The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQ
QFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGS
REQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLD
QNPRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARK
VRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEA
DFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARV
QIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSP
LRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA
Sequence Info Allergen Name Length Opt Bits Score E Value
AAO38859 Ber e 2 465 3099 712.7 1e-206
Q9AUD2 Ses i 7.0101 497 1488 345.5 3.8e-96
DQ631677 Pis v 2.0201 472 1447 336.1 2.3e-93
DQ631676 Pis v 2.0101 496 1391 323.3 1.7e-89
AAN76862 Ana o 2 457 1351 314.2 8.7e-87
P13744 Cuc ma 4.0101 480 1334 310.4 1.4e-85
QYS16039 Zan b 2.03 389 1269 295.6 3.1e-81
QYU76046 Zan b 2.0102 388 1228 286.3 2e-78
QYU76045 Zan b 2.0101 389 1217 283.7 1.1e-77
QYU76044 Zan b 2.02 383 1208 281.7 4.6e-77
EU410073 Pis v 5.0101 473 1082 252.9 2.6e-68
Q9XHP0 Ses i 6.0101 459 980 229.7 2.5e-61
Q2TLW0 Sin a 2.0101 510 948 222.4 4.5e-59
Q9XFM4 Fag e 1 538 790 186.3 3.3e-48
BAA21758 Fag e 1 565 781 184.3 1.4e-47
ADN39441 Pru du 6.0201 504 723 171.1 1.2e-43
ABW86978 Car i 4.0101 505 710 168.1 9.5e-43
Q2TPW5 Jug r 4.0101 507 709 167.9 1.1e-42
BAA21760 Fag e 1 504 703 166.5 2.9e-42
A0A1L6K371 Jug n 4.0101 510 701 166.1 4e-42
AAL73404 Cor a 9 515 692 164.0 1.7e-41
ADN39440 Pru du 6.0101 551 687 162.8 4e-41
3EHK_A Pru du 6 531 680 161.3 1.1e-40
P09800 Gos h 4 516 678 160.8 1.5e-40
P09802 Gos h 3 509 633 150.6 1.8e-37
Q7GC77 Gly m 6.0501 517 568 135.7 5.4e-33
Q9SB11 Gly m 6.0401 563 565 135.0 9.6e-33
P04776 Gly m 6.0101 495 510 122.5 4.9e-29
AAA33966 Gly m glycinin G1 495 510 122.5 4.9e-29
P11828 Gly m 6.0301 481 501 120.5 2e-28
P04405 Gly m 6.0201 485 501 120.5 2e-28
CAA68460 Gly m glycinin G2 485 501 120.5 2e-28
O82580 Ara h 3 507 482 116.1 4.2e-27
AAC63045 Ara h 3 510 482 116.1 4.2e-27
AAD47382 Ara h 4 530 457 110.4 2.3e-25
AAF18269 Jug r 2 593 151 40.7 0.00026
B3STU4 Car i 2.0101 792 153 41.1 0.00026
AAM54366 Jug n 2 481 142 38.6 0.00085
AAB01374 Gly m conglycinin 639 134 36.8 0.0041
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 712.7 bits 3099,  Expect = 1e-206
 Identities = 465/465 100%, Positives = 465/465 100%, Gaps = 0/465 0%
Query  1    MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQ 60
            MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQ
Sbjct  1    MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQ 60
Query  61   QFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGS 120
            QFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGS
Sbjct  61   QFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGS 120
Query  121  REQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLD 180
            REQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLD
Sbjct  121  REQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLD 180
Query  181  QNPRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARK 240
            QNPRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARK
Sbjct  181  QNPRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARK 240
Query  241  VRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEA 300
            VRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEA
Sbjct  241  VRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEA 300
Query  301  DFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARV 360
            DFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARV
Sbjct  301  DFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARV 360
Query  361  QIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSP 420
            QIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSP
Sbjct  361  QIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSP 420
Query  421  LRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465
            LRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA
Sbjct  421  LRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465

Sequence Alignment: 2. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 345.5 bits 1488,  Expect = 4e-96
 Identities = 223/426 52%, Positives = 311/426 73%, Gaps = 12/426 2%
Query  30   ECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPK 89
            +CR++RLTAQEP  R+E+EAG++E WD  +QQF CAGVAA+RN I+P+GLLLP Y NAP+
Sbjct  48   DCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLPHYNNAPQ 107
Query  90   LYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIP 149
            L YV +GRGI G ++PGC ETF+  +Q      +++ R RF D+HQKV ++++GDI+A+P
Sbjct  108  LLYVVRGRGIQGTVIPGCAETFERDTQ-----PRQDRRRRFMDRHQKVRQFRQGDILALP 162
Query  150  AGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRSQKQRGERYGLRGGQ 209
            AG+ LW YN+G E L+TV +  T +  NQLDQ  RHFFLAGN Q  ++    R      Q
Sbjct  163  AGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGNPQGGRQSYFGRPQTEK-Q 221
Query  210  QILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREE 269
            Q    N+F GF+ E LAD   FG+D +TAR+++G+DD RG IVR E+ L ++ P    EE
Sbjct  222  QGETKNIFNGFDDEILADA--FGVDVQTARRLKGQDDLRGRIVRAER-LDIVLPGEEEEE 278
Query  270  -LEQQEGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSA 328
              E+    G NGLEET+C+A + +N+D PA AD YNP  GR++++NSL +P+L++L+LSA
Sbjct  279  RWERDPYSGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSA 338
Query  329  MKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFV 388
             KGVLY N ++AP W LNA+S++Y  RG  R Q+V H G +VFD  +REGQ+++VPQN+V
Sbjct  339  EKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYV 398
Query  389  VVKQAGS-RGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNR 447
            V K+A    G+EW+ F TNDNA+ S  AGR S +R +P  V+  AY++S++EARR+K NR
Sbjct  399  VAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNR 458
Query  448  DEAVLFQPGSR-SRGRAS 464
            +E+ +F   SR S  R+S
Sbjct  459  EESRVFSSTSRYSWPRSS 476

Sequence Alignment: 3. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 336.1 bits 1447,  Expect = 2e-93
 Identities = 233/448 52%, Positives = 322/448 71%, Gaps = 28/448 6%
Query  2    AKLFLLSLGIFLLFHCCLA-IEY-------EQEELYE--CRIQRLTAQEPQYRLEAEAGV 51
            + L+ +SLG +LLFHC +A IE        +Q++ ++  C+IQ L A EP+ R+E+EAGV
Sbjct  4    SSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGV 63
Query  52   SEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF 111
            +E WD  ++Q++CA VA +R+TI+ +GLL+P Y NAP+L YV QG GI G + PGCPETF
Sbjct  64   TEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCPETF 123
Query  112  QSMSQFQGSREQEEERGRFQ---DQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVL 168
            Q  SQ Q SR Q     R Q   +QHQKV H+++GDIIA+PAGVA W YN+G   LV V 
Sbjct  124  QEESQSQ-SRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVA 182
Query  169  VQHTASDLNQLDQNPRHFFLAGNIQRSQKQRGERYGL----RGGQQILADNVFKGFNMEA 224
            +    +  NQLDQ  R F L G+ Q+  +  G+ +      R GQQ  ++N++  F+ E 
Sbjct  183  LADVGNSENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQQ--SNNILSAFDEEI 240
Query  225  LADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNGLEET 284
            LA    F +DT+  +K++ E+ QRG IVRV++ L+V+ P R  +E         NGLEET
Sbjct  241  LAQ--SFNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKEYSD------NGLEET 292
Query  285  ICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWR 344
             C+ T+  NI++P+ AD YNPR GR+T++N+L +PIL FLQLS  KGVLY+NA+MAP W 
Sbjct  293  FCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPHWN 352
Query  345  LNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFN 404
            +NA+S+VY  RG  R+QIV   GE+VFD+ +REGQ+VVVPQNF VVK+A S GFEWV F 
Sbjct  353  MNAHSIVYITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGFEWVSFK 412
Query  405  TNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSR 460
            TN  A  S  AGR S +RG+P+ V+ N++ +S+E+A  +K +R E  +F PGSRS+
Sbjct  413  TNGLAKISQLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQ 468

Sequence Alignment: 4. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 323.3 bits 1391,  Expect = 2e-89
 Identities = 226/459 49%, Positives = 326/459 71%, Gaps = 25/459 5%
Query  2    AKLFLLSLGIFLLFHCCLA-IEY-------EQEELYE--CRIQRLTAQEPQYRLEAEAGV 51
            + L+ +SLG +LLFHC +A IE        +Q++ ++  C+IQ L A EP+ R+E+EAGV
Sbjct  4    SSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGV 63
Query  52   SEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF 111
            +E WD  ++Q++CA VA +R+TI+ +GLL+P Y NAP+L YV QG GI G + PGCPETF
Sbjct  64   TEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCPETF 123
Query  112  QSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQH 171
            Q  SQ +   E+ ++ G   +QHQKV  +++GD+IA+PAGVA W YN+G   LV V +  
Sbjct  124  QEESQSRSRSERSQQSG---EQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALAD 180
Query  172  TASDLNQLDQNPRHFFLAGNIQR------SQKQRGERYGLRGGQQ-ILADNVFKGFNMEA 224
              +  NQLDQ  R F L G+ Q+        + R +    R GQQ   ++N++  F+ E 
Sbjct  181  VGNSENQLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNILSAFDEEI 240
Query  225  LADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELE---QQEGGGYNGL 281
            LA    F +DT+ AR+++ E  QRG IVRV++ L+V+ P R  +E E   ++E    NGL
Sbjct  241  LAQ--SFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPHRQEQEQEYEEERERRQRNGL 298
Query  282  EETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAP 341
            EET C+ T+  NI++P+ AD YNPR GR+++VN+L +PIL FLQLSA KGVL+ +A++AP
Sbjct  299  EETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAKKGVLHRDAILAP 358
Query  342  LWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWV 401
             W +NA+S+VY  RG  R+QIV   GE+VFD+ +REGQ+VVVPQNF VVK+A S  FEWV
Sbjct  359  HWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDKFEWV 418
Query  402  VFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRG 461
             F TN  +  S  AGR S +R +P+ V+ N++ +S+E+ARR+K +R E  +F PGS S+ 
Sbjct  419  SFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARRLKESRSETTIFAPGSSSQR 478
Query  462  RASA 465
            ++ +
Sbjct  479  KSQS 482

