+ +
Sbjct  61   NTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 50. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 63.8 bits 317,  Expect = 1e-12
 Identities = 41/92 44%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  26   ALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKS-N 84
            A+ CS V+  I+PC+ YLK GG V   CC+G++ +N   KTT DRQ  CNCLK++  S  
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  85   KDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
              +  + A  LP KCG+++PYK+S   +C+ +K
Sbjct  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 51. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 63.5 bits 314,  Expect = 2e-12
 Identities = 47/113 41%, Positives = 63/113 55%, Gaps = 0/113 0%
Query  4    KMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDA 63
            K+     +M++ +V++       LTC  V+ K+  CL YLK GG     CC GVKGLN  
Sbjct  5    KVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSL 64
Query  64   TKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116
             KT  DR+ AC CLK    S K +    A  LP KCG+ +PY +S  TDC++V
Sbjct  65   AKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 52. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 63.1 bits 313,  Expect = 2e-12
 Identities = 41/92 44%, Positives = 58/92 63%, Gaps = 0/92 0%
Query  26   ALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNK 85
            AL+C  V++ ++ C+ YL +   +P  CCTGV  LN+  +TTPDRQ AC CL  +  S  
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  86   DLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
             L +  A  LP  CG+N+PYK+S  T+CN V+
Sbjct  61   SLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 53. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 63.3 bits 313,  Expect = 2e-12
 Identities = 43/115 37%, Positives = 72/115 62%, Gaps = 2/115 1%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKG 59
            MA   + +    +V M+ +   A  AL C  V +K+ PCL+Y++ GG  P+ +CC GV+ 
Sbjct  1    MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRD 59
Query  60   LNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116
            L++  +++ DRQT CNCLK   +   +L  + A  +PSKC +N+PY +S + DC+++
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 54. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 62.8 bits 309,  Expect = 3e-12
 Identities = 43/114 37%, Positives = 71/114 62%, Gaps = 2/114 1%
Query  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKG 59
            MA   + +    +V M+ +   A  AL C  V +K+ PCL+Y++ GG  P+ +CC GV+ 
Sbjct  1    MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRD 59
Query  60   LNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNK 115
            L++  +++ DRQT CNCLK   +   +L  + A  +PSKC +N+PY +S + DC++
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSR 115

Sequence Alignment: 55. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 61.4 bits 303,  Expect = 6e-12
 Identities = 41/89 46%, Positives = 59/89 66%, Gaps = 2/89 2%
Query  27   LTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNK 85
            + C  V + + PCLSY++ GG  P+  CC GVK L++  ++  DRQ+ACNCLK   +   
Sbjct  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
Query  86   DLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116
            +L  D A  +P KCG+NLPY +SL  DC++V
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 56. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 60.6 bits 297,  Expect = 1e-11
 Identities = 40/105 38%, Positives = 72/105 68%, Gaps = 6/105 5%
Query  8    VFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLNDATKT 66
            V+  +V  M+++ +  E+A++C  VS+ +SPC+SY +  G  P A CC+GV+ L  + ++
Sbjct  10   VLVAVVAAMLLAVT--EAAVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARS 67
Query  67   TPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117
            T D+Q AC C+K+   +   L +  A  +P+KCG+++PY +S   DC+K++
Sbjct  68   TADKQAACKCIKS---AAAGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 57.1 bits 277,  Expect = 1e-10
 Identities = 40/110 36%, Positives = 62/110 56%, Gaps = 1/110 0%
Query  6    MKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATK 65
            M V  + ++ M     +   A+TC+DV+  ++PCL YL+ GG+    CC G K L  AT+
Sbjct  6    MGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATR 65
Query  66   TTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116
            T  DR+TAC C K +    K ++ D A  LP KCG++    ++   +CN +
Sbjct  66   TQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 50.5 bits 244,  Expect = 5e-09
 Identities = 34/37 91%, Positives = 35/37 94%, Gaps = 0/37 0%
Query  26   ALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 62
            ALTCSDVS KISPCLSYLK+GGEVPADCC GVKGLND
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND 37

