The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSGQMRRCVSQCD
KRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQR
DPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERM
KEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRY
EEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNA
FVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERL
HIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGV
IISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYR
QLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKR
HEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGR
ERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSI
LDFVGF
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9SPL4 Mac i 1.0201 666 4562 474.0 1.5e-134
Q9SPL3 Mac i 1.0101 625 4160 433.5 2.2e-122
B3STU4 Car i 2.0101 792 1822 197.9 2.3e-51
AAF18269 Jug r 2 593 1716 187.2 2.9e-48
AAM54366 Jug n 2 481 1486 164.0 2.3e-41
AAK15089 Ses i 3 585 1393 154.6 1.8e-38
A0A2I4E5L6 Jug r 6.0101 502 1337 149.0 7.8e-37
P09799 Gos h 2 605 1268 142.0 1.1e-34
P09801 Gos h 1 588 1172 132.4 9.1e-32
EF116865 Pis v 3.0101 519 1136 128.7 1e-30
Q9FZP9 Gly m 5.0201 559 1088 123.9 3.1e-29
AAM73730 Ana o 1.0101 538 1081 123.2 4.9e-29
AAM73729 Ana o 1.0102 536 1080 123.1 5.2e-29
AAL86739 Cor a 11 448 1069 121.9 9.5e-29
V9VGU0 Pin k 2.0101 463 1039 118.9 8e-28
CAA35691 Gly m conglycinin 605 1027 117.8 2.3e-27
O22120 Gly m 5.0101 543 1003 115.3 1.1e-26
AAB23463 Gly m conglycinin 439 957 110.6 2.3e-25
Q198W3 Vig r 2.0101 453 912 106.1 5.6e-24
B1NPN8 Vig r 2.0201 454 904 105.3 9.8e-24
ACB05815 Lup an 1.0101 611 680 82.8 7.9e-17
P43237 Ara h 1 614 624 77.1 4e-15
P43238 Ara h 1 626 621 76.8 5e-15
AAB01374 Gly m conglycinin 639 539 68.6 1.6e-12
CAF25232 Pis s 1.0101 415 476 62.2 8.7e-11
CAD87730 Len c 1.0101 418 472 61.8 1.2e-10
CAD87731 Len c 1.0102 415 471 61.7 1.2e-10
CAF25233 Pis s 1.0102 415 470 61.6 1.3e-10
A0A516F3L2 Pru du 8.0101 264 319 46.3 3.3e-06
A0A0S3B0K0 Coc n 1.0101 490 302 44.7 1.9e-05
AAA33947 Gly m conglycinin 218 281 42.4 4e-05
BAB21619 Gly m Bd28K 473 278 42.2 9.9e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 474.0 bits 4562,  Expect = 2e-134
 Identities = 666/666 100%, Positives = 666/666 100%, Gaps = 0/666 0%
Query  1    MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSGQMRRCVSQCD 60
            MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSGQMRRCVSQCD
Sbjct  1    MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSGQMRRCVSQCD 60
Query  61   KRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQR 120
            KRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQR
Sbjct  61   KRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQR 120
Query  121  DPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERM 180
            DPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERM
Sbjct  121  DPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERM 180
Query  181  KEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRY 240
            KEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRY
Sbjct  181  KEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRY 240
Query  241  EEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNA 300
            EEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNA
Sbjct  241  EEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNA 300
Query  301  FVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERL 360
            FVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERL
Sbjct  301  FVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERL 360
Query  361  HIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGV 420
            HIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGV
Sbjct  361  HIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGV 420
Query  421  IISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYR 480
            IISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYR
Sbjct  421  IISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYR 480
Query  481  QLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKR 540
            QLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKR
Sbjct  481  QLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKR 540
Query  541  HEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGR 600
            HEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGR
Sbjct  541  HEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGR 600
Query  601  ERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSI 660
            ERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSI
Sbjct  601  ERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSI 660
Query  661  LDFVGF 666
            LDFVGF
Sbjct  661  LDFVGF 666

Sequence Alignment: 2. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 433.5 bits 4160,  Expect = 2e-122
 Identities = 604/625 96%, Positives = 611/625 97%, Gaps = 0/625 0%
Query  42   QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQY 101
            QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQ+DPQT+CQQCQRRCRQQES PRQQQY
Sbjct  1    QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQEDPQTECQQCQRRCRQQESDPRQQQY 60
Query  102  CQRRCKEICEEEEEYNRQRDPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQ 161
            CQRRCKEICEEEEEYNRQRDPQQQYEQCQ+RCQR ETEPRHMQ CQQRCERRYEKEKRKQ
Sbjct  61   CQRRCKEICEEEEEYNRQRDPQQQYEQCQKRCQRRETEPRHMQICQQRCERRYEKEKRKQ 120
Query  162  QKRYEEQQREDEEKYEERMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQR 221
            QKRYEEQQREDEEKYEERMKE DNKRDPQQREYEDCRR CEQQEPR QYQCQRRC+EQQR
Sbjct  121  QKRYEEQQREDEEKYEERMKEGDNKRDPQQREYEDCRRHCEQQEPRLQYQCQRRCQEQQR 180
Query  222  QHGRGGDLINPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSK 281
            QHGRGGDL+NPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSK
Sbjct  181  QHGRGGDLMNPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSK 240
Query  282  LLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVI 341
            LLRALKNYRLVLLEANPNAFVLPTHLDADAILLV GGRGALKMIHRDNRESYNLECGDVI
Sbjct  241  LLRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDVI 300
Query  342  RIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAA 401
            RIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAA
Sbjct  301  RIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAA 360
Query  402  LNTQAERLRGVLGQQREGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKR 461
            LNTQ ERLRGVLGQQREGVII ASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKR
Sbjct  361  LNTQTERLRGVLGQQREGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKR 420
Query  462  PLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADV 521
            PLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADV
Sbjct  421  PLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADV 480
Query  522  EMACPHLSGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLL 581
            EMACPHLSGRHGGR GGKRHEEEE+VHYEQV+ARLSKREAIVV  GHPVVFVSSGNENLL
Sbjct  481  EMACPHLSGRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLL 540
Query  582  LFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPR 641
            LFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAA RKEVEELFNSQDESIFFPGPR
Sbjct  541  LFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPGPR 600
Query  642  QHQQQSSRSTKQQQPLVSILDFVGF 666
            QHQQQS RSTKQQQPLVSILDFVGF
Sbjct  601  QHQQQSPRSTKQQQPLVSILDFVGF 625

Sequence Alignment: 3. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 197.9 bits 1822,  Expect = 2e-51
 Identities = 304/620 49%, Positives = 436/620 70%, Gaps = 90/620 14%
Query  33   RQEYEECKRQCMQLETSGQMRRCVSQCDKRFEEDIDWSKY------DNQD-----DPQTD 81
            R++YE+C+  C + +   Q  +C  +C+++F+E  +  +       D+ D     DP+  
Sbjct  96   RKQYEQCRETCEKQDPR-QQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRDPREQ 154
Query  82   CQQCQRRCRQQESGPRQQQYCQRRCKEICEEE----EEYNRQR-----------DPQQQY 126
             +QC+  CR+Q  G RQQQ CQ RC+E  EEE    EE  R+R           DP++QY
Sbjct  155  YRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRDNDDEENPRDPREQY 214
Query  127  EQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRY------EEQQ--REDEEKYEE 178
             QCQE C+R+    R+ Q CQ RCE R E+E+RKQ++R       E+ Q  R+ E++YE+
Sbjct  215  RQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQEERERRRGRDEDDQNPRDPEQRYEQ 274
Query  179  ------------------------RMKEED------NKRDPQQREYEDCRRRCEQQE--P 206
                                    R +EE       +++DPQQ +Y  C+RRC+ QE  P
Sbjct  275  CQQQCERQRRGQEQQLCRRRCEQQRQQEERERQRGRDRQDPQQ-QYHRCQRRCQTQEQSP 333
Query  207  RQQYQCQRRC-REQQRQHGR--GGDLINPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRF 263
             +Q QCQ+RC R+ + Q+GR  G D  +P+R   GR E   E+Q  NPYYF  + L +R 
Sbjct  334  ERQRQCQQRCERQYKEQQGREWGPDQASPRRESRGREE---EQQRHNPYYFHSQGLRSRH 390
Query  264  RTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALK 323
             + EG +  LE F  R++LLR ++NYR+V+LEANPN FVLP H DA+++++VT GR  L 
Sbjct  391  ESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVVTRGRATLT 450
Query  324  MIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGG 383
             + ++ RES+NLE GDVIR+PAG T Y+IN+D+NERL + K+LQ ++ PGQ++E++ AG 
Sbjct  451  FVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGA 510
Query  384  QNPEPYLSTFSKEILEAALNTQAERLRGVLGQQ--REGVIISASQEQIRELTRD--DSES 439
            Q+ E YL  FS +IL AALNT  +RL   + QQ  REGVII ASQE++R L++    +  
Sbjct  511  QSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQ 570
Query  440  RRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSM 499
            R W    G  SS GP +L ++R  YSN++GQ +E  PE++RQLQ+MDV V  A I +G+M
Sbjct  571  RPW----GRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAM 626
Query  500  MGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDV---HYEQVKARL 556
            M P +N+++T VV V  G    EMACPH    +     G+R +EEE+    ++++V ARL
Sbjct  627  MVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARL 686
Query  557  SKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELA 616
            ++ +  V+P GHP+   +S NENL L  FGIN +NN+ NFLAG+  N++ Q+E +A EL+
Sbjct  687  ARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAGQN-NIINQLEREAKELS 745
Query  617  FAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSILDFVGF 666
            F  PR+E+EE+F  Q ES F P  RQ    S R   + +PL SILDF GF
Sbjct  746  FNMPREEIEEIFERQVESYFVPMERQ----SRRGQGRDHPLASILDFAGF 791