Sequence Alignment: 5. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 314.2 bits 1351,  Expect = 9e-87
 Identities = 230/445 51%, Positives = 316/445 71%, Gaps = 26/445 5%
Query  7    LSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAG 66
            LS+  ++LFH CLA   E ++  EC+I RL A EP  R+E EAG  E WD   +QFRCAG
Sbjct  1    LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG 60
Query  67   VAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQEEE 126
            VA +R+TI+P GLLLP Y+NAP+L YV QG G+ G+  PGCPET+Q+    QG   Q+ +
Sbjct  61   VALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQ--QG--RQQGQ 116
Query  127  RGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHF 186
             GRFQD+HQK+  +++GDIIAIPAGVA WCYN+G+  +VTV +   ++  NQLD+ PR F
Sbjct  117  SGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKF 176
Query  187  FLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDD 246
             LAGN  +   Q+ +++  RG       N+F GF+ E LA+   F +D    ++++ ED+
Sbjct  177  HLAGN-PKDVFQQQQQHQSRG------RNLFSGFDTELLAE--AFQVDERLIKQLKSEDN 227
Query  247  QRGHIVRVEQG-LKVIRPPRIR--------EELEQQE---GGGYNGLEETICSATFIQNI 294
             RG IV+V+   L+VIRP R +        EE E ++   G   NG+EETIC+  + +NI
Sbjct  228  -RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENI 286
Query  295  DNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAV 354
            ++PA AD Y P  GRLTT+NSL +PIL +LQLS  KGVLY+NA++ P W LN++S++Y  
Sbjct  287  NDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGC 346
Query  355  RGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTA 414
            +G+ +VQ+VD+ G  VFD  +REGQM+VVPQNF VVK+A    FEW+ F TND A+ S  
Sbjct  347  KGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPL 406
Query  415  AGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465
            AGRTS L G+P  VLANA+++S+E+AR+IK+N  +  L    S    R  A
Sbjct  407  AGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA 457

Sequence Alignment: 6. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 310.4 bits 1334,  Expect = 1e-85
 Identities = 205/422 48%, Positives = 296/422 70%, Gaps = 19/422 4%
Query  31   CRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKL 90
            CR++ L AQ+P  R EAEA  +EVWD  + +F+CAGV  +R+TIRP+GLLLP ++NAPKL
Sbjct  48   CRLENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKL 107
Query  91   YYVTQGRGILGVLMPGCPETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPA 150
             +V QG GI G+ +PGC ET+Q+       R  +     F+DQHQK+  +++GD++ +PA
Sbjct  108  IFVAQGFGIRGIAIPGCAETYQT-----DLRRSQSAGSAFKDQHQKIRPFREGDLLVVPA 162
Query  151  GVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRSQKQRG----ERYGLR 206
            GV+ W YN G  DLV ++   T +  NQ+D   R F+LAG  +  Q +RG    ER   +
Sbjct  163  GVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPE--QVERGVEEWERSSRK 220
Query  207  GGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRI 266
            G     + N+F GF  E L +   F +D    RK++GEDD+R  IV+V++ ++V+ P + 
Sbjct  221  GSSGEKSGNIFSGFADEFLEEA--FQIDGGLVRKLKGEDDERDRIVQVDEDFEVLLPEKD 278
Query  267  REELE-----QQEGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPIL 321
             EE       + E    NGLEETIC+  + QNI     AD +NPR GR++T N   +PIL
Sbjct  279  EEERSRGRYIESESESENGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPIL 338
Query  322  TFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMV 381
              ++LSA +GVLY NAM+AP + +N++SV+YA RG ARVQ+VD+ G++VFD  +REGQ++
Sbjct  339  RQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVREGQVL 398
Query  382  VVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEAR 441
            ++PQNFVV+K+A  RGFEW+ F TNDNA+ +  AGR S +R +P+GVL+N YR+S+EEA+
Sbjct  399  MIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLSNMYRISREEAQ 458
Query  442  RIKLNRDEAVLFQPGSRSRGR 462
            R+K  + E  ++ PG RS+GR
Sbjct  459  RLKYGQQEMRVLSPG-RSQGR 478

Sequence Alignment: 7. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 295.6 bits 1269,  Expect = 3e-81
 Identities = 193/382 50%, Positives = 262/382 68%, Gaps = 9/382 2%
Query  48   EAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGC 107
            EAGV+E WD  +QQ++CA VA +R+ I+  GLL+P YTN P+L+YV QGRGI G ++PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  108  PETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTV 167
            PET+Q   Q Q S     E  R QDQHQKV ++++GDIIA+P G A W YN+G   LV V
Sbjct  61   PETYQDEQQQQQSFSYPSEGSRSQDQHQKVRQIREGDIIALPTGSAHWIYNNGQSQLVLV 120
Query  168  LVQHTASDLNQLDQNPRHFFLAGN----IQRSQKQRGERYGLR--GGQQIL-ADNVFKGF 220
             +    +  NQLDQ  R F+L GN    +Q + + +G RY  R  GG     + N+F GF
Sbjct  121  ALVDVGNSDNQLDQYFRKFYLGGNPQPQLQGTSQSQGGRYQERLGGGDSSRRSANIFNGF 180
Query  221  NMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNG 280
            +   LA+   F ++ E  R+++    QRG I+RVE+ ++V+ P R +E  E    G YNG
Sbjct  181  DERLLAEA--FNVNPELIRRLQRPQMQRGIIIRVEEEFRVLTPQRGQESYESDPYGRYNG 238
Query  281  LEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMA 340
            +EET+C+  + +NI++P+ AD YNPRAGR+TTVN L +P+L +LQLSA KG LY+NA+ A
Sbjct  239  VEETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGNLYKNALTA 298
Query  341  PLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEW 400
            P W LNA+S+VY  RG  RVQIV   G  VFD  +REGQ++VVPQ F VVK+A +RG+EW
Sbjct  299  PHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVKRASNRGLEW 358
Query  401  VVFNTNDNALFSTAAGRTSPLRGIPVGVLAN 431
            + F TND A+ +  AGR S LR +P+ V+ N
Sbjct  359  ISFKTNDYAMTNQLAGRVSVLRALPLDVIQN 389

Sequence Alignment: 8. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 286.3 bits 1228,  Expect = 2e-78
 Identities = 187/379 49%, Positives = 261/379 68%, Gaps = 14/379 3%
Query  48   EAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGC 107
            EAGV+E WD  ++Q++CA VA +R+ I+ +GLL+P YTN  +L+YV QGRGI G + PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  108  PETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTV 167
            PET+Q   Q Q    ++ E  R QDQHQKV +L++GDI+A+P G A W YN+G   LV V
Sbjct  61   PETYQDQQQQQS---HQSEGSRSQDQHQKVRQLREGDIVAMPTGSAHWIYNNGQSQLVLV 117
Query  168  LVQHTASDLNQLDQNPRHFFLAGNIQR-----SQKQRGERY----GLRGGQQILADNVFK 218
             +    +  NQLDQ  R F++ GN Q+     SQ Q    Y    G  G ++    N+F 
Sbjct  118  ALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGGSRRSSGGNIFN 177
Query  219  GFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGY 278
            GF+   LAD   F ++ E  R+++     RG IVRVE+ L+V+RP R  +E EQ+  G  
Sbjct  178  GFDERLLADA--FNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRGEQEQEQEFRGRD 235
Query  279  NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAM 338
            NGLEET C+  + +NI+NP++AD YNPR GR++TVNS+ +P+L ++QLSA KG LY+NA 
Sbjct  236  NGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQ 295
Query  339  MAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGF 398
            +AP W LN++SVVY  RG  RVQIV   G  V+D  ++EGQ++VVPQ + V+K+A ++G+
Sbjct  296  LAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKKASNQGL 355
Query  399  EWVVFNTNDNALFSTAAGRTSPLRGIPVGVLAN 431
            EW+ F TNDNA  S  AGR S +R +P+ V+ N
Sbjct  356  EWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 9. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 283.7 bits 1217,  Expect = 1e-77
 Identities = 187/379 49%, Positives = 264/379 69%, Gaps = 15/379 3%
Query  48   EAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGC 107
            EAGV+E WD  ++Q++CA VA +R+ I+ +GLL+P YTN  +L+YV QGRGI G + PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  108  PETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTV 167
            PET+Q   Q Q    ++ E  R QDQHQKV +L++GDI+A+P G A W YN+G   LV V
Sbjct  61   PETYQDQQQQQS---HQSEGSRSQDQHQKVRQLREGDIVAVPTGSAHWIYNNGQSQLVLV 117
Query  168  LVQHTASDLNQLDQNPRHFFLAGNIQR-----SQKQRGERY-GLRG---GQQILADNVFK 218
             +    +  NQLDQ  R F++ GN Q+     SQ Q    Y G +G    ++    N+F 
Sbjct  118  ALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGSSRRSSGGNIFN 177
Query  219  GFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGY 278
            GF+   LAD   F ++ E  R+++     RG IVRVE+ L+V+RP R +E+ ++QE  G 
Sbjct  178  GFDERLLADA--FNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRGQEQEQEQEFRGR 235
Query  279  -NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENA 337
             NGLEET C+  + +NI+NP++AD YNPR GR++TVNS+ +P+L ++QLSA KG LY+NA
Sbjct  236  DNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNA 295
Query  338  MMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRG 397
             +AP W LN++SVVY  RG  RVQIV   G  V+D  ++EGQ++VVPQ + V+K+A ++G
Sbjct  296  QLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKRASNQG 355
Query  398  FEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLAN 431
            +EW+ F TNDNA  S  AGR S +R +P+ V+ N
Sbjct  356  LEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 10. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 281.7 bits 1208,  Expect = 5e-77
 Identities = 185/376 49%, Positives = 257/376 68%, Gaps = 12/376 3%
Query  48   EAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGC 107
            EAGV+E WD  + Q++CA VA +R+ I+  GLL+P YTN  +L+YV QGRGI G + PGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  108  PETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTV 167
            PET+Q   Q Q  + Q     R QDQHQKV ++++GDIIA+P G A W YN+G   LV V
Sbjct  61   PETYQDQQQQQSYQSQG---SRSQDQHQKVRQIREGDIIALPTGAAHWIYNNGGSQLVLV 117
Query  168  LVQHTASDLNQLDQNPRHFFLAGNIQ-----RSQKQRGERY-GLRGGQQ-ILADNVFKGF 220
             +    +  NQLDQ  R F+L GN Q      SQ+Q+G  Y G +GG       N+F GF
Sbjct  118  ALVDVGNSDNQLDQYFRKFYLGGNPQPELQGTSQRQQGGGYQGSQGGGGGSRRGNMFNGF 177
Query  221  NMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGYNG 280
            +   LAD   F ++ E  R+++    QRG IVRVE+ ++V+ P R +E+ ++QE    NG
Sbjct  178  DERLLADA--FNVNPELIRRLQRPQMQRGIIVRVEEEFRVLSPQRGQEQEQEQEQDCDNG 235
Query  281  LEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMA 340
            +EET C+  + +NI++P+ AD YNPR GR+TTVN + +P+L +LQLSA KG LY+NA+ +
Sbjct  236  VEETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLYQNALTS 295
Query  341  PLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEW 400
            P W LN +S+VY  RG  R+QIV   G  VF+  +REGQ++V+PQ F VVK+A +RG+EW
Sbjct  296  PHWNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKASNRGLEW 355
Query  401  VVFNTNDNALFSTAAGRTSPLRGIPVGV 428
            + F TNDNA+ +  AGR S +R +P+ V
Sbjct  356  IAFKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 11. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 252.9 bits 1082,  Expect = 3e-68
 Identities = 231/459 50%, Positives = 319/459 69%, Gaps = 20/459 4%
Query  1    MAKLFLLSLGIFLL--FHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYT 58
            MA   LLSL + LL  FH CLA   + ++  EC+I +L A EP  R+E EAG+ E WD  
Sbjct  1    MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN 60
Query  59   DQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQ 118
             +QFRCAGVA  R+TI+P GL LP Y+NAP L Y+ +G G+ G L+PGCPET+Q+  Q Q
Sbjct  61   HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQ 120
Query  119  GSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQ 178
                Q  +  RFQD+HQK++ ++KGDIIA+PAGVA WCYN+G+  +VTV +   ++  NQ
Sbjct  121  ----QHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQ 176
Query  179  LDQNPRHFFLAGNIQR--SQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTE 236
            LD  PR F LAGN +    Q+Q+ +  G R  QQ   +N+F GF+ + LA+V  F ++  
Sbjct  177  LDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEV--FQVEQS 234
Query  237  TARKVRGEDDQRGHIVRVEQGLKVIRPPRIR--------EELEQQEG--GGYNGLEETIC 286
              ++++ E D RG IV+V+  L+VIRPPR +        EE E + G  G  NGLEETIC
Sbjct  235  LVKQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYERGRRGRDNGLEETIC 294
Query  287  SATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLN 346
            +  + +NI +P+ +D Y P  GR+T++NSL +PIL +LQLSA +GVL  NA+M P W +N
Sbjct  295  TMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFN 354
Query  347  ANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTN 406
            A+S+VY  +G A+VQ+VD+ G TVFD  + EGQ+ VVPQNF VVK+A  + FEW+ F TN
Sbjct  355  AHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTN 414
Query  407  DNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465
            D A+ S  AG TS LR +P  VLANA+++S+E+AR+IK+N ++  L    S  + R  A
Sbjct  415  DRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQPTLSSGQSSQQMRDDA 473

