The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE
SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED
PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL
HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV
FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER
ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP
VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ
VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE
ARRLKYNRQETTLVRSSRSSSERKRRSESEGRAEA
Sequence Info Allergen Name Length Opt Bits Score E Value
AAL73404 Cor a 9 515 3476 798.6 0
Q2TPW5 Jug r 4.0101 507 2462 567.4 6.5e-163
A0A1L6K371 Jug n 4.0101 510 2455 565.8 2e-162
ABW86978 Car i 4.0101 505 2438 562.0 2.9e-161
3EHK_A Pru du 6 531 1431 332.4 3.8e-92
ADN39440 Pru du 6.0101 551 1431 332.4 4e-92
P04776 Gly m 6.0101 495 1378 320.4 1.5e-88
AAA33966 Gly m glycinin G1 495 1378 320.4 1.5e-88
ADN39441 Pru du 6.0201 504 1376 319.9 2.1e-88
P09802 Gos h 3 509 1280 298.0 8.3e-82
P09800 Gos h 4 516 1164 271.6 7.7e-74
P11828 Gly m 6.0301 481 1110 259.3 3.6e-70
P04405 Gly m 6.0201 485 1078 252.0 5.7e-68
CAA68460 Gly m glycinin G2 485 1078 252.0 5.7e-68
AAN76862 Ana o 2 457 984 230.6 1.5e-61
Q2TLW0 Sin a 2.0101 510 981 229.9 2.7e-61
EU410073 Pis v 5.0101 473 862 202.7 3.7e-53
O82580 Ara h 3 507 839 197.5 1.5e-51
AAC63045 Ara h 3 510 839 197.5 1.5e-51
DQ631676 Pis v 2.0101 496 807 190.2 2.3e-49
AAD47382 Ara h 4 530 774 182.7 4.6e-47
Q9XFM4 Fag e 1 538 768 181.3 1.2e-46
Q9AUD2 Ses i 7.0101 497 761 179.7 3.3e-46
BAA21758 Fag e 1 565 752 177.6 1.6e-45
P13744 Cuc ma 4.0101 480 726 171.7 8e-44
DQ631677 Pis v 2.0201 472 700 165.8 4.8e-42
BAA21760 Fag e 1 504 697 165.1 8.3e-42
AAO38859 Ber e 2 465 692 164.0 1.7e-41
QYU76045 Zan b 2.0101 389 689 163.4 2.2e-41
QYS16039 Zan b 2.03 389 685 162.5 4.1e-41
QYU76046 Zan b 2.0102 388 683 162.0 5.6e-41
QYU76044 Zan b 2.02 383 659 156.5 2.4e-39
Q9SB11 Gly m 6.0401 563 632 150.3 2.7e-37
Q9XHP0 Ses i 6.0101 459 616 146.7 2.7e-36
Q7GC77 Gly m 6.0501 517 591 141.0 1.6e-34
A0A0S3B0K0 Coc n 1.0101 490 169 44.8 1.4e-05
BAB21619 Gly m Bd28K 473 163 43.4 3.4e-05
AAL86739 Cor a 11 448 151 40.7 0.00021
CAA26385 Tri a gliadin 313 136 37.4 0.0015
AAA34275 Tri a gliadin 318 135 37.2 0.0017
AAA34278 Tri a gliadin 319 135 37.2 0.0017
AAA34279 Tri a gliadin 313 134 36.9 0.002
CAY54134 Tri a 21.0101 281 133 36.8 0.002
AAB02788 Tri a glutenin 815 139 37.8 0.0028
CAA31396 Tri a glutenin 648 131 36.1 0.0076
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 798.6 bits 3476,  Expect = 0
 Identities = 515/515 100%, Positives = 515/515 100%, Gaps = 0/515 0%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE
Sbjct  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED
Sbjct  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
            PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL
Sbjct  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
Query  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
            HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV
Sbjct  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
Query  241  FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER 300
            FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER
Sbjct  241  FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER 300
Query  301  ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP 360
            ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP
Sbjct  301  ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP 360
Query  361  VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ 420
            VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ
Sbjct  361  VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ 420
Query  421  VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE 480
            VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE
Sbjct  421  VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE 480
Query  481  ARRLKYNRQETTLVRSSRSSSERKRRSESEGRAEA 515
            ARRLKYNRQETTLVRSSRSSSERKRRSESEGRAEA
Sbjct  481  ARRLKYNRQETTLVRSSRSSSERKRRSESEGRAEA 515