Sequence Alignment: 4. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 187.2 bits 1716,  Expect = 3e-48
 Identities = 272/575 47%, Positives = 400/575 69%, Gaps = 29/575 5%
Query  73   DNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYEQCQER 132
            +N  DP+   +QCQ  CR+Q  G RQQQ CQ RC+E  EE++    +R+ +++     ++
Sbjct  9    ENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQRSQEERE-RRRGRDVDDQ 67
Query  133  CQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQQR 192
              R + E R+ Q CQQ+CER+   +++   +R  EQ+R+ EE+  ER +  D ++DPQQ 
Sbjct  68   NPR-DPEQRYEQ-CQQQCERQRRGQEQTLCRRRCEQRRQQEER--ERQRGRD-RQDPQQ- 121
Query  193  EYEDCRRRCEQQE--PRQQYQCQRRC-REQQRQHGRG-GDLINPQRGGSGRYEEGEEKQS 248
            +Y  C+RRC+ QE  P +Q QCQ+RC R+ + Q+GR  G   +P+R   GR EE   +Q 
Sbjct  122  QYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGREEE---QQR 178
Query  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
             NPYYF  +S+ +R  +EEG +  LE F  R++LLR ++NYR+V+L+ANPN  +LP H D
Sbjct  179  HNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHKD 238
Query  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
            A+++ +VT GR  L ++ ++ RES+NLECGDVIR+PAG T Y+IN+D+NERL + K+LQ 
Sbjct  239  AESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQP 298
Query  369  ISTPGQYKEFFPAGGQNPEP-YLSTFSKEILEAALNTQAERLRGVLGQQ--REGVIISAS 425
            ++ PGQ++E++ AG ++P+  YL  FS +IL AALNT  +RL   + QQ  REGVII AS
Sbjct  299  VNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRAS 358
Query  426  QEQIRELTRD--DSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQ 483
            QE++R L++    +  R W    G  SS GP +L ++ P YSN++GQ +E  PE++RQLQ
Sbjct  359  QEKLRALSQHAMSAGQRPW----GRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQ 414
Query  484  DMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEE 543
            +MDV V  A I +G+MM P +N+++T VV V  G    EMACPH+S +    +G + +EE
Sbjct  415  EMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEE 474
Query  544  EEDV-HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRER 602
            EE    +++V ARL++ +  V+P GHP+   +S NENL L+ F IN +NN+ +FLAG + 
Sbjct  475  EESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAG-QN 533
Query  603  NVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSILD 662
            N++ Q+E +A EL+F  PR+E+EE+F SQ ES F P  RQ    S R   + +PL SILD
Sbjct  534  NIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQ----SRRGQGRDHPLASILD 589
Query  663  FVGF 666
            F  F
Sbjct  590  FAFF 593

Sequence Alignment: 5. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 164.0 bits 1486,  Expect = 2e-41
 Identities = 233/469 49%, Positives = 336/469 71%, Gaps = 23/469 4%
Query  185  NKRDPQQREYEDCRRRCEQQE--PRQQYQCQRRC-REQQRQHGRG-GDLINPQRGGSGRY 240
            +++DPQQ +Y  C+RRC+ QE  P +Q QCQ+RC R+ + Q+GR  G   +P+R   GR 
Sbjct  3    DRQDPQQ-QYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESKGRE 61
Query  241  EEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNA 300
            E   E+Q  NPYYF  +S+ +R  +EEG +  LE F  R++LLR ++NYR+V+L+ANPN 
Sbjct  62   E---EQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNT 118
Query  301  FVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERL 360
            F+LP H DA+++++VT GR  L ++ ++ RES+NLECGDVIR+PAG T Y+IN+D+NERL
Sbjct  119  FMLPHHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERL 178
Query  361  HIAKFLQTISTPGQYKEFFPAGGQNPEP-YLSTFSKEILEAALNTQAERLRGVLGQQ--R 417
             + K+LQ ++ PGQ +E++ AG ++P+  YL  FS +IL AALNT  +RL   + QQ  R
Sbjct  179  EMVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQR 238
Query  418  EGVIISASQEQIRELTRD--DSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVK 475
            EGVII ASQE++R L++    +  R W    G  SS GP +L ++RP YSN++GQ +E  
Sbjct  239  EGVIIRASQEKLRALSQHAMSAGQRPW----GRRSSGGPISLKSERPSYSNQFGQFFEAC 294
Query  476  PEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGR 535
            PE++RQLQ+MDV V  A I +G+MM P +N+++T VV V  G    EMACPH+S +    
Sbjct  295  PEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFED 354
Query  536  RGGKRHEEEEDV-HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHE 594
            +G + +EEEE    +++V ARL++ +  V+P GHP+   +S NENL L+ FGIN +NN+ 
Sbjct  355  QGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQR 414
Query  595  NFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQ 654
            NFLAG+  +++ Q+E +A EL+F  PR+E+EE+F SQ ES F P  RQ    S R   + 
Sbjct  415  NFLAGQN-SIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQ----SRRGQGRD 469
Query  655  QPLVSILDFVGF 666
            +PL SIL F  F
Sbjct  470  HPLASILGFAFF 481

Sequence Alignment: 6. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 154.6 bits 1393,  Expect = 2e-38
 Identities = 246/533 46%, Positives = 376/533 70%, Gaps = 57/533 10%
Query  77   DPQTDCQQCQRRCR-QQESGPRQQQYCQRRCKEICE---------------EEEEYNRQR 120
            DP+   +QC+ +C+ QQ+    Q++ C + CKE                  EEE +NR +
Sbjct  27   DPEL--KQCKHQCKAQQQISKEQKEACIQACKEYIRQKHQGEHGRGGGDILEEEVWNR-K 83
Query  121  DPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERM 180
             P ++  +C   C+++  E R  + C +RC+  Y++EK +Q                   
Sbjct  84   SPIERLRECSRGCEQQHGEQR--EECLRRCQEEYQREKGRQ------------------- 122
Query  181  KEEDNKRDPQQREYEDCRRRCEQQEPRQQY---QCQRRCREQQR-QHGRGGDLINPQRGG 236
             ++DN  DP+ ++Y+ CR +C +Q     +   +C+RR  E+ R Q+GR G        G
Sbjct  123  -DDDNPTDPE-KQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGR-GEMYEG 179
Query  237  SGRYEEGEEK-QSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLE 295
              R EE EE+ +   PY F+++ + T FRT+ G + VL+ F  RS+LLR ++NYR+ +LE
Sbjct  180  REREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILE 239
Query  296  ANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRD 355
            A P  F++P H DA+++++V  GRG + ++ +D RES N++ GD+++I AGTT YLINRD
Sbjct  240  AEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRD 299
Query  356  NNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQ 415
            NNERL +AK+LQ +STPG+++ FF AGG+NPE ++ +FS EILEAA+NT+ +RL+ ++GQ
Sbjct  300  NNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQ 359
Query  416  QREGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVK 475
            QR+GVI+ AS+EQ+R ++R + E   W    GGES +G  N++ +RP +SN+YGQ +EV 
Sbjct  360  QRQGVIVKASEEQVRAMSRHE-EGGIWPF--GGES-KGTINIYQQRPTHSNQYGQLHEVD 415
Query  476  PEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGR 535
               YRQL+D+D++V +ANITQG+M  P +N+++TK+ +V  GE   EMACPH+S   G  
Sbjct  416  ASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSY 475
Query  536  RGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHEN 595
            +G  R        Y++V +RL++   +++P GHP V V+S N+NL ++ F +NA NN + 
Sbjct  476  QGETRGRPS----YQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKF 531
Query  596  FLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQ 645
             LAGR RNV+ Q+E +A ELAF  P +EVEE+  SQ E  FF GPRQ+QQ
Sbjct  532  PLAGR-RNVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKGPRQQQQ 580