Sequence Alignment: 12. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 229.7 bits 980,  Expect = 3e-61
 Identities = 189/441 42%, Positives = 298/441 67%, Gaps = 24/441 5%
Query  5    FLLSLGIFLLFHCCLAIEYEQE--ELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQF 62
            FLL+L + LL    +A   E    +  +CR QR++  +P  R+++E G +E+WD   +QF
Sbjct  6    FLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQF 65
Query  63   RCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQ------SMSQ 116
            +CAG+ A+R+TIRP GL LP Y  +P+L Y+ +G+G++ +++PGC ET+Q      +M +
Sbjct  66   QCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMER 125
Query  117  FQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDL 176
             + S +Q+  RG  +D HQKVH L++GDI+AIP+G A WCYNDG EDLV V +       
Sbjct  126  TEASEQQD--RGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLS 183
Query  177  NQLDQNPRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTE 236
            NQLDQ  R F+LAG + RS +Q  +       +Q +  N+F+ F+ E L++   F +  E
Sbjct  184  NQLDQKFRAFYLAGGVPRSGEQEQQ------ARQTF-HNIFRAFDAELLSE--AFNVPQE 234
Query  237  TARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGY--NGLEETICSATFIQNI 294
            T R+++ E+++RG IV   + +  +RP    EE EQ+  G    NGLEET C+  F  N+
Sbjct  235  TIRRMQSEEEERGLIVMARERMTFVRPD--EEEGEQEHRGRQLDNGLEETFCTMKFRTNV 292
Query  295  DNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAV 354
            ++  EAD ++ +AGR+  V+  K+PIL ++ LSA KG LY NA+++P W +  +++VY  
Sbjct  293  ESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVT 352
Query  355  RGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTA 414
            RG+A+VQ+VDH G+ + +D + +G+M VVPQ +    +AG+ GFEWV F T  + + S  
Sbjct  353  RGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPL 412
Query  415  AGRTSPLRGIPVGVLANAYRLSQEEARRIKLNR-DEAVLFQPGSR 458
            AG TS +R +P+ V+ N+Y++S  +A+ +K+NR  ++ L+ PG R
Sbjct  413  AGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGR 457

Sequence Alignment: 13. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 222.4 bits 948,  Expect = 4e-59
 Identities = 200/445 44%, Positives = 300/445 67%, Gaps = 65/445 14%
Query  1    MAKLFLLSLGIFLLFHCCLA---IEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDY 57
            +A L++ ++G++L+++ CLA   +    +    C +  L   +P   +++EAG  E WD+
Sbjct  4    LAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEVIKSEAGQVEYWDH 63
Query  58   TDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF---QSM 114
               Q RCAGV+  R  I+  GL LP + ++P + YV QG GI G ++PGC ETF   Q M
Sbjct  64   NHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDSQPM 123
Query  115  S----QFQGSREQEEERGR-------------------------------FQDQHQKVHH 139
                 Q QG + Q+ ++G+                               F+D HQKV H
Sbjct  124  QGQQGQQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEH 183
Query  140  LKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRSQKQR 199
            ++ GD IA+  G A W YN GD+ L+ V +   A+  NQLD+NPR F LAGN Q+   Q+
Sbjct  184  VRHGDAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGSSQQ 243
Query  200  GERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLK 259
                     QQ    N++ GF+ + LA  L   +D   A++++ + D+RG+IVRV+  ++
Sbjct  244  ---------QQQQQQNILSGFDPQVLAQALK--IDVRLAQELQNQQDKRGNIVRVKGPFQ 292
Query  260  VIRPP-RIREELEQQ-------EGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGRLT 311
            V+RPP R   E EQ        +    NGLEETICS    +NID+PA AD Y P  GR+T
Sbjct  293  VVRPPLRQAYESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRVT 352
Query  312  TVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVF 371
            +VNS  +PIL +++LSA +G+L  +AM+ P + +NAN ++Y  +G+AR+Q+V+  G+ V+
Sbjct  353  SVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNVL 412
Query  372  DDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLAN 431
            D  +++GQ+VV+PQ F  V Q+ +  FEW+ F TN NA+ ST AGRTS LR +P+ V+ N
Sbjct  413  DQQVQKGQLVVIPQGFAYVVQSQN-NFEWISFKTNANAMISTLAGRTSALRALPLEVITN 471
Query  432  AYRLSQEEARRIKLNRDEAVLFQPGSRSRG 461
            AY++S EEAR+IK+N  E  L    +R+RG
Sbjct  472  AYQISLEEARKIKFNTLETTL----TRARG 497

Sequence Alignment: 14. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 186.3 bits 790,  Expect = 3e-48
 Identities = 218/429 50%, Positives = 303/429 70%, Gaps = 59/429 13%
Query  25   QEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVY 84
            Q+  ++C IQRLTA EP  R+ +EAGV+E+WD+   +FRCAG  A+R  I+P GLLLP Y
Sbjct  38   QQFQHQCDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSY 97
Query  85   TNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQEEERGR--------------- 129
            +NAP + +V QGRG+ GV++PGCPETFQS S+F+  R Q ++R R               
Sbjct  98   SNAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESSRGDQRSR 157
Query  130  ---------------------FQ--DQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVT 166
                                 F   DQHQK+  ++ GD+I  PAGV  W +N+GD DL++
Sbjct  158  QSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLIS 217
Query  167  VLVQHTASDLNQLDQNPRHFFLAGNIQ------RSQKQRGERYGLRGGQQ------ILAD 214
            + +    S  NQLD+N R+FFLAG  +      RSQ+Q  E    R  ++      +L  
Sbjct  218  ITLYDANSFQNQLDENVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESQDDEALLEA 277
Query  215  NVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQE 274
            N++ GF  E L +++   +D ET  K+RGE+DQRG IV+  + LK+  P    EEL+++ 
Sbjct  278  NILSGFEDEILQEIFR-NVDQETISKLRGENDQRGFIVQA-RDLKLRVPEEYEEELQRER 335
Query  275  G----GGY---NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLS 327
            G    GG    NGLE+  C+  F QN++ P+ AD +NPRAGR+ TV+S  +PIL F+QLS
Sbjct  336  GDRKRGGSGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLS 395
Query  328  AMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNF 387
            A   VLY+NA++ P W LNA+S +Y  RGE RVQ+V   G +VFDDN++ GQ++VVPQ F
Sbjct  396  AQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGF 455
Query  388  VVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNR 447
             VV +AG  G+EWV +  +DNA+ S  AG+TS LR IPV VLAN+Y +S +EA R+K  R
Sbjct  456  AVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGR 515
Query  448  DEAVLFQP 455
             E  +F+P
Sbjct  516  QEVEVFRP 523