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 47.3 bits 219,  Expect = 1e-07
 Identities = 31/88 35%, Positives = 54/88 61%, Gaps = 4/88 4%
Query  29   CSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDL 87
            C  V   I PCL ++K   + P+  CC+G K L++  KTT  ++ AC C+ A+ K    +
Sbjct  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
Query  88   KSDFAVPLPSKCGLN--LPYKLSLETDCNKVK 117
            K+++   +P KCG+   LP  ++ + DC+K++
Sbjct  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 60. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 44.9 bits 205,  Expect = 8e-07
 Identities = 29/88 32%, Positives = 53/88 60%, Gaps = 4/88 4%
Query  29   CSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDL 87
            C  V   I PCL ++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
Query  88   KSDFAVPLPSKCGLN--LPYKLSLETDCNKVK 117
            K+++   +P KC +   LP  ++ + DC+K++
Sbjct  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 44.4 bits 202,  Expect = 1e-06
 Identities = 30/88 34%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  25   SALTCSDVSTKISPCLSYLKKGGEVPAD-CCTGVKGLNDATKTTPDRQTACNCLKASFKS 83
            S  TC  V   + PCL +++   + P+  CC+G K L+  TKT P R  AC C++ + K+
Sbjct  36   SEETCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKT 95
Query  84   NKDLKSDFAVPLPSKCGL---NLPYKLSLETDC 113
              D+   +   +P  CG+    LP  + +  DC
Sbjct  96   YSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 44.4 bits 202,  Expect = 1e-06
 Identities = 29/88 32%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  28   TCSDVSTKISPCLSYLKKGGEVPAD-CCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            TC  +   + PCL +++   + P+  CC+G K L+  TKT P R  AC C++ + K+  D
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  87   LKSDFAVPLPSKCGL---NLPYKLSLETDCNKV 116
            +   +   +P  CG+    LP  + +  DC  V
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 63. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 43.7 bits 198,  Expect = 2e-06
 Identities = 28/85 32%, Positives = 47/85 55%, Gaps = 5/85 5%
Query  28   TCSDVSTKISPCLSYLKKGGEVPAD-CCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
            TC  +   + PCL +++   + P+  CC+G K L+  TKT P R  AC C++ + K+  D
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  87   LKSDFAVPLPSKCGL---NLPYKLSLETDC 113
            +   +   +P  CG+    LP  + +  DC
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91

Sequence Alignment: 64. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 43.2 bits 196,  Expect = 2e-06
 Identities = 42/104 40%, Positives = 60/104 57%, Gaps = 11/104 10%
Query  8    VFCIMVVCMVVS---TSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDAT 64
            ++ + V  ++VS   T +A S  TC  V   ++PC  +L  G E    CCTGV  LN++ 
Sbjct  7    LWSVAVGLLLVSWRPTMFAASP-TCDTVQNILAPCAGFLT-GQEPSKACCTGVNNLNNSR 64
Query  65   KTTPDRQTACNCLKASFKS-NKDLKSDFAVPLPS-KCGLNLPYK-LSLETDCNKV 116
            KT  DR   CNC+K   KS   D K    +PL S KCG+   +  +    DC+K+
Sbjct  65   KTKADRVAVCNCIKELTKSIAYDPKR---MPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 65. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 42.4 bits 189,  Expect = 6e-06
 Identities = 29/88 32%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  25   SALTCSDVSTKISPCLSYLKKGGEVPAD-CCTGVKGLNDATKTTPDRQTACNCLKASFKS 83
            S  TC  V   + PCL +++   + P+  CC+G K L+  TKT   R  AC C++ + K+
Sbjct  37   SEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKT 96
Query  84   NKDLKSDFAVPLPSKCGL---NLPYKLSLETDC 113
              D+   +   +P  CG+    LP  + +  DC
Sbjct  97   YSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128

Sequence Alignment: 66. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 41.9 bits 188,  Expect = 6e-06
 Identities = 27/78 34%, Positives = 44/78 56%, Gaps = 5/78 6%
Query  38   PCLSYLKKGGEVPAD-CCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLP 96
            PCL +++   + P+  CC+G K L+  TKT P R  AC C++ + K+  D+   +   +P
Sbjct  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
Query  97   SKCGL---NLPYKLSLETDCNKV 116
              CG+    LP  + +  DC  V
Sbjct  67   KHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 67. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 29.8 bits 124,  Expect = 0.007
 Identities = 17/33 51%, Positives = 22/33 66%, Gaps = 2/33 6%
Query  26   ALTCSDVSTKISPCLSYLKKGG--EVPADCCTGVK 58
            ++TC+ VS  + PCL+YLK  G    P  CC GVK
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.