Sequence Alignment: 7. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 149.0 bits 1337,  Expect = 8e-37
 Identities = 204/456 44%, Positives = 313/456 68%, Gaps = 21/456 4%
Query  190  QQREYEDCRRRCEQQ---EPRQQYQCQRRCREQQRQHGRGGDLINPQRG--GSGR---YE 241
            Q  E + C+ +C +Q   + +++ +CQR C E + +  +  +    +R   GS R   YE
Sbjct  29   QDPELKQCKHQCRHQRQFDEQEKEHCQRSCDEYHIEK-KARERAERRRSEEGSSREEGYE 87
Query  242  E---GEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANP 298
            E   G E++ +NPY F++  + TR RT+EG I VLE F  RSKLLR ++N+R+ +LEANP
Sbjct  88   EEELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANP 147
Query  299  NAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNE 358
              F+ P H+DA+ +++V  GR  +  +  + RE++N+E GD++RIPAGT  YLINRD NE
Sbjct  148  QTFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENE 207
Query  359  RLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQRE 418
            +L+I K L+ +S PG+++ F  +GG++PE +   FS E+LEAAL T+ ++L  ++G+Q +
Sbjct  208  KLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEKLFGKQTQ 267
Query  419  GVIISASQEQIRELTR-DDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPE 477
            GVII AS+EQIR +++ +++  R W    GG+S+  P+NLF+KRP  SN++G+ +E  P+
Sbjct  268  GVIIKASKEQIRSMSKHEETTPRIWPF--GGDSTH-PFNLFHKRPSQSNQFGRLFETDPK 324
Query  478  DYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS--GRHGGR 535
            + +QLQD+D+ V  ANIT+GSM GP++N+R+TK+ VV  GE   EMACPHLS  G  G R
Sbjct  325  ECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLSSSGSRGQR 384
Query  536  RGG--KRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNH 593
             G    R        Y+Q++ RL      V P GHPV  ++S N+NL ++ F +NAQ N 
Sbjct  385  EGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDVNAQGNI 444
Query  594  ENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRS 650
               LAG+  N++ + E +A ELAF  P +EVE++F +QD+  FFPGP ++ ++  R+
Sbjct  445  RFPLAGKN-NIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQPEEGGRA 500

Sequence Alignment: 8. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 142.0 bits 1268,  Expect = 1e-34
 Identities = 237/555 42%, Positives = 364/555 65%, Gaps = 61/555 10%
Query  68   DWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYE 127
            D+    ++DDPQ   + C++RC+ +  G  +Q  C+ R +   +EE++ + + DPQ++Y+
Sbjct  27   DFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQDKCEDRSETQLKEEQQRDGE-DPQRRYQ 85
Query  128  QCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKR 187
             C++ CQ+ E   R    C+Q C  +YE    KQQ     QQ+ D               
Sbjct  86   DCRQHCQQEERRLRPH--CEQSCREQYE----KQQ-----QQQPD--------------- 119
Query  188  DPQQREYEDCRRRCEQQE--PRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRY-EEGE 244
                +++++C++RC+ QE  P ++ QC + CREQ ++    G+  N  R       +EGE
Sbjct  120  ----KQFKECQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGE 175
Query  245  EKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLP 304
            ++Q +NPYYF  RS+  RFR E G+  VL+ F  +  LLR +  +R+ +LEANPN FVLP
Sbjct  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
Query  305  THLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAK 364
             H DA+ I +VT GRG +  +  +N+ESYN+  G V+RIPAG+T YL N+DN E+L IA 
Sbjct  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
Query  365  FLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLG-------QQR 417
            + + ++ PGQ+++FFPAG +NP+ YL  FS+EILEA +NT++E+L  + G       QQ 
Sbjct  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQG 355
Query  418  EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRG-PYNLFNKRPLYSNKYGQAYEVKP 476
            +G+   ASQEQIR L++  +  R       G+ S G  +NL+++ P YSN+ G+ YE  P
Sbjct  356  QGMFRKASQEQIRALSQGATSPR-------GKGSEGYAFNLLSQTPRYSNQNGRFYEACP 408
Query  477  EDYRQ-LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGR 535
             +++Q L+++D SV    I +GS+  P +N+++T VV+V  G   VEM CPHLS R+   
Sbjct  409  RNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLS-RQSSD 467
Query  536  RGGKRHEEEEDV-------HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGI- 587
               +  EE+E+        +Y++V+A+LS     VVP GHPV FV+S NE+L L+ FG+ 
Sbjct  468  WSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLY 527
Query  588  NAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQS 647
            N Q+N   F+AG+  NV +Q + QA ELAF    + V+E+FN+  +  +F   R  +   
Sbjct  528  NGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFD 586
Query  648  SRSTKQQQPLVSILDF 663
             R      PL   LDF
Sbjct  587  ERRGSNN-PLSPFLDF 601

Sequence Alignment: 9. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 132.4 bits 1172,  Expect = 9e-32
 Identities = 231/539 42%, Positives = 356/539 66%, Gaps = 63/539 11%
Query  68   DWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQR--DPQQQ 125
            D+      DDP    + C+RRC     G ++QQ C+  CK    E+++  R+R  DPQ++
Sbjct  27   DFPGRRGDDDPPKRYEDCRRRCEWDTRGQKEQQQCEESCKSQYGEKDQQQRHRPEDPQRR 86
Query  126  YEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDN 185
            YE+CQ+ C+++E   R+   CQQRC +R+E+E+  QQ                       
Sbjct  87   YEECQQECRQQE--ERQRPQCQQRCLKRFEQEQ--QQS---------------------- 120
Query  186  KRDPQQREYEDCRRRCEQQE--PRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRYEEG 243
                 QR++++C++ C QQE  P ++ QC R CRE+ +++    +    +       EEG
Sbjct  121  -----QRQFQECQQHCHQQEQRPERKQQCVRECRERYQENPWRRE--REEEAEEEETEEG 173
Query  244  EEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVL 303
            E++QS NP++F  RS+ +RFR E G+  VL+ F  R  +LR +  +RL +LEANPN FVL
Sbjct  174  EQEQSHNPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVL 233
Query  304  PTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIA 363
            P H DA+ I LVT GRG L  +  +N+ESYN+  G V+R+PAG+T YL N+DN E+L IA
Sbjct  234  PHHCDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIA 293
Query  364  KFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLG-------QQ 416
             + + ++ P Q++EFFPAG Q P+ YL  FS+EILE A+NT++E+L  ++G       QQ
Sbjct  294  VLHRPVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQ 353
Query  417  REGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKP 476
             +G+   ASQEQIR L+++ +  R     + GE  R  +NL+ + P YSN+ G+ YE  P
Sbjct  354  GQGMFRKASQEQIRALSQEATSPRE----KSGE--RFAFNLLYRTPRYSNQNGRFYEACP 407
Query  477  EDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHL---SGRHG 533
             ++RQL D++V+V    + QGS+  P +N+++T VV+V  G   VEM  PHL   S    
Sbjct  408  REFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEE 467
Query  534  GRRGGKRHEEEEDV---HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQ 590
                 + +E+EE+    +Y +++++LS+ +  VVP   PV FV+S N+NL +  FG+  Q
Sbjct  468  EEEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQ 527
Query  591  N-----NHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQ 645
            N     N+  F+AG+  +V +Q + QA ELAF    + V+E+FN+  +  +F   RQ Q+
Sbjct  528  NINPDHNQRIFVAGKINHV-RQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVS-RQRQR 585
Query  646  QS 647
             S
Sbjct  586  AS 587

Sequence Alignment: 10. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 128.7 bits 1136,  Expect = 1e-30
 Identities = 219/509 43%, Positives = 342/509 67%, Gaps = 31/509 6%
Query  119  QRDPQQQYEQCQERC--QRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKY 176
            + DP  + +QC+ +C  QR+  E +  Q C + CE+ Y     K++K  E+++ E+EE  
Sbjct  1    KTDP--ELKQCKHQCKVQRQYDEEQKEQ-CAKGCEKYY-----KEKKGREQEEEEEEEWG 52
Query  177  EERMK-EEDNKRDPQQREYEDCRRRCEQQEPRQQYQ-CQRRCREQ----QRQHGRGGDLI 230
              R + +E +  +P ++    C ++CE+Q+  QQ Q C+ RC+E+    +R+H    D  
Sbjct  53   SGRGRGDEFSTHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEE 112
Query  231  NPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYR 290
              + G     +E +E++ +NPY F++  ++TR +TE+G + VL  F  RSKLLR L+ YR
Sbjct  113  EEEEG-----DEEQEEEDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYR 167
Query  291  LVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFY 350
            L +L ANP AFV+P H+DAD+I++V+ GRG +  I  + RES N++ GD+IRI AGT FY
Sbjct  168  LAFLVANPQAFVVPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFY 227
Query  351  LINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLR 410
            ++N D NE+L+I K+LQ ++ PG+Y+ F   GG+NPE +   FS+E+LEAAL T  ++L 
Sbjct  228  IVNTDENEKLYIVKLLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLE 287
Query  411  GVLGQQREGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQ 470
             ++ +Q EG I+ AS+EQIR ++R       W     G+S+ G +NLF K P  SN YGQ
Sbjct  288  KLFEKQDEGAIVKASKEQIRAMSRRGEGPSIWPFT--GKST-GTFNLFKKDPSQSNNYGQ 344
Query  471  AYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSG 530
             +E + +DY  LQ++D+ V   NIT+G M GPF+N+R+TK+ +V SGE  +E+ACPHLS 
Sbjct  345  LFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSS 404
Query  531  RHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQ 590
                +  G   +E+    Y+++ + +      VVP GHP V V+SGN+NL ++ F +NA+
Sbjct  405  ---SKNSG---QEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAE 458
Query  591  NNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRS 650
             N    LAG+ +N+++ +E +A ELAF    +EV+++F  QDE  FF GP+  Q+Q  R+
Sbjct  459  GNIRYTLAGK-KNIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQGPKWRQHQQGRA 517

Sequence Alignment: 11. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 123.9 bits 1088,  Expect = 3e-29
 Identities = 193/533 36%, Positives = 335/533 62%, Gaps = 41/533 7%
Query  107  KEICEEEE-EYNRQRDPQQQYEQCQERCQRHETEPRHM---QTCQQRCERRYEKEKRKQQ 162
            +E CEE +    R + P+++ +Q  E+ +    +PR     +  Q   E  +E+++  + 
Sbjct  4    EEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEW 63
Query  163  KRYEEQQ--REDEEKYEERMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQ 220
             R EE++  +  EE+ +ER  E      P+Q+E E    + E Q  ++++Q +    E++
Sbjct  64   HRKEEKHGGKGSEEEQDER--EHPRPHQPHQKEEE----KHEWQHKQEKHQGKESEEEEE 117
Query  221  RQ-HGRGGDLINPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGR 279
             Q      D  + +  GS    E    ++ NP++F+ + + T F+ + GH+ VL+ F  R
Sbjct  118  DQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKR 177
Query  280  SKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGD 339
            S+ L+ L++YR++ + + PN ++LP H DAD ++++  G   L +++ D+R+SYNL+ GD
Sbjct  178  SQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGD 237
Query  340  VIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILE 399
             +R+PAGTT+Y++N DN+E L +  +   ++ PG+++ FF +  Q  + YL  FSK ILE
Sbjct  238  ALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILE 297
Query  400  AALNTQAERLRGVL-----GQQR------EGVIISASQEQIRELTRDDSESRRWHIRRGG 448
            A+ +T+ E +  VL     GQQ+      E VI+  S++QIREL++    S R  I    
Sbjct  298  ASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTIS--- 354
Query  449  ESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRS 508
             S   P+NL ++ P+YSNK G+ +E+ PE   QL+D+DV + + ++ +G++  P FN+++
Sbjct  355  -SEDKPFNLRSRDPIYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA 413
Query  509  TKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEED-VHYEQVKARLSKREAIVVPVG 567
              V+V+  GEA++E+         G +   +R+++EE  +   + +A LS+++  V+P G
Sbjct  414  IVVLVINEGEANIELV--------GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAG 465
Query  568  HPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEEL 627
            +PVV  ++ + N+  FAFGINA+NN+ NFLAG + NV+ QI  Q  ELAF    K++E L
Sbjct  466  YPVVVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENL 523
Query  628  FNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661
              SQ ES F     Q++++ ++  K   PL SIL
Sbjct  524  IKSQSESYFVDAQPQQKEEGNKGRK--GPLSSIL 555

Sequence Alignment: 12. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 123.2 bits 1081,  Expect = 5e-29
 Identities = 212/504 42%, Positives = 331/504 65%, Gaps = 30/504 5%
Query  121  DPQQQYEQCQERC--QRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEE 178
            DP  + +QC+ +C  QR+  E +  Q C + CE+ Y KEK+ +++ +EE+    EE++  
Sbjct  29   DP--ELKQCKHQCKVQRQYDEQQKEQ-CVKECEKYY-KEKKGREREHEEE----EEEWGT 80
Query  179  RMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQ-CQRRCREQQRQHGRGGDLINPQRGGS 237
               +E +  +P ++    C R+CE+QE  QQ Q C+ RC+E+ ++  RG    N +R   
Sbjct  81   GGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKE-RGQH--NYKREDD 137
Query  238  GRYEEGE-EKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEA 296
               +E E E++ +NPY F++  ++T+ +TE+G + +L  F  +SKLL AL+ YRL +L A
Sbjct  138  EDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVA 197
Query  297  NPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDN 356
            NP AFV+P+H+DAD+I++V+ GRG +  I  + RES N+  GD++ I +GT FY+ N D 
Sbjct  198  NPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDE 257
Query  357  NERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQ 416
            NE+L++ +FL+ ++ PG+++ F   GG+NPE +   FS EILEAAL T  + L  ++ +Q
Sbjct  258  NEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQ 317
Query  417  REGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKP 476
             +G I+ AS+EQIR ++R     + W      E S G + LF K P  SNKYGQ +E + 
Sbjct  318  DQGTIMKASKEQIRAMSRRGEGPKIWPFT---EESTGSFKLFKKDPSQSNKYGQLFEAER 374
Query  477  EDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRR 536
             DY  L+ +D+ V  ANIT+G M  PF+N+R+TK+ +V SGE  VE+ACPHLS       
Sbjct  375  IDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSS-- 432
Query  537  GGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENF 596
                H       Y++++AR+ K    +VP GHP   V+SGNENL +  F +NA+ N    
Sbjct  433  ----HPS-----YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYT 483
Query  597  LAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRS 650
            LAG+ +N+++ +E +A ELAF    +EV+++F  QDE  FF GP   +++  R+
Sbjct  484  LAGK-KNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 536

Sequence Alignment: 13. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 123.1 bits 1080,  Expect = 5e-29
 Identities = 211/504 41%, Positives = 331/504 65%, Gaps = 30/504 5%
Query  121  DPQQQYEQCQERC--QRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEE 178
            DP  + +QC+ +C  QR+  E +  Q C + CE+ Y KEK+ +++ +EE+    EE++  
Sbjct  27   DP--ELKQCKHQCKVQRQYDEQQKEQ-CVKECEKYY-KEKKGREREHEEE----EEEWGT 78
Query  179  RMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQ-CQRRCREQQRQHGRGGDLINPQRGGS 237
               +E +  +P ++    C R+CE+QE  QQ Q C+ RC+E+ ++  RG    N +R   
Sbjct  79   GGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKE-RGQH--NYKREDD 135
Query  238  GRYEEGE-EKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEA 296
               +E E E++ +NPY F++  ++T+ +TE+G + +L  F  +SKLL AL+ YRL +L A
Sbjct  136  EDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVA 195
Query  297  NPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDN 356
            NP AFV+P+H+DAD+I++V+ GRG +  I  + RES N+  GD++ I +GT FY+ N D 
Sbjct  196  NPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDE 255
Query  357  NERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQ 416
            NE+L++ +FL+ ++ PG+++ F   GG+NPE +   FS EILEAAL T  + L  ++ +Q
Sbjct  256  NEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQ 315
Query  417  REGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKP 476
             +G I+ AS+EQ+R ++R     + W      E S G + LF K P  SNKYGQ +E + 
Sbjct  316  DQGTIMKASKEQVRAMSRRGEGPKIWPFT---EESTGSFKLFKKDPSQSNKYGQLFEAER 372
Query  477  EDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRR 536
             DY  L+ +D+ V  ANIT+G M  PF+N+R+TK+ +V SGE  VE+ACPHLS       
Sbjct  373  IDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSS-- 430
Query  537  GGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENF 596
                H       Y++++AR+ K    +VP GHP   V+SGNENL +  F +NA+ N    
Sbjct  431  ----HPS-----YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYT 481
Query  597  LAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRS 650
            LAG+ +N+++ +E +A ELAF    +EV+++F  QDE  FF GP   +++  R+
Sbjct  482  LAGK-KNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 534

Sequence Alignment: 14. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 121.9 bits 1069,  Expect = 1e-28
 Identities = 204/438 46%, Positives = 302/438 68%, Gaps = 33/438 7%
Query  186  KRDPQQREYEDCRRRC--EQQEPRQQYQCQRR-CREQQRQHGRGGDLINPQRGGSGRYEE 242
            K DP   E + C+ +C  E+Q   QQ +  ++ C E+ R+  +       + G S     
Sbjct  4    KEDP---ELKKCKHKCRDERQFDEQQRRDGKQICEEKARERQQ-------EEGNSSEESY 53
Query  243  GEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFV 302
            G+E Q +NPY F +  + +R +TEEG + VLENF  RS+LL  ++N+RL +LEANP+ F+
Sbjct  54   GKE-QEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFI 112
Query  303  LPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHI 362
             P H+DA+ +L+V  GR  + M+  + RES+N+E GD+IRIPAGT  Y+INRD NE+L I
Sbjct  113  SPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFI 172
Query  363  AKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGVII 422
             K LQ +S PG+++ F+ AGG++PE +   FS E+LEAAL  + E+L  V+G+Q +G I+
Sbjct  173  VKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIV 232
Query  423  SASQEQIRELTR-DDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQ 481
             AS+E+IR L++ ++   R W    GGESS GP NL++K P  SN++G+ YE  P+D++Q
Sbjct  233  KASREKIRALSQHEEGPPRIWPF--GGESS-GPINLLHKHPSQSNQFGRLYEAHPDDHKQ 289
Query  482  LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRH 541
            LQD+D+ V  ANIT+GSM GP++N+R+TK+ VV  GE   EMACPHLS   G        
Sbjct  290  LQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGS------- 342
Query  542  EEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRE 601
                   Y+++ ARL +    V P GHPV  ++S N NL ++ F +NA+ N    LAG+ 
Sbjct  343  -------YQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKG 395
Query  602  RNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTK 652
             N++ + E  A ELAF  P +EVE +F +QD++ FFPGP ++Q++  R  +
Sbjct  396  -NIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRGGR 445