Sequence Alignment: 15. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 184.3 bits 781,  Expect = 1e-47
 Identities = 221/429 51%, Positives = 301/429 70%, Gaps = 89/429 20%
Query  25   QEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVY 84
            Q+  ++C +QRLTA EP  R+ +EAGV+E+WD    +FRCAG  A+R  I+P GLLLP Y
Sbjct  38   QQFHHQCDVQRLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSY 97
Query  85   TNAPKLYYVTQGRGILGVLMPGCPETFQSMSQF--------QGSREQEEE---RG----- 128
            +NAP + +V QGRG+ GV++PGCPETFQS S+F        Q SR+ E E   RG     
Sbjct  98   SNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESSRGDQRTR 157
Query  129  -----RFQ-----------------------------------------------DQHQK 136
                  F                                                DQHQK
Sbjct  158  QSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQHQK 217
Query  137  VHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQ--- 193
            +  ++ GD+I  PAGV  W +NDGD DL+++ +    S  NQLD N R+FFLAG  +   
Sbjct  218  IFRIRDGDVIPSPAGVVQWTHNDGDNDLISITLYDANSFQNQLDGNVRNFFLAGQSKQSR 277
Query  194  ---RSQKQRGERYGLRGGQQ------ILADNVFKGFNMEALADVLGFGMDTETARKVRGE 244
               RSQ+Q  E    R  ++      +L  N++ GF  E L +++   +D ET  K+RG+
Sbjct  278  EDRRSQRQTREEGSDRQSRESDDDEALLEANILTGFQDEILQEIFR-NVDQETISKLRGD 336
Query  245  DDQRGHIVRVEQGLKVIRPPRIREELEQQEG----GGY---NGLEETICSATFIQNIDNP 297
            +DQRG IV+  + LK+  P    EEL+++ G    GG    NGLE+  C+  F QN++ P
Sbjct  337  NDQRGFIVQA-RDLKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRP 395
Query  298  AEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGE 357
            + AD +NPRAGR+ TVNS  +PIL F+QLSA   VLY+NA++ P W LNA+S +Y  RGE
Sbjct  396  SRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGE 455
Query  358  ARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGR 417
             RVQ+V   G +VFDDN++ GQ++VVPQ F VV +AG  G+EWV +  +DNA+ S  AG+
Sbjct  456  GRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGK 515
Query  418  TSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQP 455
            TS LR IPV VLAN+Y +S +EA R+K  R E  +F P
Sbjct  516  TSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLP 553

Sequence Alignment: 16. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 171.1 bits 723,  Expect = 1e-43
 Identities = 227/448 50%, Positives = 320/448 71%, Gaps = 52/448 11%
Query  11   IFLLFHCCLAIE---YEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGV 67
            ++LLF+ CLA     + Q +  E ++ +L A+EP   +++EAGV+E W+ +D QF+ AGV
Sbjct  2    LLLLFNGCLASRQHIFGQNK--EWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGV 59
Query  68   AALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF-----------QSMSQ 116
            A +R TI P GL LP Y NAP+L Y+ +GRG+LG + PGC ETF           Q   Q
Sbjct  60   AVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQ 119
Query  117  FQGSRE-----QEEERGR-FQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQ 170
            F+ SR+     Q++ +G   QD+HQK+ H+++GDIIA+PAGVA W YN+G++ LV V + 
Sbjct  120  FRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLL 179
Query  171  HTASDLNQLDQNPRHFFLAGNIQ---RSQKQRGERYGLRGGQQILADNVFKGFNMEALAD 227
               +D NQLDQ PR F+LAGN Q     Q+Q  ++   + GQQ   +N+F GF+ + LA 
Sbjct  180  DLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQ 239
Query  228  VLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRP--------------------PRIR 267
             L   ++ ETAR ++G+DD R  IVRV+  L  + P                     R R
Sbjct  240  ALN--VNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQRER 297
Query  268  EE----LEQQEGGGY-NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILT 322
            EE     EQQ GGG  NG+EET CSA + QNI +P+ ADFYNP+ GR++ VN   +PIL 
Sbjct  298  EEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILR 357
Query  323  FLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVV 382
            +L+LSA KGVLY NA+  P W  NAN++VYA+RG ARVQ+V+  G+ ++DD +REGQ+ +
Sbjct  358  YLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFL 417
Query  383  VPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARR 442
            +PQN  V+ QA + GFE++ F T++N + +T AGRTS LR +P  VL NA+R+S++EAR 
Sbjct  418  IPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARN 477
Query  443  IKLNRDEAVLFQPGSRSRGR 462
            +K NR E+ L+   S  RGR
Sbjct  478  LKYNRQESRLLSATSPPRGR 497

Sequence Alignment: 17. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 168.1 bits 710,  Expect = 9e-43
 Identities = 256/454 56%, Positives = 338/454 74%, Gaps = 47/454 10%
Query  1    MAKLFLLSLGIFL----LFHCCLAIE--YEQEELYECRIQRLTAQEPQYRLEAEAGVSEV 54
            MAK  LLS+ + L    LF+ CLA     +Q ++ +C++ RL A EP  R+EAEAGV E 
Sbjct  1    MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIES 60
Query  55   WDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSM 114
            WD   QQ++CAGVA +R TI P GLLLP Y+NAP+L Y+ +GRGI GVL PGCPETF+  
Sbjct  61   WDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEE- 119
Query  115  SQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTAS 174
            SQ Q  + Q  E    QD+HQK+ H+++GDIIA PAGVA WCYNDG   +V +++  T +
Sbjct  120  SQRQSQQGQRREFQ--QDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHN 177
Query  175  DLNQLDQNPRHFFLAGNI--------------QRSQKQRGERYGLRGGQQI-LADNVFKG 219
            + NQLDQNPR+F+LAGN               +R Q+Q  +R G  G QQ  L +NVF G
Sbjct  178  NANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSG 237
Query  220  FNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVE-QGLKVIRPPRIREELEQQEG--- 275
            F+ E LAD   F +DTETAR+++ E+D+RG IVRVE + L+VIRP   REE E++E    
Sbjct  238  FDAEFLAD--AFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEERKER 295
Query  276  ---------------GGY--NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKV 318
                           GG   NGLEETIC+ ++ +NI +P+ AD Y   AGR++TVNS  +
Sbjct  296  ERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSHNL 355
Query  319  PILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREG 378
            PIL +LQLSA +G LY +A+  P W LNA+SVVYA+RG A VQ+VD+ G+TVFDD LREG
Sbjct  356  PILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREG 415
Query  379  QMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQE 438
            Q++ +PQNF VVK+A   GFEWV F TN+NA+ S  AGRTS +R +P  VL NA+++ +E
Sbjct  416  QLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPRE 475
Query  439  EARRIKLNRDEAVLFQPGSRS 459
            +ARR+K+NR E+ L +  SRS
Sbjct  476  DARRLKFNRQESTLVRSRSRS 496

Sequence Alignment: 18. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 167.9 bits 709,  Expect = 1e-42
 Identities = 258/457 56%, Positives = 343/457 75%, Gaps = 49/457 10%
Query  1    MAKLFLLSLGIFL---LFHCCLAIE--YEQEELYECRIQRLTAQEPQYRLEAEAGVSEVW 55
            MAK  LLS+ +FL   LF+ CLA     +Q+++ +C++ RL A EP  R+EAEAGV E W
Sbjct  1    MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRIEAEAGVIESW 60
Query  56   DYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMS 115
            D  +QQF+CAGVA +R TI P GLLLP Y+NAP+L Y+ +GRGI GVL PGCPETF+  S
Sbjct  61   DPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFEE-S 119
Query  116  QFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASD 175
            Q Q  + Q  E    QD+HQK+ H+++GDIIA PAGVA W YNDG   +V + +  T ++
Sbjct  120  QRQSQQGQSREFQ--QDRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNN 177
Query  176  LNQLDQNPRHFFLAGNI--------------QRSQKQRGERYGLRGGQQI-LADNVFKGF 220
             NQLDQNPR+F+LAGN               +R Q+QR +R G  G QQ  L +NVF GF
Sbjct  178  ANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGF 237
Query  221  NMEALADVLGFGMDTETARKVRGEDDQRGHIVRVE-QGLKVIRPPRIREELEQQEG---- 275
            + + LAD   F +DTETAR+++ E+D+R  IVRVE + L+VIRP   REE E++E     
Sbjct  238  DADFLADA--FNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERE 295
Query  276  --------------GGY--NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVP 319
                          GG   NGLEETIC+  + +NI +P+ AD Y   AGR++TVNS  +P
Sbjct  296  RERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLP 355
Query  320  ILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQ 379
            +L +LQLSA +G LY +A+  P W LNA+SVVYA+RG A VQ+VD+ G+TVFDD LREGQ
Sbjct  356  VLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQ 415
Query  380  MVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEE 439
            ++ +PQNF VVK+A + GFEWV F TN+NA+ S  AGRTS +R +P  VLA A+++ +E+
Sbjct  416  LLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPRED 475
Query  440  ARRIKLNRDEAVLFQPGSR-SRGRAS 464
            ARR+K+NR E+ L +  SR SR R+S
Sbjct  476  ARRLKFNRQESTLVR--SRPSRSRSS 499

Sequence Alignment: 19. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 166.5 bits 703,  Expect = 3e-42
 Identities = 212/424 50%, Positives = 289/424 68%, Gaps = 25/424 5%
Query  29   YECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAP 88
            ++C IQRLTA EP  R+ +EAGV+E+WD+   +FRC G  A+R  I+P GLLLP Y+NAP
Sbjct  44   HQCDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYSNAP 103
Query  89   KLYYVTQGRGILGVLMPGCPETFQSMSQF---QGSR-------EQEEERGRFQDQHQKVH 138
             + +V QGRG+ GV++PGCPETFQS S+F   Q  R       E EEE  R  DQHQK+ 
Sbjct  104  YITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEEESSR-GDQHQKIF 162
Query  139  HLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRSQKQ 198
             +++GD+I  PAGV  W +NDG++DL++V +    S   QLD+N R FFLAG  QR  ++
Sbjct  163  RIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRETRE 222
Query  199  RGERYGLR---GGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVE 255
             G     R     + +L  N++ GF  E L +++   +D ET  K+RGE+DQRG IV+  
Sbjct  223  EGSDRQSRESDDDEALLGANILSGFQDEILHELFR-DVDRETISKLRGENDQRGFIVQA- 280
Query  256  QGLKVIRPPRIREELEQQEG------GGY---NGLEETICSATFIQNIDNPAEADFYNPR 306
            Q LK+  P    EE E++ G      GG    NG+E+  C+  F +N + P     +NPR
Sbjct  281  QDLKLRVPQDFEEEYERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPR 340
Query  307  AGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHR 366
            AGR+ TVNS  +PIL FLQLSA   VLY+NA++ P W LNA+S +Y  RGE RVQ+V   
Sbjct  341  AGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDE 400
Query  367  GETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPV 426
            G++VFDD ++ GQ++VVPQ F VV +AG  G+EWV +  + NA+ S   GRTS LR IPV
Sbjct  401  GKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPV 460
Query  427  GVLANAYRLSQEEARRIKLNRDEAVLFQP 455
             VLAN+Y +S +EA ++K  R E  +F+P
Sbjct  461  EVLANSYDISTKEAYKLKNGRQEVEVFRP 489

