The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA
CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP
ADGGSPPPPSTH
Sequence Info Allergen Name Length Opt Bits Score E Value
ANC85008 Art ar 1.0101 132 982 152.7 3.1e-39
ANC85013 Art la 1.0101 132 982 152.7 3.1e-39
ANC85016 Art si 1.0102 132 975 151.7 6.2e-39
ANC85014 Art la 1.0102 132 972 151.2 8.4e-39
ANC85009 Art ar 1.0102 132 972 151.2 8.4e-39
AF493943 Art v 1.0101 132 970 150.9 1e-38
ANC85015 Art si 1.0101 132 969 150.8 1.1e-38
ANC85011 Art gm 1.0101 132 968 150.7 1.3e-38
ANC85010 Art ca 1.0101 132 965 150.2 1.7e-38
ANC85006 Art an 1.0102 132 964 150.1 1.9e-38
AHF71025 Art l 1.0101 108 818 128.8 4e-32
AHF71023 Art c 1.0101 108 812 127.9 7.3e-32
AHF71021 Art ab 1.0101 108 810 127.6 8.9e-32
AHF71024 Art f 1.0101 108 807 127.2 1.2e-31
AHF71026 Art t 1.0101 108 807 127.2 1.2e-31
CBK52317 Amb a 4.0101 164 475 79.3 4.6e-17
A0A0X9C7K4 Par h 1.0101 156 472 78.9 6.1e-17
QUJ17885 Api g 7.0101 93 256 47.2 1.2e-07
Q7M1F3 Aes h 1.0101 50 235 43.7 7.5e-07
XP_015936675 Ara h 12 71 147 31.2 0.0062
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Art ar 1.0101 Sequence ID: ANC85008

 Score = 152.7 bits 982,  Expect = 3e-39
 Identities = 132/132 100%, Positives = 132/132 100%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPSTH
Sbjct  121  ADGGSPPPPSTH 132

Sequence Alignment: 2. Allergen Name: Art la 1.0101 Sequence ID: ANC85013

 Score = 152.7 bits 982,  Expect = 3e-39
 Identities = 132/132 100%, Positives = 132/132 100%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPSTH
Sbjct  121  ADGGSPPPPSTH 132

Sequence Alignment: 3. Allergen Name: Art si 1.0102 Sequence ID: ANC85016

 Score = 151.7 bits 975,  Expect = 6e-39
 Identities = 130/132 98%, Positives = 132/132 100%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIF+LAIGEIEAAGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFVLAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPSTH
Sbjct  121  ADGGSPPPPSTH 132

Sequence Alignment: 4. Allergen Name: Art la 1.0102 Sequence ID: ANC85014

 Score = 151.2 bits 972,  Expect = 8e-39
 Identities = 130/132 98%, Positives = 131/132 99%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGA+PPPAAGGSP PPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGASPPPAAGGSPPPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPSTH
Sbjct  121  ADGGSPPPPSTH 132

Sequence Alignment: 5. Allergen Name: Art ar 1.0102 Sequence ID: ANC85009

 Score = 151.2 bits 972,  Expect = 8e-39
 Identities = 130/132 98%, Positives = 131/132 99%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGA+PPPAAGGSP PPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGASPPPAAGGSPPPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPSTH
Sbjct  121  ADGGSPPPPSTH 132

Sequence Alignment: 6. Allergen Name: Art v 1.0101 Sequence ID: AF493943

 Score = 150.9 bits 970,  Expect = 1e-38
 Identities = 129/132 97%, Positives = 131/132 99%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIFI+AIGE+EAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
             DGGSPPPPSTH
Sbjct  121  VDGGSPPPPSTH 132

Sequence Alignment: 7. Allergen Name: Art si 1.0101 Sequence ID: ANC85015

 Score = 150.8 bits 969,  Expect = 1e-38
 Identities = 130/132 98%, Positives = 131/132 99%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPS H
Sbjct  121  ADGGSPPPPSGH 132