Sequence Alignment: 15. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 118.9 bits 1039,  Expect = 8e-28
 Identities = 168/424 39%, Positives = 254/424 59%, Gaps = 9/424 2%
Query  222  QHGRGGDLINPQRGGSGRYEEG-EEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRS 280
            QHGRG   + P+  G G +  G EE++ +NPY F    +  R  +E G I  L NF   S
Sbjct  36   QHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVS 95
Query  281  KLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDV 340
            +LL  +  YR+  +E  PN  +LP ++DA  IL VTGGRG +  ++++      LE GDV
Sbjct  96   ELLEGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDV 155
Query  341  IRIPAGTTFYLINRDNNERLHIAKFLQTISTP-GQYKEFFPAGGQNPEPYLSTFSKEILE 399
              +P+G TFYL+N D++  L IA +L+T ST  G+Y+ F+ AGG+NPE   S FS ++LE
Sbjct  156  FGVPSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLE 215
Query  400  AALNTQAERLRGVLGQQREGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFN 459
            AA+NT  ++L  ++G +R GVI  A++EQIRE+ R    S         E  + P+NL N
Sbjct  216  AAFNTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRGGFSA--ESTSASEQPK-PFNLRN 272
Query  460  KRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEA 519
            ++P + N  G+     P+D   L  +DV+V    +  G+M  P  NT++T + +V  GE 
Sbjct  273  QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEG 332
Query  520  DVEMACPHLSGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNEN 579
             +EMACPHL   HG      R    +D++YE+V+ARL      VVP GHP+  ++S N  
Sbjct  333  RIEMACPHLGQEHGW--SSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGR 390
Query  580  LLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPR-KEVEELFNSQDESIFFP 638
            L ++ F IN   N   FLAG+  NVLQ +E +   L+F  PR +E+EE++ +Q + + + 
Sbjct  391  LEILWFDINTSGNEREFLAGKN-NVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILR 449
Query  639  GPRQHQQQSSRST 651
            GP+++++   RS+
Sbjct  450  GPQRQRRDEPRSS 462

Sequence Alignment: 16. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 117.8 bits 1027,  Expect = 2e-27
 Identities = 193/555 34%, Positives = 345/555 62%, Gaps = 55/555 9%
Query  72   YDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRC------KEICEEEE---EYNRQRDP 122
            Y  +++P+ +  +C + C  +    R Q  C+ RC      KE CEE E      R + P
Sbjct  27   YWEKENPKHN--KCLQSCNSERDSYRNQA-CHARCNLLKVEKEECEEGEIPRPRPRPQHP 83
Query  123  QQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKE 182
            +++ +Q  E+ +  + +PR +   + +  +  E E+R++Q+   ++++  E+  EE  ++
Sbjct  84   EREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDED 143
Query  183  EDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRYEE 242
            ED ++D +Q  +    R   Q+E R + + +    EQQR+     D             E
Sbjct  144  EDEEQDERQFPFP---RPPHQKEERNEEEDEDE--EQQRESEESED------------SE 186
Query  243  GEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFV 302
                ++ NP+ F    + T F+ + G I VL+ F  RS  L+ L++YR++ + + PN ++
Sbjct  187  LRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLL 246
Query  303  LPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHI 362
            LP H DAD ++++  G   L +++ D+R+SY L+ GD +R+P+GTT+Y++N DNNE L +
Sbjct  247  LPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRL 306
Query  363  AKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL--------- 413
              +   ++ PG+++ FF +  +  + YL  FS+ ILEA+ +T+ E +  VL         
Sbjct  307  ITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQ 366
Query  414  GQQR--EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQA 471
            G+QR  E VI+  S+EQIR L++    S R  I     S   P+NL ++ P+YSNK G+ 
Sbjct  367  GEQRLQESVIVEISKEQIRALSKRAKSSSRKTI----SSEDKPFNLRSRDPIYSNKLGKF 422
Query  472  YEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGR 531
            +E+ PE   QL+D+D+ + I ++ +G+++ P FN+++  ++V+  G+A++E+      G 
Sbjct  423  FEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV-----GL 477
Query  532  HGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQN 591
                +  ++++EE+ +   + +A LS+++  V+P G+PVV  ++ N N+  FA GINA+N
Sbjct  478  K--EQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF--FAIGINAEN 533
Query  592  NHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRST 651
            N+ NFLAG + NV+ QI  Q  ELAF    + VE+L+ +Q ES F     + +++ ++  
Sbjct  534  NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 593
Query  652  KQQQPLVSIL 661
            K   PL SIL
Sbjct  594  KG--PLSSIL 601

Sequence Alignment: 17. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 115.3 bits 1003,  Expect = 1e-26
 Identities = 185/523 35%, Positives = 328/523 62%, Gaps = 46/523 8%
Query  107  KEICEEEE---EYNRQRDPQQQYEQCQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQK 163
            KE CEE E      R + P+++ +Q  E+ +  + +PR +   + +  +  E E+R++Q+
Sbjct  3    KEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPRPIPFPRPQPRQEEEHEQREEQE 62
Query  164  RYEEQQREDEEKYEERMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQH 223
               ++++  E+  EE  ++ED ++D +Q  +    R   Q+E R+Q + +    EQQR+ 
Sbjct  63   WPRKEEKRGEKGSEEEDEDEDEEQDERQFPFP---RPPHQKEERKQEEDEDE--EQQRES 117
Query  224  GRGGDLINPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLL 283
                D             E    ++ NP+ F    + T F+ + G I VL+ F  RS  L
Sbjct  118  EESED------------SELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQL 165
Query  284  RALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRI 343
            + L++YR++ + + PN ++LP H DAD ++++  G   L +++ D+R+SY L+ GD +R+
Sbjct  166  QNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRV 225
Query  344  PAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALN 403
            P+GTT+Y++N DNNE L +  +   ++ PG+++ FF +  +  + YL  FS+ ILEA+ +
Sbjct  226  PSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYD 285
Query  404  TQAERLRGVL---------GQQR--EGVIISASQEQIRELTRDDSESRRWHIRRGGESSR 452
            T+ E +  VL         G+QR  E VI+  S+EQIR L++    S R  I     S  
Sbjct  286  TKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS----SED 341
Query  453  GPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVV 512
             P+NL ++ P+YSNK G+ +E+ PE   QL+D+D+ + I ++ +G+++ P FN+++  ++
Sbjct  342  KPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVIL 401
Query  513  VVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVF 572
            V+  G+A++E+      G     +  ++++EE+ +   + +A LS+++  V+P G+PVV 
Sbjct  402  VINEGDANIELV-----GLK--EQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVV 454
Query  573  VSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQD 632
             ++ N N+  FA GINA+NN+ NFLAG + NV+ QI  Q  ELAF    + VE+L+ +Q 
Sbjct  455  NATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQR 512
Query  633  ESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661
            ES F     + +++ ++  K   PL SIL
Sbjct  513  ESYFVDAQPKKKEEGNKGRK--GPLSSIL 539

Sequence Alignment: 18. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 110.6 bits 957,  Expect = 2e-25
 Identities = 160/398 40%, Positives = 259/398 65%, Gaps = 22/398 5%
Query  249  DNPYYF-DERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHL 307
            +NP+YF    S+ T F  +   I +L+ F  RS  L  L++YR+V +++ PN  +LP H 
Sbjct  31   NNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHA 90
Query  308  DADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQ 367
            DAD +L+V  GR  L +++ D+R+SYNL  GD  RIPAGTT+YL+N  +++ L I K+  
Sbjct  91   DADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAI 150
Query  368  TISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-GQ-----QREGVI 421
             ++ PG+Y +FF +  Q  + YL  FS  ILE +++++ E +  VL G+     Q+EGVI
Sbjct  151  PVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVI 210
Query  422  ISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQ 481
            +  S+EQIR+L+R    S R  I    E    P+NL ++ P+YSN +G+ +E+ PE   Q
Sbjct  211  VELSKEQIRQLSRRAKSSSRKTISSEDE----PFNLRSRNPIYSNNFGKFFEITPEKNPQ 266
Query  482  LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRH 541
            L+D+D+ +   +I +G+++ P FN+++  ++V+  G+A++E+      G     +  K+ 
Sbjct  267  LRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELV-----GIK--EQQQKQK 319
Query  542  EEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRE 601
            +EEE +  ++ +A LS+ +  V+P  +P  FV +   NL ++AFGINA+NN+ NFLAG +
Sbjct  320  QEEEPLEVQRYRAELSEDDVFVIPAAYP--FVVNATSNLNFLAFGINAENNQRNFLAGEK 377
Query  602  RNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661
             NV++QIE Q  ELAF    ++VE L+  Q ES F     Q++++ S+  K   P+ SIL
Sbjct  378  DNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRK--GPFPSIL 435