Sequence Alignment: 20. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 166.1 bits 701,  Expect = 4e-42
 Identities = 252/461 54%, Positives = 335/461 72%, Gaps = 45/461 9%
Query  1    MAKLFLLSLGIFL--LFHCCLAIE--YEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWD 56
            MAK  LLS+ + L  L + CLA     +Q  + EC+++RL A EP  R+EAEAGV E WD
Sbjct  1    MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESWD 60
Query  57   YTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQ 116
              +QQF+CAGVA +R TI P GLLLP Y+NAP+L Y+ +GRGI GVL PGCPETF+   Q
Sbjct  61   PNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQQ 120
Query  117  FQGSREQEEERGRFQ-DQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASD 175
             Q           FQ D+HQK+ H+++GD+IA PAGVA WCYNDGD  +V V +  T ++
Sbjct  121  GQSRIRPSLRSASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNN 180
Query  176  LNQLDQNPRHFFLAGNI--------------QRSQKQRGERYGLRGGQQILA-DNVFKGF 220
             NQLDQNPR+F+LAGN               +R Q+Q  +R+G  G QQ  + +NVF GF
Sbjct  181  ANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGNNVFSGF 240
Query  221  NMEALADVLGFGMDTETARKVRGEDDQRGHIVRVE-QGLKVIRPPRIREELEQQEG---- 275
            + + LAD   F +DTETAR+++ E+D+R  IVRVE + L+VIRP   REE E++E     
Sbjct  241  DADFLAD--AFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERE 298
Query  276  --------------GGY--NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVP 319
                          GG   NGLEETIC+  + +NI +P+ AD Y   AGR++T NS  +P
Sbjct  299  RERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTANSHTLP 358
Query  320  ILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQ 379
            +L +LQLSA +G LY +A+  P W LNA+SVVYA+RG A VQ+VD+ G+TVFDD LREGQ
Sbjct  359  VLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQ 418
Query  380  MVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEE 439
            ++ +PQNF VVK+A + GFEWV F TN+NA+ S  AGRTS +R +P  VLANA ++ +E+
Sbjct  419  LLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANALQIPRED 478
Query  440  ARRIKLNRDEAVLFQ--PGSRSRGRA 463
            ARR+K+NR E+ L +  P S    R+
Sbjct  479  ARRLKFNRQESTLVRSRPSSSRSSRS 504

Sequence Alignment: 21. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 164.0 bits 692,  Expect = 2e-41
 Identities = 259/455 56%, Positives = 333/455 73%, Gaps = 48/455 10%
Query  1    MAKLFLLSLGIFLL--FHCCLAIEY---EQEELY--ECRIQRLTAQEPQYRLEAEAGVSE 53
            MAKL L+S+ + LL  F+ CL I      Q++ Y  EC + RL A EP  R+EAEA   E
Sbjct  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
Query  54   VWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF-- 111
             WD+ DQQF+CAGVA +R TI P GLLLP Y+NAP+L Y+ +GRGI GVL PGCPETF  
Sbjct  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
Query  112  -QSMSQFQGSREQEEERGRF-QDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLV 169
             Q  SQ QG R+ + +  R  QD+HQK+ H+++GDIIA+PAGVA WCYNDGD  +VTV +
Sbjct  121  PQQQSQ-QGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSL 179
Query  170  QHTASDLNQLDQNPRHFFLAGNI----QRS-QKQRGER-------YGLRGGQ--QILADN 215
             HT +  NQLD+NPRHF+LAGN     QR  Q+Q G+R       +G +G Q  Q   +N
Sbjct  180  LHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNN 239
Query  216  VFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQE- 274
            VF GF+ E LAD   F +D +TAR+++   D+R +IV+VE  L+V+RP R R+E E+QE 
Sbjct  240  VFSGFDAEFLAD--AFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQER 297
Query  275  ---------------GG---GYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSL 316
                           GG     NG+EETICS  + +NI   + AD Y  + GR+ TVNS 
Sbjct  298  QERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSN 357
Query  317  KVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLR 376
             +P+L +LQLSA +G L    +  P W LNA+SVVYA+RG ARVQ+VD  G TVFDD LR
Sbjct  358  TLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELR 417
Query  377  EGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLS 436
            +GQ++ +PQNF V K+A S GFEWV F TNDNA  S  AGRTS +R +P  VLANA+++S
Sbjct  418  QGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQIS 477
Query  437  QEEARRIKLNRDEAVLFQPGSRS 459
            +EEARR+K NR E  L +  SRS
Sbjct  478  REEARRLKYNRQETTLVR-SSRS 499

Sequence Alignment: 22. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 162.8 bits 687,  Expect = 4e-41
 Identities = 232/458 50%, Positives = 333/458 72%, Gaps = 92/458 20%
Query  1    MAKLFLLSLGIFLLFHCCLAIEYEQ-EELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTD 59
            MAK F++SL ++L+F+ CLA    Q     +C++ +L A+EP  R++AEAG  E W++  
Sbjct  1    MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQ 60
Query  60   QQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQF-- 117
            + F+CAGVAA R TI+  GL LP Y+NAP+L Y+ QGRG+LG +  GCPETF+   Q   
Sbjct  61   EDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ 120
Query  118  ----------------------QGSREQEEER-GRFQ----------------------- 131
                                  QG +EQ++ER GR Q                       
Sbjct  121  QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQ 180
Query  132  -------DQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPR 184
                   D+HQK   +++GD++AIPAGVA W YNDGD++LV V + H +SD NQLDQNPR
Sbjct  181  QQQFRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPR 240
Query  185  HFFLAGNIQRSQKQRGE----RYGLRG--GQ-------------QILADNVFKGFNMEAL 225
             F+LAGN +    Q+G+    + G +G  GQ             Q   +NVF GFN + L
Sbjct  241  KFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLL 300
Query  226  ADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELE-------------Q 272
            A  L   ++ ETAR ++G++D R +I+RV   L  ++PPR R+E E             Q
Sbjct  301  AQALN--VNEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQERQ 358
Query  273  QEGGGY--NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMK 330
            Q+GG    NGLEET CS  + +NI NP  AD ++PRAGR++T+NS  +PIL FL+LSA +
Sbjct  359  QQGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAER 418
Query  331  GVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVV 390
            G +Y N + +P W +NA+SVVY +RG ARVQ+V+  G+ ++D  +++GQ+ +VPQN  V+
Sbjct  419  GFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVI 478
Query  391  KQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEA 450
            +QAG++GFE+  F T +NA+ +T AGRTS LR +P  VLANAY++S+E+AR++K NR E 
Sbjct  479  QQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQET 538
Query  451  VLFQPGSRSR 460
            + +    + R
Sbjct  539  IALSSSQQRR 548

Sequence Alignment: 23. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 161.3 bits 680,  Expect = 1e-40
 Identities = 218/429 50%, Positives = 313/429 72%, Gaps = 91/429 21%
Query  30   ECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPK 89
            +C++ +L A+EP  R++AEAG  E W++    F+CAGVAA R TI+  GL LP Y+NAP+
Sbjct  11   QCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQ 70
Query  90   LYYVTQGRGILGVLMPGCPETFQSMSQF------------------------QGSREQEE 125
            L Y+ QGRG+LG +  GCPETF+   Q                         QG +EQ++
Sbjct  71   LIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ 130
Query  126  ER-GRFQ------------------------------DQHQKVHHLKKGDIIAIPAGVAL 154
            ER GR Q                              D+HQK   +++GD++AIPAGVA 
Sbjct  131  ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAGVAY 190
Query  155  WCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRSQKQRGE----RYGLRG--G 208
            W YNDGD++LV V + H +SD NQLDQNPR F+LAGN +    Q+G+    + G +G  G
Sbjct  191  WSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPG 250
Query  209  Q-------------QILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVE 255
            Q             Q   +NVF GFN + LA  L   ++ ETAR ++G++D R +I++V 
Sbjct  251  QHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALN--VNEETARNLQGQNDNRNQIIQVR 308
Query  256  QGLKVIRPPRIREELE-------------QQEGGGY--NGLEETICSATFIQNIDNPAEA 300
              L  ++PPR R+E E             QQ+G     NGLEET CS  + +NI NP  A
Sbjct  309  GNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERA 368
Query  301  DFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARV 360
            D ++PRAGR++T+NS  +PIL FL+LSA +G +Y N + +P W +NA+SVVY +RG ARV
Sbjct  369  DIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARV 428
Query  361  QIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSP 420
            Q+V+  G+ ++D  +++GQ+ +VPQN  V++QAG++GFE+  F T +NA+ +T AGRTS 
Sbjct  429  QVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSF 488
Query  421  LRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSR 460
            LR +P  VLANAY++S+E+AR++K NR E + +    + R
Sbjct  489  LRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRR 528