Sequence Alignment: 8. Allergen Name: Art gm 1.0101 Sequence ID: ANC85011

 Score = 150.7 bits 968,  Expect = 1e-38
 Identities = 129/132 97%, Positives = 130/132 98%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIF+LAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFLLAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPA GGSP PPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPATGGSPPPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPSTH
Sbjct  121  ADGGSPPPPSTH 132

Sequence Alignment: 9. Allergen Name: Art ca 1.0101 Sequence ID: ANC85010

 Score = 150.2 bits 965,  Expect = 2e-38
 Identities = 129/132 97%, Positives = 130/132 98%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSP PPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPPPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPS H
Sbjct  121  ADGGSPPPPSAH 132

Sequence Alignment: 10. Allergen Name: Art an 1.0102 Sequence ID: ANC85006

 Score = 150.1 bits 964,  Expect = 2e-38
 Identities = 128/132 96%, Positives = 130/132 98%, Gaps = 0/132 0%
Query  1    MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGA 60
            MAKCSYVFCAVLLIF+LAIGEIEAAGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGA
Sbjct  1    MAKCSYVFCAVLLIFVLAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGA 60
Query  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPP 120
            CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSP PPADGGSPPPPADGGSPP
Sbjct  61   CHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPPPPADGGSPPPPADGGSPP 120
Query  121  ADGGSPPPPSTH 132
            ADGGSPPPPS H
Sbjct  121  ADGGSPPPPSAH 132

Sequence Alignment: 11. Allergen Name: Art l 1.0101 Sequence ID: AHF71025

 Score = 128.8 bits 818,  Expect = 4e-32
 Identities = 106/108 98%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
            AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPPADGGSPPPPSTH
Sbjct  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSTH 108

Sequence Alignment: 12. Allergen Name: Art c 1.0101 Sequence ID: AHF71023

 Score = 127.9 bits 812,  Expect = 7e-32
 Identities = 105/108 97%, Positives = 106/108 98%, Gaps = 0/108 0%
Query  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132
            TPAPPGAAPPPAAGGSP PPADGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  61   TPAPPGAAPPPAAGGSPPPPADGGSPPPPADGGSPPADGGSPPPPSAH 108

Sequence Alignment: 13. Allergen Name: Art ab 1.0101 Sequence ID: AHF71021

 Score = 127.6 bits 810,  Expect = 9e-32
 Identities = 104/108 96%, Positives = 107/108 99%, Gaps = 0/108 0%
Query  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132
            TPAPPGA+PPPAAGGSP PPADGG+PPPPADGGSPPADGGSPPPPSTH
Sbjct  61   TPAPPGASPPPAAGGSPPPPADGGTPPPPADGGSPPADGGSPPPPSTH 108

Sequence Alignment: 14. Allergen Name: Art f 1.0101 Sequence ID: AHF71024

 Score = 127.2 bits 807,  Expect = 1e-31
 Identities = 104/108 96%, Positives = 105/108 97%, Gaps = 0/108 0%
Query  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSAH 108

Sequence Alignment: 15. Allergen Name: Art t 1.0101 Sequence ID: AHF71026

 Score = 127.2 bits 807,  Expect = 1e-31
 Identities = 104/108 96%, Positives = 105/108 97%, Gaps = 0/108 0%
Query  25   AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 84
            AGSKLCEKTSKT+SGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA
Sbjct  1    AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGA 60
Query  85   TPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPADGGSPPPPSTH 132
            TPAPPGAAPPPAAGGSP PP DGGSPPPPADGGSPPADGGSPPPPS H
Sbjct  61   TPAPPGAAPPPAAGGSPPPPTDGGSPPPPADGGSPPADGGSPPPPSAH 108