Sequence Alignment: 19. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 106.1 bits 912,  Expect = 6e-24
 Identities = 153/404 37%, Positives = 261/404 64%, Gaps = 29/404 7%
Query  241  EEGEEKQSDNPYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPN 299
            EE + +  +NP+YF+ +R + T F+ + GH+ V+  F  RSK ++ L+NYR+V +++ PN
Sbjct  34   EESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPN 93
Query  300  AFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNER 359
             ++LP H DAD +L+V  GR  L +++ D R+SY LE G   +IPAGTTF+L+N ++N+ 
Sbjct  94   TLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDN 153
Query  360  LHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-GQQR- 417
            L I K+   ++ P +++ FF +  +  + YL  FSK ILEA++++  + +  VL G++R 
Sbjct  154  LRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQ 213
Query  418  ---------EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKY 468
                     EGVI+   +EQIREL +    S R  +    E    P+NL N  P+YSNK+
Sbjct  214  QQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE----PFNLRNSNPIYSNKF 269
Query  469  GQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHL 528
            G+ YE+ PE   QL+D+DV +   ++ +G ++ P +N+++  ++V+  GEA +E+  P  
Sbjct  270  GRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP-- 327
Query  529  SGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGIN 588
                       +++++E +  ++ +A LS+ +  V+P  +PV   ++ N N+  FAFGIN
Sbjct  328  ---------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGIN 376
Query  589  AQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSS 648
            A+NN+ NFLAG + NV+ +I  + ++++F A   +VE+L   Q ES F     ++QQ+  
Sbjct  377  AENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREE 436
Query  649  RSTKQQQPLVSIL 661
                ++  L SIL
Sbjct  437  GHKGRKGSLSSIL 449

Sequence Alignment: 20. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 105.3 bits 904,  Expect = 1e-23
 Identities = 154/390 39%, Positives = 260/390 66%, Gaps = 29/390 7%
Query  246  KQSDNPYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLP 304
            +  +NP+YF+ +R + T FR + GH+ VL+ F  RSK ++ L+NYR+V L + PN ++LP
Sbjct  41   RGKNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLP 100
Query  305  THLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAK 364
             H DAD +L+V  GR  L +++ D R+S  LE G   +IPAGTTF+L+N D+NE L I K
Sbjct  101  HHADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIK 160
Query  365  FLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL----GQQR--- 417
            +   ++ P ++++FF +  +  + YL  FSK ILEA++++  + +  VL    GQQ+   
Sbjct  161  LAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQG 220
Query  418  -----EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAY 472
                 EGVI+   +EQIRELT+    S +    +   S   P+NL N++P+YSNK G+ +
Sbjct  221  QESQQEGVIVELKREQIRELTKHAKSSSK----KSLSSEDQPFNLRNQKPIYSNKLGRWF 276
Query  473  EVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRH 532
            E+ PE   QL+D+D+ +   ++ +GS++ P +N+++  ++V+  G+A++E+         
Sbjct  277  EITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELV-------- 328
Query  533  GGRRGGKRHEE-EEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQN 591
            G R   K++EE EE    ++ +A LS+ +  ++P  +PV   ++ N N+  FAFGINA+N
Sbjct  329  GQREQQKQQEEQEESWEVQRYRAELSEDDVFIIPATYPVAINATSNLNF--FAFGINAEN 386
Query  592  NHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPG-PRQHQQQSSR 649
            N+ NFLAG + NV+ +I  + +++ F A  ++V++L   Q ES F    P Q++++ +R
Sbjct  387  NQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445

Sequence Alignment: 21. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 82.8 bits 680,  Expect = 8e-17
 Identities = 211/541 39%, Positives = 338/541 62%, Gaps = 61/541 11%
Query  98   QQQYCQRRCKEICEEEEEYNRQRDPQQQYEQCQE--RCQRHETEPRHMQTCQQRCERRYE 155
            ++ + +   KE  EEE E  +Q  P+QQ EQ +E  R ++H+ EP   ++ Q    +  E
Sbjct  31   EKDFTKNPPKEREEEEHEPRQQPRPRQQEEQEREHRREEKHDGEPSRGRS-QSEESQEEE 89
Query  156  KEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRR 215
             E+R+++ R  EQ  E + + + R +EE+ + + Q R      RR E++E R+Q Q    
Sbjct  90   HERRREHHREREQ--EQQPRPQRRQEEEEEEEEWQPRRQRPQSRR-EEREEREQEQGSS- 145
Query  216  CREQQRQHGRGGDLINPQRGGSGRYEEGEEKQ---SD-----NPYYFDERSLSTRFRTEE 267
                  Q G GGD    +R      EE E++Q   SD     NPY+F    + T +R   
Sbjct  146  ---SGSQRG-GGDERRQHRERRVHREEREQEQDSRSDSRRQRNPYHFSSNRFQTYYRNRN 201
Query  268  GHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHR 327
            G+I VLE F  R+  L  L+NYR++ +++ PN ++LP H DAD IL+V  GR  + +++ 
Sbjct  202  GQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILPKHSDADFILVVLNGRATITIVNP 261
Query  328  DNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPE 387
            D R+ YNLE GD +R+PAGTT Y++N D+N+ L +AK+   I+ PG+  +F+P+  ++ +
Sbjct  262  DKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKDQQ 321
Query  388  PYLSTFSKEILEAALNTQAERLRGVL--------------GQ----QREGVIISASQEQI 429
             Y+S FSK  LEA +NT+ E +  VL              GQ    Q EGVI+  S++QI
Sbjct  322  SYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQI 381
Query  430  RELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSV 489
            +EL +    S       G  S  GP+NL + +P+YSNK+G  YE+ P+   Q+QD+++S+
Sbjct  382  QELRKHAQSSS----GEGKPSESGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISL 437
Query  490  FIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDVHY 549
                I +G+++ P +N+++  +VVV  GE + E+          G R  +R+++E++  Y
Sbjct  438  TFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELV---------GIRDQQRQQDEQEEEY 488
Query  550  EQ-------VKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRER 602
            EQ          +LSK +  ++P GHP+   +S N  L L+ FGINA  N+ NFLAG E 
Sbjct  489  EQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSN--LRLLGFGINANENQRNFLAGSED 546
Query  603  NVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQ--PLVSI 660
            NV++Q++ +  EL F    ++VE L  +Q +S F     Q+QQQ  +  ++ +  P+ SI
Sbjct  547  NVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREKEGRRGRRGPISSI 606
Query  661  LD 662
            L+
Sbjct  607  LN 608

Sequence Alignment: 22. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 77.1 bits 624,  Expect = 4e-15
 Identities = 226/545 41%, Positives = 337/545 61%, Gaps = 86/545 15%
Query  70   SKYDNQDDPQTDC-QQCQRRCRQQESGPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYEQ 128
            S Y   ++P   C Q+C + C QQE    +Q+ C+ RC ++     EY    DP+  Y+ 
Sbjct  27   SPYRKTENP---CAQRCLQSC-QQEPDDLKQKACESRCTKL-----EY----DPRCVYDT 73
Query  129  CQERCQRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRD 188
                 QRH    R     + R    Y+ ++R  Q R EE  R    +  ER +EED  R 
Sbjct  74   GATN-QRHPPGER----TRGRQPGDYDDDRR--QPRREEGGRWGPAEPREREREED-WRQ 125
Query  189  PQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRYEEGEEKQS 248
            P+    ED RR   QQ PR+            R  GR G+    Q  G+   E  EE   
Sbjct  126  PR----EDWRRPSHQQ-PRKI-----------RPEGREGE----QEWGTPGSEVREETSR 165
Query  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
            +NP+YF  R +STR+  + G I VL+ F  RSK ++ L+N+R+V +EA PN +VLP H D
Sbjct  166  NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPKHAD 225
Query  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
            AD IL++  G+  + + + +NR+S+NL+ G  +RIP+G   Y++NR +N+ L +AK    
Sbjct  226  ADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMP 285
Query  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL------------GQQ 416
            ++TPGQ+++FFPA  ++   YL  FS+  LEAA+N +   +R VL            GQ+
Sbjct  286  VNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQR 345
Query  417  R--------EGVIISASQEQIRELTRDDSESRRWHIRRGGESS--RGPYNLFNKRPLYSN 466
            R        EGVI+  S+E+++ELT+      +    +G E      P NL +  P  SN
Sbjct  346  RRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSK----KGSEEEDITNPINLRDGEPDLSN 401
Query  467  KYGQAYEVKPEDYR-QLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMAC 525
             +G+ +EVKP+    QLQD+D+ +    I +G++M P FN+++  +VVV  G  ++E+  
Sbjct  402  NFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVA 461
Query  526  PHLSGRHGGRRGGKRHEEEEDVHYE----QVK---ARLSKREAIVVPVGHPVVFVSSGNE 578
                 ++ GRR  +  EEEED   E    +V+   ARL + +  ++P  HPV   +S   
Sbjct  462  VRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE- 520
Query  579  NLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFP 638
             L L+ FGINA+NNH  FLAG + NV+ QIE QA +LAF    ++VE+L  +Q ES F  
Sbjct  521  -LHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVS 579
Query  639  GPRQHQQQSSRSTKQQQ--------PLVSIL 661
               Q Q  SS   + Q+        PL+SIL
Sbjct  580  ARPQSQSPSSPEKEDQEEENQGGKGPLLSIL 610