Sequence Alignment: 24. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 160.8 bits 678,  Expect = 2e-40
 Identities = 231/444 52%, Positives = 314/444 70%, Gaps = 77/444 17%
Query  1    MAKLFLLSLGIFLL--FH-CCLAIE----YEQEELY------------ECRIQRLTAQEP 41
            MA   LLS+ + LL  FH CC  I+    + Q+  +            +C++Q L A +P
Sbjct  1    MAYTSLLSFSVCLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQCQLQNLNALQP 60
Query  42   QYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILG 101
            ++R+ +EAG +E WD  + QF+CAGVA LR+ I+ +GLLLP +T+AP L+YV QG GI G
Sbjct  61   KHRFRSEAGETEFWDQNEDQFQCAGVAFLRHKIQRKGLLLPSFTSAPMLFYVEQGEGIHG 120
Query  102  VLMPGCPETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGD 161
             + PGCPET+QS SQ Q  +++ +     +DQHQK+  LK+GD++A+PAGVA W +N+G 
Sbjct  121  AVFPGCPETYQSQSQ-QNIQDRPQ-----RDQHQKLRRLKEGDVVALPAGVAHWIFNNGR 174
Query  162  EDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQ-----------RSQKQ----RGERYGLR 206
              LV V +    +D NQLD+N R FFLAG+ Q           R+Q+Q    RGER    
Sbjct  175  SQLVLVALVDVGNDANQLDENFRKFFLAGSPQGGVVRGGQSRDRNQRQSRTQRGEREE-E 233
Query  207  GGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVI----- 261
              Q+   +NV+ GF    LA    FG+DT  ARK++ E D RG IVR+E+G++       
Sbjct  234  ESQESGGNNVLSGFRDNLLAQA--FGIDTRLARKLQNERDNRGAIVRMEHGFEWPEEGQR 291
Query  262  -----------RPPRIREELEQQEGGGY---------------NGLEETICSATFIQNID 295
                       R P+ +   E QE G                 NGLEET CS  + +   
Sbjct  292  RQGREEEGEEEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHR-- 349
Query  296  NPAE-ADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAV 354
             PA  AD +NPR GR+TTVNS+ +PIL +LQLSA +GVLY NA+ AP W +NA+S+VY  
Sbjct  350  TPASSADVFNPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVYIT 409
Query  355  RGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTA 414
            RG  R+QIV   GE +FD+ +  GQ++ VPQN  VVK+AG RGFEW+ F TN NA  S  
Sbjct  410  RGNGRIQIVSENGEAIFDEQVERGQVITVPQNHAVVKKAGRRGFEWIAFKTNANAKISQI 469
Query  415  AGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQP 455
            AGR S +RG+PV VLAN++ +S+EEA R+K NR E  +F P
Sbjct  470  AGRVSIMRGLPVDVLANSFGISREEAMRLKHNRQEVSVFSP 510

Sequence Alignment: 25. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 150.6 bits 633,  Expect = 2e-37
 Identities = 222/452 49%, Positives = 310/452 68%, Gaps = 59/452 13%
Query  6    LLSLGIFLLFHCCLAIEY--EQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFR 63
            LL L +++LF+ CLA +    Q+   EC+I RL A  PQ R+ +EAG +E W+   QQ+R
Sbjct  7    LLFLSLLFLFNGCLARQTFSSQQSQNECQINRLRASAPQTRIRSEAGTTEWWNPNCQQLR 66
Query  64   CAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQ 123
            CAGV+ +R TI P GL+LP +TNAP+L Y+ QGRGI G++MPGC ETFQ   Q+Q     
Sbjct  67   CAGVSVMRQTIEPNGLVLPSFTNAPQLLYIVQGRGIQGIVMPGCAETFQDSQQWQ----- 121
Query  124  EEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNP 183
             + RGRFQDQHQKV  +++GDIIA+P GV  W YNDG+E +VT+ +  T +  NQLD  P
Sbjct  122  HQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLLDTGNSANQLDNIP 181
Query  184  RHFFLAGNIQRSQKQ-------------RGE----------------------RYGL--- 205
            R F LAGN +  Q+Q             RGE                      R+     
Sbjct  182  RRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRHQEEEE 241
Query  206  RGGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPR 265
            +G +    +N++  F+   LA    F +D +  RK++     RG I+RV   L+V+ PPR
Sbjct  242  QGRESSSCNNLLCAFDRNFLAQ--AFNVDHDIIRKIQRVRGNRGTIIRVRDRLQVVTPPR 299
Query  266  IREELE---QQE-------GGGY-NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVN 314
            + EE     QQE       GG   NGLEET CS    +N+ +P  AD +NP+AGR++T+N
Sbjct  300  MEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKENLADPERADIFNPQAGRISTLN 359
Query  315  SLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDN 374
             + +PIL  L+LSA +GVLY  A + P W +NA+ ++Y +RG ARVQ+V+H G+ VFDDN
Sbjct  360  RFNLPILQRLELSAERGVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDDN 419
Query  375  LREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYR 434
            + +GQ++ VPQNF  +KQAG+ G EW+ F TN  A  +  AG  S +R +P  V+A +Y+
Sbjct  420  VEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTPMAGSVSFMRALPEEVVAASYQ 479
Query  435  LSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465
            +S+E+ARRIK+N     +F P S+S  RA A
Sbjct  480  VSREDARRIKFNNKNTFFFTP-SQSERRADA 509

Sequence Alignment: 26. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 135.7 bits 568,  Expect = 5e-33
 Identities = 203/444 45%, Positives = 288/444 64%, Gaps = 74/444 16%
Query  4    LFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFR 63
            L L SL ++LL   C+AI     ++ EC++  L A EP +R+E+E G+ E W+    +++
Sbjct  8    LSLSSLCLLLLSSACFAIT--SSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQ 65
Query  64   CAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGSREQ 123
            CAGV   + T+   GL LP Y+  P++  V QG+G +G   PGCPETF+   Q Q SR  
Sbjct  66   CAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQ-QSSRRG 124
Query  124  EEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNP 183
               + ++QD HQK+ H+ +GD++ IP GV  W YN GDE +V + +  T++  NQLDQNP
Sbjct  125  SRSQQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNP 184
Query  184  RHFFLAGN--------IQRSQKQR---GERYGLRGGQQILADNVFKGFNMEALADVLGFG 232
            R F+LAGN        +Q+ Q+Q+   G + G    Q+    +V+ GF+   LA    F 
Sbjct  185  RVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQ--SFN 242
Query  233  MDTETARKVRGEDDQRGHIVRVEQGLKVIRP-----------------------PRI--- 266
             + +TA K+R  DD+R +IV VE GL VI P                       PR    
Sbjct  243  TNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSH 302
Query  267  ----------REEL--------------EQQEGGGY-----NGLEETICSATFIQNIDNP 297
                       EE               EQQE  G      NG+EE IC+  + +NI  P
Sbjct  303  GKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARP 362
Query  298  AEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGE 357
            + ADFYNP+AGR++T+NSL +P L  + LSA   VLY N + +P W LNANSV+Y  RG+
Sbjct  363  SRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGK 422
Query  358  ARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGR 417
             RV++V+ +G  VFD  LR GQ++VVPQNFVV +Q G +G+E+VVF T+ NA+ S     
Sbjct  423  GRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIK-- 480
Query  418  TSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQP 455
               +R IP  VL+N+Y L Q + R++K   +   L  P
Sbjct  481  -DVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP 517

Sequence Alignment: 27. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 135.0 bits 565,  Expect = 1e-32
 Identities = 204/447 45%, Positives = 297/447 66%, Gaps = 118/447 26%
Query  1    MAKLFLLSLG---IFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDY 57
            M K F LSL    ++LL   C+AI     +L EC++  L A EP +R+E+E G+ + W+ 
Sbjct  1    MGKPFTLSLSSLCLLLLSSACFAIS--SSKLNECQLNNLNALEPDHRVESEGGLIQTWNS 58
Query  58   TDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF---QSM 114
               +++CAGV   + T+   GL LP Y+  P++  + QG+G LGV +PGCPETF   Q  
Sbjct  59   QHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQ 118
Query  115  SQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTAS 174
            S  +GSR Q+++   +QD HQK+ H+ +GD++ IP GV  W YN GDE +V + +  T++
Sbjct  119  SNRRGSRSQKQQ---LQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSN 175
Query  175  DLNQLDQNPRHFFLAGN--------IQRSQKQRGERYGLRGGQQILAD-----NVFKGFN 221
              NQLDQ PR F+LAGN        +Q+ Q+Q+    G + GQ+   +     +V+ GF+
Sbjct  176  FNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHG-GRKQGQHQQEEEEEGGSVLSGFS 234
Query  222  MEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVI-------------------- 261
               LA    F  + + A K++  DD+R +IV VE GL VI                    
Sbjct  235  KHFLAQ--SFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDED 292
Query  262  -----RPPR----------------------------IREELEQQ--------------- 273
                  PPR                             RE+ + Q               
Sbjct  293  EQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSR 352
Query  274  ------------------EGG--GYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTV 313
                              E G    NG+EE IC+  + +NI  P+ ADFYNP+AGR++T+
Sbjct  353  EWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTL 412
Query  314  NSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDD 373
            NSL +P L  +QLSA   VLY+N + +P W LNANSV+Y  RG+ +V++V+ +G  VFD 
Sbjct  413  NSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDG 472
Query  374  NLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAY 433
             LR GQ++VVPQNFVV +QAG +GFE++VF T+ NA+ S        +R IP  VLA++Y
Sbjct  473  ELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSY 529
Query  434  RLSQEEARRIKLNRDEAVLFQPGSR 458
             L Q +   +K   +   L  P S+
Sbjct  530  NLRQSQVSELKYEGNWGPLVNPESQ 554