Sequence Alignment: 16. Allergen Name: Amb a 4.0101 Sequence ID: CBK52317

 Score = 79.3 bits 475,  Expect = 5e-17
 Identities = 70/114 61%, Positives = 84/114 73%, Gaps = 10/114 8%
Query  10   AVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNK---KCDKKCIEWEKAQHGACHKREA 66
            A LL+F+LAI EI +   KLCEK S T+SGKC  K   KCDK+CIEWE A+HGACHKR++
Sbjct  3    AGLLVFVLAISEIASVKGKLCEKPSVTWSGKCKVKQTDKCDKRCIEWEGAKHGACHKRDS 62
Query  67   GKESCFCYFDCSKSP-PGATP-APPGAAP---PPAAGGSPSPPA-DGGSPPPPADGGSPP 120
             K +CFCYFDC  +  PG  P AP G AP   PP+ GG+P P   +GG  PPP +GG   
Sbjct  63   -KATCFCYFDCDPTKNPGPPPGAPKGKAPAPSPPSGGGAPPPSGGEGGDGPPPPEGGEGG 121
Query  121  ADGG 124
             DGG
Sbjct  122  GDGG 125

Sequence Alignment: 17. Allergen Name: Par h 1.0101 Sequence ID: A0A0X9C7K4

 Score = 78.9 bits 472,  Expect = 6e-17
 Identities = 68/126 53%, Positives = 85/126 67%, Gaps = 12/126 9%
Query  1    MAKCSYVFCA-VLLIFILAIGEIEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQH 58
            MAK S  +   +LL++++AI EI +   K+CEK SKT+ G C D +KCDK+C+EWE A+H
Sbjct  1    MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDKRCMEWEGAKH 60
Query  59   GACHKREAGKESCFCYFDCSKS-----PPGATPAPPGAAPPPAAGGSPSPPADGGSPPPP 113
            GACH+RE+ K  CFCYFDC        PPGA P  PG  P P  GG    P  GG+PPP 
Sbjct  61   GACHQRES-KYMCFCYFDCDPKKNPGPPPGA-PGTPGTPPAPPGGGEGDAPPGGGAPPPA 118
Query  114  AD---GGSPPADGGSPPP 128
                 GG     GG+PPP
Sbjct  119  GGEGGGGGGEGGGGAPPP 136

Sequence Alignment: 18. Allergen Name: Api g 7.0101 Sequence ID: QUJ17885

 Score = 47.2 bits 256,  Expect = 1e-07
 Identities = 41/72 56%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  5    SYVFCAVLLIFILA---IGEIEAAGSK----------LCEKTSKTYSGKCDN-KKCDKKC 50
            S  + A++L+F++A   +G  + A +           LCEK S+T++GKC N K CD +C
Sbjct  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
Query  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93

Sequence Alignment: 19. Allergen Name: Aes h 1.0101 Sequence ID: Q7M1F3

 Score = 43.7 bits 235,  Expect = 7e-07
 Identities = 31/48 64%, Positives = 37/48 77%, Gaps = 3/48 6%
Query  29   LC-EKTSKTYSGKCDNK-KCDKKCIEWEKAQHGACHKREAGKESCFCYFDC 77
            LC E+ S+T+SG C N   CDK+C +WEKA HGACHKRE     CFCYF+C
Sbjct  1    LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRE-NHWKCFCYFNC 50

Sequence Alignment: 20. Allergen Name: Ara h 12 Sequence ID: XP_015936675

 Score = 31.2 bits 147,  Expect = 0.006
 Identities = 23/65 35%, Positives = 32/65 49%, Gaps = 6/65 9%
Query  8    FCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKC-DNKKCDKKCIEWEKAQHGACHKREA 66
            FC  +L++ LA   +    +KLC   + TY G C  N  CD  C   E    G C K   
Sbjct  6    FCIFFLVLFLAQEGVVKTEAKLCNHLADTYRGPCFTNASCDDHCKNKEHFVSGTCMK--- 62
Query  67   GKESCFCYFDC 77
               +C+C  +C
Sbjct  63   --MACWCAHNC 71

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.