Sequence Alignment: 23. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 76.8 bits 621,  Expect = 5e-15
 Identities = 204/542 37%, Positives = 329/542 60%, Gaps = 57/542 10%
Query  93   ESGPRQQQY---CQRRCKEICEEEEEYNRQRDPQQQYEQCQERCQRHETEPRHMQTCQQR 149
            +S P Q++    C +RC + C++E +  +Q+        C+ RC + E +PR +   +  
Sbjct  26   KSSPYQKKTENPCAQRCLQSCQQEPDDLKQK-------ACESRCTKLEYDPRCVYDPRGH 78
Query  150  CERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQ-QREYEDCRRRCEQQEPRQ 208
                 ++    ++ R  +    D+++ + R +EE  +  P   RE E   R  + ++PR+
Sbjct  79   TGTTNQRSPPGERTRGRQPGDYDDDRRQPR-REEGGRWGPAGPRERE---REEDWRQPRE 134
Query  209  QYQCQRRCREQQ----RQHGRGGDLINPQRGGSGRYEEGEEKQSDNPYYFDERSLSTRFR 264
             +   RR   QQ    R  GR G+    Q  G+      EE   +NP+YF  R +STR+ 
Sbjct  135  DW---RRPSHQQPRKIRPEGREGE----QEWGTPGSHVREETSRNNPFYFPSRRFSTRYG 187
Query  265  TEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALKM 324
             + G I VL+ F  RS+ ++ L+N+R+V +EA PN +VLP H DAD IL++  G+  + +
Sbjct  188  NQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATVTV 247
Query  325  IHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQ 384
             + +NR+S+NL+ G  +RIP+G   Y++NR +N+ L +AK    ++TPGQ+++FFPA  +
Sbjct  248  ANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPASSR 307
Query  385  NPEPYLSTFSKEILEAALNTQAERLRGVL------------GQQR---------EGVIIS 423
            +   YL  FS+  LEAA+N +   +R VL            GQ+R         EGVI+ 
Sbjct  308  DQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSENNEGVIVK 367
Query  424  ASQEQIRELTRD-DSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYR-Q 481
             S+E++ ELT+   S S++     G  ++  P NL    P  SN +G+ +EVKP+    Q
Sbjct  368  VSKEHVEELTKHAKSVSKKGSEEEGDITN--PINLREGEPDLSNNFGKLFEVKPDKKNPQ 425
Query  482  LQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRH 541
            LQD+D+ +    I +G++M P FN+++  +VVV  G  ++E+       ++ GRR  +  
Sbjct  426  LQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEED 485
Query  542  E-EEEDVHYEQVK---ARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFL 597
            E EEE+    +V+   ARL + +  ++P  HPV   +S    L L+ FGINA+NNH  FL
Sbjct  486  EDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASS--ELHLLGFGINAENNHRIFL 543
Query  598  AGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQP 656
            AG + NV+ QIE QA +LAF    ++VE+L  +Q ES F     Q Q QS  S +++ P
Sbjct  544  AGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARPQSQSQSPSSPEKESP 602

Sequence Alignment: 24. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 68.6 bits 539,  Expect = 2e-12
 Identities = 205/564 36%, Positives = 353/564 62%, Gaps = 71/564 12%
Query  72   YDNQDDPQTDCQQCQRRCRQQESGPRQQQYCQRRCKEI-CEEEEEYN-------RQRDPQ 123
            Y  + +P  +  +C R C  ++   R Q  C+ RC  +  EEEEE         R + P+
Sbjct  27   YWEKQNPSHN--KCLRSCNSEKDSYRNQA-CHARCNLLKVEEEEECEEGQIPRPRPQHPE 83
Query  124  QQYEQCQERCQRHETEPRHM---QTCQQRCERRYEKEKRKQQKRYEEQQ--REDEEKYEE 178
            ++ +Q  E+ +    +PR     +  Q   E  +E+++  +  R EE++  +  EE+ +E
Sbjct  84   RERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDE 143
Query  179  RMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQCQRRCREQQRQ-HGRGGDLINPQRGGS 237
            R  E      P+Q+E E    + E Q  ++++Q +    E++ Q      D  + +  GS
Sbjct  144  R--EHPRPHQPHQKEEE----KHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGS 197
Query  238  GRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEAN 297
                E    ++ NP++F+ + + T F+ + GH+ VL+ F  RS+ L+ L++YR++ + + 
Sbjct  198  ESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSK 257
Query  298  PNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNN 357
            PN ++LP H DAD ++++  G   L +++ D+R+SYNL+ GD +R+PAGTTFY++N DN+
Sbjct  258  PNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDND 317
Query  358  ERLHI---AKF----------LQTIST------PGQYKEFFPAGGQNPEPYLSTFSKEIL 398
            E L +     F          L+ I+       PG+++ FF +  Q  + YL  FSK IL
Sbjct  318  ENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNIL 377
Query  399  EAALNTQAERLRGVL-----GQQR------EGVIISASQEQIRELTRDDSESRRWHIRRG 447
            EA+ +T+ E +  VL     GQQ+      E VI+  S++QIREL++    S R  I   
Sbjct  378  EASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTI--- 434
Query  448  GESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTR 507
              S   P+NL ++ P+YSNK G+ +E+   +  QL+D+DV + + ++ +G++  P FN++
Sbjct  435  -SSEDKPFNLGSRDPIYSNKLGKLFEITQRNP-QLRDLDVFLSVVDMNEGALFLPHFNSK 492
Query  508  STKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEED-VHYEQVKARLSKREAIVVPV 566
            +  V+V+  GEA++E+         G +   +R+++EE  +   + +A LS+++  V+P 
Sbjct  493  AIVVLVINEGEANIELV--------GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPA 544
Query  567  GHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEE 626
            G+PV+  ++ + N+  FAFGINA+NN+ NFLAG + NV+ QI  Q  ELAF    K++E 
Sbjct  545  GYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIEN 602
Query  627  LFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661
            L  SQ ES F     Q++++ ++  K   PL SIL
Sbjct  603  LIKSQSESYFVDAQPQQKEEGNKGRKG--PLSSIL 635

Sequence Alignment: 25. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 62.2 bits 476,  Expect = 9e-11
 Identities = 157/380 41%, Positives = 241/380 63%, Gaps = 29/380 7%
Query  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+ + LP + D
Sbjct  6    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
Query  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
            AD IL+V  G+  L ++  ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  66   ADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
Query  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQRE---------- 418
            ++ PGQ + F+ +G QN    LS FSK ILEAA+NT  E +  VL +Q+E          
Sbjct  126  VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK 185
Query  419  ---------GVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 469
                      VI+  S+EQI EL+++   S +  +     S  GP+NL ++ P+YSNK+G
Sbjct  186  DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSV----SSESGPFNLRSRNPIYSNKFG 241
Query  470  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 529
            + +E+ PE  +QLQD+D+ V   +I +GS++ P +N+R+  +V V  G+ D E+      
Sbjct  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR-- 299
Query  530  GRHGGRRGGKRHEEEEDV--HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGI 587
              + G+   K  E+EE+   + +  +A+LS  +  V+P GHPV   +S + NL+   FGI
Sbjct  300  NENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLI--GFGI 357
Query  588  NAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIF 636
            NA+NN  NFLAG E NV+ Q+E    ELAF     EV+ L+ +Q +S F
Sbjct  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYF 406

Sequence Alignment: 26. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 61.8 bits 472,  Expect = 1e-10
 Identities = 158/382 41%, Positives = 241/382 63%, Gaps = 28/382 7%
Query  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+   LP   D
Sbjct  6    ENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTD 65
Query  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
            AD IL+V  G+  L +++ ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  66   ADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
Query  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-------GQQR---- 417
            ++ PGQ + F+ +G QN   +LS FSK ILEAA+NT+ E +  VL        Q+R    
Sbjct  126  VNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLR 185
Query  418  --------EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 469
                    E VI+  S+EQI EL+++   S +  +    E    P+NL ++ P+YSNK+G
Sbjct  186  DKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE----PFNLRSRNPIYSNKFG 241
Query  470  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 529
            + +E+ PE   QLQD+D+ V    I +GS++ P +N+R+  +V V  G+ D E+      
Sbjct  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
Query  530  GRHGGRRGGKRHEEEEDVHYEQV---KARLSKREAIVVPVGHPVVFVSSGNENLLLFAFG 586
             ++  R      E +E+   +QV   +ARLS  + +V+P GHPV   +S + NL+   FG
Sbjct  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLI--GFG 359
Query  587  INAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIF 636
            INA+NN+ NFLAG E NV+ QI+    ELAF    +EV+ L+ +Q +S F
Sbjct  360  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409