Sequence Alignment: 28. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 122.5 bits 510,  Expect = 5e-29
 Identities = 204/456 44%, Positives = 300/456 65%, Gaps = 48/456 10%
Query  1    MAKLFLLSLGIFLLFH-CCLAIE-YEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYT 58
            MAKL ++SL  FLLF  CC+A    EQ +  EC+IQ+L A +P  R+E+E G+ E W+  
Sbjct  1    MAKL-VFSL-CFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPN 58
Query  59   DQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQ 118
            ++ F+CAGVA  R T+    L  P YTN P+  Y+ QG+GI+G++ PGCP TF+   Q Q
Sbjct  59   NKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQ 118
Query  119  GSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQ 178
                Q  +  R QD+HQK++++++GD+IA+P GVA W YN+ D  +V V +  T S  NQ
Sbjct  119  ----QRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQ 174
Query  179  LDQNPRHFFLAGNIQ----RSQKQRGERYGLRGGQQILADN----VFKGFNMEALADVLG 230
            LDQ PR F+LAGN +    + Q+++G     +G +Q   +N    ++ GF +E L     
Sbjct  175  LDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA-- 232
Query  231  FGMDTETARKVRGEDD--QRGHIVRVEQGLKVIRPP------RIREELEQQEG------- 275
            F +D + A+ ++GE++   +G IV V+ GL VI+PP      R +EE E++E        
Sbjct  233  FSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKG 292
Query  276  ---------GGY-----NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPIL 321
                     G       NG++ETIC+  + +NI   +  D YNP+AG +TT  SL  P L
Sbjct  293  KDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPAL 352
Query  322  TFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMV 381
            ++L+LSA  G L +NAM  P + LNANS++YA+ G A +Q+V+  GE VFD  L+EG+++
Sbjct  353  SWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVL 412
Query  382  VVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEAR 441
            +VPQNFVV  ++ S  FE+V F TND  +  T AG  S L  +P  V+ + + L  ++AR
Sbjct  413  IVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQAR 472
Query  442  RIKLNRDEAVLFQPGSRSRGRASA 465
            +IK N     L  P   S+ RA A
Sbjct  473  QIKNNNPFKFLVPP-QESQKRAVA 495

Sequence Alignment: 29. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 122.5 bits 510,  Expect = 5e-29
 Identities = 204/456 44%, Positives = 300/456 65%, Gaps = 48/456 10%
Query  1    MAKLFLLSLGIFLLFH-CCLAIE-YEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYT 58
            MAKL ++SL  FLLF  CC+A    EQ +  EC+IQ+L A +P  R+E+E G+ E W+  
Sbjct  1    MAKL-VFSL-CFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPN 58
Query  59   DQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQ 118
            ++ F+CAGVA  R T+    L  P YTN P+  Y+ QG+GI+G++ PGCP TF+   Q Q
Sbjct  59   NKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQ 118
Query  119  GSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQ 178
                Q  +  R QD+HQK++++++GD+IA+P GVA W YN+ D  +V V +  T S  NQ
Sbjct  119  ----QRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQ 174
Query  179  LDQNPRHFFLAGNIQ----RSQKQRGERYGLRGGQQILADN----VFKGFNMEALADVLG 230
            LDQ PR F+LAGN +    + Q+++G     +G +Q   +N    ++ GF +E L     
Sbjct  175  LDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA-- 232
Query  231  FGMDTETARKVRGEDD--QRGHIVRVEQGLKVIRPP------RIREELEQQEG------- 275
            F +D + A+ ++GE++   +G IV V+ GL VI+PP      R +EE E++E        
Sbjct  233  FSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKG 292
Query  276  ---------GGY-----NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPIL 321
                     G       NG++ETIC+  + +NI   +  D YNP+AG +TT  SL  P L
Sbjct  293  KDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPAL 352
Query  322  TFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMV 381
            ++L+LSA  G L +NAM  P + LNANS++YA+ G A +Q+V+  GE VFD  L+EG+++
Sbjct  353  SWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVL 412
Query  382  VVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEAR 441
            +VPQNFVV  ++ S  FE+V F TND  +  T AG  S L  +P  V+ + + L  ++AR
Sbjct  413  IVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQAR 472
Query  442  RIKLNRDEAVLFQPGSRSRGRASA 465
            +IK N     L  P   S+ RA A
Sbjct  473  QIKNNNPFKFLVPP-QESQKRAVA 495

Sequence Alignment: 30. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 120.5 bits 501,  Expect = 2e-28
 Identities = 201/449 44%, Positives = 290/449 64%, Gaps = 39/449 8%
Query  1    MAKLFLLSLGIFLLFH-CCLAIEY-EQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYT 58
            MAKL +LSL  FLLF  CC+A  + EQ +  EC+IQRL A +P  R+E+E G  E W+  
Sbjct  1    MAKL-VLSL-CFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPN 58
Query  59   DQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQ 118
            ++ F+CAGVA  R T+    L  P YTNAP+  Y+ QG GI+G++ PGCP TF+   Q +
Sbjct  59   NKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQ-K 117
Query  119  GSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQ 178
            G      +  R QD+HQK++H+++GD+IA+P G A W YN+ D  +V V +  T S  NQ
Sbjct  118  G------QSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQ 171
Query  179  LDQNPRHFFLAGNIQRS------QKQRGERYGLRGGQQILADN----VFKGFNMEALADV 228
            LDQ PR F+LAGN ++       QKQ+G     +G +Q   +N    ++ GF  E L   
Sbjct  172  LDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHA 231
Query  229  LGFGMDTETARKVRGEDDQ--RGHIVRVEQGLKVIRPP----RIREELEQQ--------- 273
              F +D +  RK++GE+++  +G IV V+ GL VI PP    + R E E++         
Sbjct  232  --FVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKH 289
Query  274  -EGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGV 332
             +    NG++ETIC+  + +NI   +  D +NP+AG +TT  SL  P L++L+LSA  G 
Sbjct  290  CQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGS 349
Query  333  LYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQ 392
            L +NAM  P + LNANS++YA+ G A VQ+V+  GE VFD  L+EGQ+++VPQNF V  +
Sbjct  350  LRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAAR 409
Query  393  AGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVL 452
            + S  FE+V F TND       AG  S L  +P  V+   + L +++AR++K N   + L
Sbjct  410  SQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFL 469
Query  453  FQPGSRSR 460
              P    R
Sbjct  470  VPPKESQR 477

Sequence Alignment: 31. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 120.5 bits 501,  Expect = 2e-28
 Identities = 204/455 44%, Positives = 289/455 63%, Gaps = 40/455 8%
Query  1    MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQ 60
            MAKL +LSL  FLLF  C+A+  EQ +  EC+IQ+L A +P  R+E+E G  E W+  ++
Sbjct  1    MAKL-VLSL-CFLLFSGCFALR-EQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNK 57
Query  61   QFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGS 120
             F+CAGVA  R T+    L  P YTN P+  Y+ QG GI+G++ PGCP T+Q   + Q  
Sbjct  58   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQ-- 115
Query  121  REQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLD 180
              Q     R QD+HQKVH +++GD+IA+P GVA W YN+ D  +V V +  T S  NQLD
Sbjct  116  --QRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLD 173
Query  181  QNPRHFFLAGN-----IQRSQKQRGERYGLRGGQQILAD---NVFKGFNMEALADVLGFG 232
            Q PR F+LAGN     ++  Q+Q+G     +G QQ   +   N++ GF  E L +   FG
Sbjct  174  QMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEA--FG 231
Query  233  MDTETARKVRGEDDQR--GHIVRVEQGLKV----IRPPRIRE----ELEQ---------- 272
            ++ +  R ++GE+++   G IV V+ GL+V    +R P+  E    E EQ          
Sbjct  232  VNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGC 291
Query  273  --QEGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMK 330
              Q     NG++ETIC+  + QNI   +  D YNP+AG +TT  SL  P L +L+LSA  
Sbjct  292  QRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQY 351
Query  331  GVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVV 390
            G L +NAM  P + LNANS++YA+ G A VQ+V+  GE VFD  L+EG +++VPQNF V 
Sbjct  352  GSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVA 411
Query  391  KQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEA 450
             ++ S  FE+V F TND       AG  S L  +P  V+ + + L  ++AR++K N   +
Sbjct  412  AKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFS 471
Query  451  VLFQPGSRSRGRASA 465
             L  P   S+ RA A
Sbjct  472  FLVPP-QESQRRAVA 485

Sequence Alignment: 32. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 120.5 bits 501,  Expect = 2e-28
 Identities = 204/455 44%, Positives = 289/455 63%, Gaps = 40/455 8%
Query  1    MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQ 60
            MAKL +LSL  FLLF  C+A+  EQ +  EC+IQ+L A +P  R+E+E G  E W+  ++
Sbjct  1    MAKL-VLSL-CFLLFSGCFALR-EQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNK 57
Query  61   QFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQGS 120
             F+CAGVA  R T+    L  P YTN P+  Y+ QG GI+G++ PGCP T+Q   + Q  
Sbjct  58   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQ-- 115
Query  121  REQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLD 180
              Q     R QD+HQKVH +++GD+IA+P GVA W YN+ D  +V V +  T S  NQLD
Sbjct  116  --QRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLD 173
Query  181  QNPRHFFLAGN-----IQRSQKQRGERYGLRGGQQILAD---NVFKGFNMEALADVLGFG 232
            Q PR F+LAGN     ++  Q+Q+G     +G QQ   +   N++ GF  E L +   FG
Sbjct  174  QMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEA--FG 231
Query  233  MDTETARKVRGEDDQR--GHIVRVEQGLKV----IRPPRIRE----ELEQ---------- 272
            ++ +  R ++GE+++   G IV V+ GL+V    +R P+  E    E EQ          
Sbjct  232  VNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGC 291
Query  273  --QEGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMK 330
              Q     NG++ETIC+  + QNI   +  D YNP+AG +TT  SL  P L +L+LSA  
Sbjct  292  QRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQY 351
Query  331  GVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVV 390
            G L +NAM  P + LNANS++YA+ G A VQ+V+  GE VFD  L+EG +++VPQNF V 
Sbjct  352  GSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVA 411
Query  391  KQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEA 450
             ++ S  FE+V F TND       AG  S L  +P  V+ + + L  ++AR++K N   +
Sbjct  412  AKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFS 471
Query  451  VLFQPGSRSRGRASA 465
             L  P   S+ RA A
Sbjct  472  FLVPP-QESQRRAVA 485