Sequence Alignment: 27. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 61.7 bits 471,  Expect = 1e-10
 Identities = 154/382 40%, Positives = 240/382 62%, Gaps = 25/382 6%
Query  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+ + LP + D
Sbjct  6    ENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQYTD 65
Query  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
            AD IL+V  G+  L +++ ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  66   ADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
Query  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-------GQQR---- 417
            ++ PGQ + F+ +G QN   +LS F+K ILEAA+NT  E +  VL        Q+R    
Sbjct  126  VNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRSLR 185
Query  418  --------EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 469
                    E VI+  S+EQI+EL+++   S +  +    E    P+NL ++ P+YSNK+G
Sbjct  186  DRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE----PFNLRSRNPIYSNKFG 241
Query  470  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 529
            + +E+ PE   QLQD+D+ V    I +GS++ P +N+R+  +V V  G+   E+      
Sbjct  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNE 301
Query  530  GRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINA 589
             +       + +EEE   + ++ +A+LS  +  VVP GHPV   +S + NL+   FGINA
Sbjct  302  NQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLI--GFGINA 359
Query  590  QNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIF 636
            +NN+ NFLAG E NV+ QI+    ELAF    +EV+ L+ +Q +S F
Sbjct  360  KNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406

Sequence Alignment: 28. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 61.6 bits 470,  Expect = 1e-10
 Identities = 157/380 41%, Positives = 239/380 62%, Gaps = 29/380 7%
Query  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P  + LP   D
Sbjct  6    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQCTD 65
Query  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
            AD IL+V  G+  L ++  ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  66   ADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLTIP 125
Query  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQRE---------- 418
            ++ PGQ + F+ +G QN    LS FSK ILEAA+NT  E +  VL +Q+E          
Sbjct  126  VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK 185
Query  419  ---------GVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 469
                      VI+  S+EQI EL+++   S +  +     S  GP+NL ++ P+YSNK+G
Sbjct  186  DRRQEINEENVIVKVSREQIEELSKNAKSSSKKSV----SSESGPFNLRSRNPIYSNKFG 241
Query  470  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 529
            + +E+ PE  +QLQD+D+ V   +I +GS++ P +N+R+  +V V  G+ D E+      
Sbjct  242  KFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQR-- 299
Query  530  GRHGGRRGGKRHEEEEDV--HYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGI 587
              + G+   K  E+EE+   + +  +A+LS  +  V+P GHPV   +S + NL+   FGI
Sbjct  300  NENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLI--GFGI 357
Query  588  NAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIF 636
            NA+NN  NFLAG E NV+ Q+E    ELAF     EV+ L+ +Q +S F
Sbjct  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYF 406

Sequence Alignment: 29. Allergen Name: Pru du 8.0101 Sequence ID: A0A516F3L2

 Score = 46.3 bits 319,  Expect = 3e-06
 Identities = 60/188 31%, Positives = 103/188 54%, Gaps = 12/188 6%
Query  34   QEYEECKRQCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQE 93
            Q+ E+C R C Q E  G+   C  QC +  + ++   +   Q   Q   +QC +RC+   
Sbjct  73   QQQEQCLRMCRQQE-QGHHLPCREQCIRSPDREMC-ERACQQQQGQGGGRQCLQRCKMIT 130
Query  94   SGPRQQQYCQRRCKEICEEEEEYNRQRDPQQQYEQCQERCQRHETEPRHMQTCQQRCERR 153
              PR++  C R C +  +++  +  Q+  QQ  +QC++ CQ  E +P   Q CQ+ C  +
Sbjct  131  RDPRERLKCVRTCTQ-GQQQGVFQGQQQQQQVEQQCRQHCQS-ERDPMRQQECQEYCVGQ 188
Query  154  YEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQQREYEDCRRRCE---QQEPRQQY 210
              +++ +QQ R   Q      + +E+ +EE  ++    R+ E C+  C+   Q  P+QQ 
Sbjct  189  MMQQEYEQQCRSRCQWERPRREQQEQCQEECTEK---IRQLEQCQEGCKIQGQYGPQQQ- 244
Query  211  QCQRRCREQQRQHGRGGDLI 230
            +CQR CREQ  Q G+G  ++
Sbjct  245  ECQRMCREQFEQ-GQGIRMV 263

Sequence Alignment: 30. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 44.7 bits 302,  Expect = 2e-05
 Identities = 117/400 29%, Positives = 213/400 53%, Gaps = 76/400 19%
Query  234  RGGSGRYEEGEEKQSDNPY---YFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYR 290
            RG  GR +  EEK   +P     F  R     ++T+ G + ++  +  R     +  +  
Sbjct  33   RGMEGREKRVEEKAPRSPEDRGLFILRRSKEVLKTDAGEVRLMMGYRYRGN--HSPMHIG 90
Query  291  LVLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFY 350
            ++ +E  PN + +P ++DA  IL+V  G   +  I+++      L+ G V  IPAG++FY
Sbjct  91   FITME--PNTLYIPQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFY 148
Query  351  LINRDNNERLHIA---KFLQTISTPGQYKE-FFPAGGQNPEPYLSTFSKEILEAALNTQA 406
            ++N D +ERLHI      L+++   G Y + F+  GG  P   LS F    L AA+N  +
Sbjct  149  IVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSS 208
Query  407  ERLRGVLGQQREGVIISASQE-------------------QIRELTRDDS------ESRR 441
            ++L  +L  QR G II  + E                   Q +E+  DD       E   
Sbjct  209  DQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDV 268
Query  442  WHIR--------RGG---------ESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQD 484
            W  R        +G            S G YNL++  P Y N YG +  +   DY  L+ 
Sbjct  269  WTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKH 328
Query  485  MDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEE 544
             ++ V++ N+  G+M+ P  N  +T+  ++  G   +++  P+ +               
Sbjct  329  SNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPNGTA-------------- 374
Query  545  EDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNV 604
                   + A++S+ +   +P   P   ++S    L +F F  +A+ N   FL G+  ++
Sbjct  375  ------AMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGKS-SL 427
Query  605  LQQIEPQAMELAFAAPRKEVEELFNSQDESIFFP-GP-RQHQQQSSRSTKQQQPLV 658
            L+ +    +  AF    +++E +  +Q E++ +P  P R+ ++ + +  K ++ LV
Sbjct  428  LHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKKWKGEEVLV 483

Sequence Alignment: 31. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 42.4 bits 281,  Expect = 4e-05
 Identities = 75/206 36%, Positives = 133/206 64%, Gaps = 11/206 5%
Query  445  RRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFF 504
            R+   S   P+NL ++ P+YS K G+ +E+ PE   QL+D+D+ + I ++ +G+++ P F
Sbjct  9    RKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHF 68
Query  505  NTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVV 564
            N+++  ++V+  G+A++E+      G     +  ++++EE+ +   + +A LS+++  V+
Sbjct  69   NSKAIVILVINEGDANIELV-----GLK--EQQQEQQQEEQPLEVRKYRAELSEQDIFVI 121
Query  565  PVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEV 624
            P G+PVV  ++ N N+  FA GINA+NN+ NFLAG + NV+ QI  Q  ELAF    + V
Sbjct  122  PAGYPVVVNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAV 179
Query  625  EELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSIL 661
            E+L+ +Q ES F       +++ ++  K   PL SIL
Sbjct  180  EKLLKNQRESYFVDAQPNEKEEGNKGRK--GPLSSIL 214

Sequence Alignment: 32. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 42.2 bits 278,  Expect = 0.0001
 Identities = 107/396 27%, Positives = 208/396 52%, Gaps = 71/396 17%
Query  241  EEGEEKQSDNPYYFDERSLSTR-FRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPN 299
            +EG +K+S    ++   S STR F+T+ G + VL++  GR       ++  + ++   P 
Sbjct  25   DEGGDKKSPKSLFL--MSNSTRVFKTDAGEMRVLKSHGGRI----FYRHMHIGFISMEPK 78
Query  300  AFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNER 359
            ++ +P +LD++ I+++  G   L  I+ D      L+ GD+  IP+G+ FYL+N    +R
Sbjct  79   SLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQR 138
Query  360  LHIAKFLQTISTPG--QYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQR 417
            LH+   +   ++ G   ++ F+  GG N    LS F   ILE A+N     +  ++ ++ 
Sbjct  139  LHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKEL 198
Query  418  EGVII-------------------SASQEQIRELTRDDSE-------SRRWHI------- 444
            +G I+                      ++Q++++ +D  E       SR W         
Sbjct  199  DGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFG 258
Query  445  -------RRGGESSRGPYNLFN-KRPLYSNKYGQAYEVKPEDYRQLQDMDVSVFIANITQ 496
                    +    S   YNL++ K+  + N YG +  +   +Y  L + D+ V++  ++ 
Sbjct  259  KVNEKIENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSA 318
Query  497  GSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDVHYEQVKARL 556
            GSM+ P  N  S +  +V SG  ++ +  P+      G R               +K ++
Sbjct  319  GSMLAPHVNPISDEYTIVLSGYGELHIGYPN------GSRA--------------MKTKI 358
Query  557  SKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELA 616
             + +  VVP   P   V+S +  L +F F  +A+ N   FLAG   ++L+ +    +  A
Sbjct  359  KQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAA-SLLRTLMGPELSAA 417
Query  617  FAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRSTKQQQPLVSILDF 663
            F      +    ++Q E++ +P       +++   K ++   +I  F
Sbjct  418  FGVSEDTLRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSF 464

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.