Sequence Alignment: 33. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 116.1 bits 482,  Expect = 4e-27
 Identities = 192/440 43%, Positives = 274/440 62%, Gaps = 68/440 15%
Query  24   EQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPV 83
            +Q E   C+ QRL AQ P  R+E+E G  E W+  +Q+F CAGVA  R  +R   L  P 
Sbjct  2    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 61
Query  84   YTNAPKLYYVTQGRGILGVLMPGCPETFQ--------SMSQFQGSREQEEERGRFQ-DQH 134
            Y+NAP+  ++ QGRG +G++ PGCP  ++        S SQ    R Q E++ + Q D H
Sbjct  62   YSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSH 121
Query  135  QKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQ- 193
            QKVH + +GD+IA+P GVA+W YND D D+V V +  T ++ NQLDQ PR F LAGN + 
Sbjct  122  QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ 181
Query  194  ---RSQKQ--RGERYGL----------------------------RGGQQILAD--NVFK 218
               R Q+Q  +  R  L                            R GQ+   +  N+F 
Sbjct  182  EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFS 241
Query  219  GFNMEALADVLGFGMDTETARKVRGE--DDQRGHIVRVEQGLKVIRPPRIREELEQQE-- 274
            GF  E L   +    D +  + +RGE   ++ G IV V  GL+++ P R R   E++E  
Sbjct  242  GFTPEFLEQAFQVD-DRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
Query  275  -------------GGGY----NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLK 317
                         G G     NG+EETIC+A+  +NI      D YNP+AG L T N L 
Sbjct  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
Query  318  VPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLRE 377
            + IL +L  SA  G LY NA+    +  NA+S++Y +RG A VQ+VD  G  V+D+ L+E
Sbjct  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
Query  378  GQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQ 437
            G+++VVPQNF V  ++ S  FE+V F T+     +  AG  S +  +P  V+AN+Y L +
Sbjct  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
Query  438  EEARRIKLNRDEAVLFQPGSRSRGRASA 465
            E+AR++K N +   +F P S+   RA A
Sbjct  481  EQARQLK-NNNPFKFFVPPSQQSPRAVA 507

Sequence Alignment: 34. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 116.1 bits 482,  Expect = 4e-27
 Identities = 192/440 43%, Positives = 274/440 62%, Gaps = 68/440 15%
Query  24   EQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPV 83
            +Q E   C+ QRL AQ P  R+E+E G  E W+  +Q+F CAGVA  R  +R   L  P 
Sbjct  5    QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 64
Query  84   YTNAPKLYYVTQGRGILGVLMPGCPETFQ--------SMSQFQGSREQEEERGRFQ-DQH 134
            Y+NAP+  ++ QGRG +G++ PGCP  ++        S SQ    R Q E++ + Q D H
Sbjct  65   YSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSH 124
Query  135  QKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQ- 193
            QKVH + +GD+IA+P GVA+W YND D D+V V +  T ++ NQLDQ PR F LAGN + 
Sbjct  125  QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ 184
Query  194  ---RSQKQ--RGERYGL----------------------------RGGQQILAD--NVFK 218
               R Q+Q  +  R  L                            R GQ+   +  N+F 
Sbjct  185  EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFS 244
Query  219  GFNMEALADVLGFGMDTETARKVRGE--DDQRGHIVRVEQGLKVIRPPRIREELEQQE-- 274
            GF  E L   +    D +  + +RGE   ++ G IV V  GL+++ P R R   E++E  
Sbjct  245  GFTPEFLEQAFQVD-DRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 303
Query  275  -------------GGGY----NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLK 317
                         G G     NG+EETIC+A+  +NI      D YNP+AG L T N L 
Sbjct  304  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 363
Query  318  VPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLRE 377
            + IL +L  SA  G LY NA+    +  NA+S++Y +RG A VQ+VD  G  V+D+ L+E
Sbjct  364  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 423
Query  378  GQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQ 437
            G+++VVPQNF V  ++ S  FE+V F T+     +  AG  S +  +P  V+AN+Y L +
Sbjct  424  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 483
Query  438  EEARRIKLNRDEAVLFQPGSRSRGRASA 465
            E+AR++K N +   +F P S+   RA A
Sbjct  484  EQARQLK-NNNPFKFFVPPSQQSPRAVA 510

Sequence Alignment: 35. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 110.4 bits 457,  Expect = 2e-25
 Identities = 197/463 42%, Positives = 288/463 62%, Gaps = 69/463 14%
Query  1    MAKLFLLSLGIFLLFHCCLAIEYEQE-ELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTD 59
            MAKL+ LS+   +L     +I + Q+ E   C+ QRL AQ P  R+E+E G  E W+  +
Sbjct  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
Query  60   QQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQ--- 116
            Q+F CAGVA  R  +R   L  P Y+NAP+  ++ QGRG +G++ PGCP T++  +Q   
Sbjct  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR 120
Query  117  -FQGSRE----QEEERGRFQ-DQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQ 170
             +Q  R     QEE++ + Q D HQKVH + +GD+IA+P GVA+W YND D D+V V + 
Sbjct  121  RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
Query  171  HTASDLNQLDQNPRHFFLAGNIQ----RSQKQ--RGERYGL------------------- 205
             T ++ NQLDQ PR F LAGN +    R Q+Q  +  R  L                   
Sbjct  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
Query  206  ---------RGGQQILAD--NVFKGFNMEALADVLGFGMDTETARKVRGEDD--QRGHIV 252
                     R GQ+   +  N+F GF  E L   +    D +  + + GE++  + G IV
Sbjct  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVD-DRQIVQNLWGENESEEEGAIV 299
Query  253  RVEQGLKVIRPPRIR---EELE---------QQEG-------GGYNGLEETICSATFIQN 293
             V  GL+++ P   R   EE E         +Q+G       GG NG+EETIC+A   +N
Sbjct  300  TVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKN 359
Query  294  IDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYA 353
            I        Y+P+       + L + IL +L LSA  G LY NA+  P +  NA+S++YA
Sbjct  360  IGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYA 419
Query  354  VRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFST 413
            +RG A VQ+VD  G  V+D+ L+EG+++VVPQNF V  ++ S  FE+V F T+     + 
Sbjct  420  LRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN 479
Query  414  AAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465
             AG  S +  +P  V+AN+Y L +E+AR++K N +   +F P  +   RA A
Sbjct  480  FAGENSFIDNLPEEVVANSYGLPREQARQLK-NNNPFKFFVPPFQQSPRAVA 530

Sequence Alignment: 36. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 40.7 bits 151,  Expect = 0.0003
 Identities = 42/128 32%, Positives = 65/128 50%, Gaps = 15/128 11%
Query  60   QQFRCAGVAALRNTIRPQGLLLPVY-TNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQ 118
            +Q++   V      I+   +++P Y + A  + YV +G G   +    CP       + Q
Sbjct  411  RQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEM---ACPHVSSQSYEGQ 467
Query  119  GSREQEEER--GRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDL 176
            G REQEEE   GRFQ   +    L +GDI  IPAG  +      +E+L  +       D+
Sbjct  468  GRREQEEEESTGRFQ---KVTARLARGDIFVIPAGHPIAITASQNENLRLL-----GFDI 519
Query  177  NQLDQNPRHFFLAGNIQRSQKQR 199
            N  + N R F+   N   +Q +R
Sbjct  520  NG-ENNQRDFLAGQNNIINQLER 541

Sequence Alignment: 37. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 41.1 bits 153,  Expect = 0.0003
 Identities = 44/130 33%, Positives = 68/130 52%, Gaps = 13/130 10%
Query  60   QQFRCAGVAALRNTIRPQGLLLPVY-TNAPKLYYVTQGRGILGVLMPGCPETFQSMS-QF 117
            +Q++   V      I+   +++P Y + A  + YV +G G + +    CP    S S ++
Sbjct  607  RQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEM---ACPHDVSSQSYEY 663
Query  118  QGSREQEEERGRFQDQHQKVH-HLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDL 176
            +G REQEEE      Q QKV   L +GDI  IPAG  +      +E+L   LV    +  
Sbjct  664  KGRREQEEEESS-TGQFQKVTARLARGDIFVIPAGHPIAITASQNENL--RLVGFGINGK 720
Query  177  NQLDQNPRHFFLAGNIQRSQKQR 199
            N    N R+F+   N   +Q +R
Sbjct  721  N----NQRNFLAGQNNIINQLER 739

Sequence Alignment: 38. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 38.6 bits 142,  Expect = 0.0008
 Identities = 34/99 34%, Positives = 51/99 51%, Gaps = 9/99 9%
Query  60   QQFRCAGVAALRNTIRPQGLLLPVY-TNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQ 118
            +Q++   V      I+   +++P Y + A  + YV +G G   +    CP       + Q
Sbjct  299  RQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEM---ACPHVSSQSFEDQ 355
Query  119  GSREQEEER--GRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDL 164
            G REQEEE   GRFQ   +    L +GDI  IPAG  +      +E+L
Sbjct  356  GRREQEEEESTGRFQ---KVTARLARGDIFVIPAGHPIAITASQNENL 400

Sequence Alignment: 39. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 36.8 bits 134,  Expect = 0.004
 Identities = 80/307 26%, Positives = 147/307 47%, Gaps = 41/307 13%
Query  138  HHLKKGDIIAIPAGVALWCYN-DGDEDLVTVLVQHTASDLN-QLDQNPRHFFLAGNIQRS 195
            ++L+ GD + +PAG  ++  N D DE+L  ++   T   +N   D+N R   LA  I  +
Sbjct  293  YNLQSGDALRVPAGTTFYVVNPDNDENL-RMIAGTTFYVVNPDNDENLRMITLA--IPVN 349
Query  196  QKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDT--ETARKV---RGEDDQRGH 250
            +  R E + L   Q     + ++GF+     ++L    DT  E   KV   R E  Q+G 
Sbjct  350  KPGRFESFFLSSTQA--QQSYLQGFS----KNILEASYDTKFEEINKVLFGREEGQQQGE 403
Query  251  IVRVEQGLKV-IRPPRIREELEQQEGGGYNGLEETICSATFIQNIDNPAEADFYNPRAGR 309
              R+++ + V I   +IRE  ++ +        +TI S     N+ +      Y+ + G+
Sbjct  404  -ERLQESVIVEISKKQIRELSKHAKSSS----RKTISSEDKPFNLGS--RDPIYSNKLGK 456
Query  310  LTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIV-----D 364
            L  + + + P L  L +      + E A+  P +   A  V+    GEA +++V      
Sbjct  457  LFEI-TQRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQ 515
Query  365  HRGETV--------FDDNLREGQMVVVPQNF-VVVKQAGSRGFEWVVFNTNDNALFSTAA 415
            +R +          +   L E  + V+P  + V+V       F     N  +N     A 
Sbjct  516  QRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAG 575
Query  416  GRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLF--QPGSRSRG 461
             + + +  IP  V   A+  S ++   +  ++ E+ +   QP  +  G
Sbjct  576  SKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEG 623

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.