Sequence Alignment: 2. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 567.4 bits 2462,  Expect = 6e-163
 Identities = 384/501 76%, Positives = 440/501 87%, Gaps = 18/501 3%
Query  1    MAKLILVSFSLCLLV-LFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQI 59
            MAK IL+S  L L+V LFNGCL  + G R+QQQ  FG+C L+RL+ALEPTNRIEAEA  I
Sbjct  1    MAKPILLSIYLFLIVALFNGCLAQSGG-RQQQQ--FGQCQLNRLDALEPTNRIEAEAGVI 57
Query  60   ESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFE 119
            ESWD N+QQFQCAGVAV+RRTIEPNGLLLPQYSNAP+L+YI RGRGITGVLFPGCPETFE
Sbjct  58   ESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFE 117
Query  120  DPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSL 179
            + Q+QSQQGQ      S+  +QDRHQKIRHFREGDIIA+PAGVAHW YNDG +PVV +SL
Sbjct  118  ESQRQSQQGQ------SREFQQDRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISL 171
Query  180  LHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSH--GEQGEQEQQGEG 237
            L TNN ANQLD+NPR+FYLAGNPDDE + QGQQ++ Q RRQQQ  +  GE+G Q+Q+G G
Sbjct  172  LDTNNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHG-QQQRGLG 230
Query  238  NNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGR-LQVVRPERSRQEWERQE 296
            NNVFSGFDA+FLADAFNVD +TARRLQS  D RR+IV+VEGR LQV+RP  SR+E ER+E
Sbjct  231  NNVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREE 290
Query  297  RQERESEQERERQRRQGGRG-RDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVN 355
            R+ERE E+E E +RRQ  RG RD NG+EETIC+LRLRENI   SRADIYTE+ GRI+TVN
Sbjct  291  RKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVN 350
Query  356  SNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDE 415
            S+TLPVLRWLQLSAERG L  + LYVPHWNLNAHSVVYA+RGRA VQVVD+ G TVFDDE
Sbjct  351  SHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDE 410
Query  416  LRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQ 475
            LR+GQ+LTIPQNFAV KRA +EGFEWV+FKTN+NA +SPLAGRTSAIRALP++VLA AFQ
Sbjct  411  LREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQ 470
Query  476  ISREEARRLKYNRQETTLVRSSRSSSERKRRSESEGRAE 514
            I RE+ARRLK+NRQE+TLVRS R S  R R S SE RAE
Sbjct  471  IPREDARRLKFNRQESTLVRS-RPS--RSRSSRSERRAE 506

Sequence Alignment: 3. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 565.8 bits 2455,  Expect = 2e-162
 Identities = 382/502 76%, Positives = 438/502 87%, Gaps = 19/502 3%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAK IL+S SLCL+ L NGCL  + G  RQQ R FGEC L RL ALEP+NRIEAEA  IE
Sbjct  1    MAKPILLSISLCLVALVNGCLAQSGG--RQQPR-FGECKLKRLVALEPSNRIEAEAGVIE 57
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            SWD N+QQFQCAGVAV+RRTIEPNGLLLPQYSNAP+L+YI +GRGITGVLFPGCPETFE+
Sbjct  58   SWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEE 117
Query  121  PQQQSQQGQRQGQGQSQRS---EQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTV 177
                SQQGQ + +  S RS   ++DRHQKIRHFREGD+IA+PAGVAHWCYNDGD+PVV V
Sbjct  118  ----SQQGQSRIR-PSLRSASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAV 172
Query  178  SLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHS--HGEQGEQEQQG 235
            +L+ T N ANQLD+NPR+FYLAGNPDDE + QGQQ++ Q RRQQQH   HGE G Q+Q+G
Sbjct  173  ALMDTTNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPG-QQQRG 231
Query  236  EGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGR-LQVVRPERSRQEWER 294
             GNNVFSGFDA+FLADAFNVD +TARRLQS  D RR+IV+VEGR LQV+RP  SR+E ER
Sbjct  232  SGNNVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQER 291
Query  295  QERQERESEQERERQRRQGGRG-RDVNGFEETICSLRLRENICTRSRADIYTEQVGRINT 353
            +ER+ERE E+E E +RRQ  RG RD NG+EETIC+LRLRENI   SRADIYTE+ GRI+T
Sbjct  292  EERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRIST 351
Query  354  VNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFD 413
             NS+TLPVLRWLQLSAERG L  + LYVPHWNLNAHSVVYA+RGRA VQVVD+ G TVFD
Sbjct  352  ANSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFD 411
Query  414  DELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANA 473
            DELR+GQ+LTIPQNFAV KRA +EGFEWV+FKTN+NA +SPLAGRTSAIRALP++VLANA
Sbjct  412  DELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANA 471
Query  474  FQISREEARRLKYNRQETTLVRSSRSSSERKRRSESEGRAE 514
            +QI RE+ARRLK+NRQE+TLVRS  SSS   R S SE RAE
Sbjct  472  LQIPREDARRLKFNRQESTLVRSRPSSS---RSSRSERRAE 509

Sequence Alignment: 4. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 562.0 bits 2438,  Expect = 3e-161
 Identities = 373/498 74%, Positives = 432/498 86%, Gaps = 16/498 3%
Query  1    MAKLILVSFSLCLLV--LFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQ 58
            MAK IL+S  LCL++  LFNGCL  + G  RQQ++ FG+C L+RL+ALEPTNRIEAEA  
Sbjct  1    MAKPILLSIYLCLIIVALFNGCLAQSGG--RQQHK-FGQCQLNRLDALEPTNRIEAEAGV 57
Query  59   IESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETF 118
            IESWD N QQ+QCAGVAV+RRTIEPNGLLLP+YSNAP+L+YI RGRGITGVLFPGCPETF
Sbjct  58   IESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETF 117
Query  119  EDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVS 178
            E+ Q+QSQQGQR+        +QDRHQKIRHFREGDIIA+PAGVAHWCYNDG SPVV + 
Sbjct  118  EESQRQSQQGQRR------EFQQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIF 171
Query  179  LLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSH--GEQGEQEQQGE 236
            LL T+N ANQLD+NPR+FYLAGNPDDE + QGQQ++ Q RRQQQH +  GE+GEQ Q+  
Sbjct  172  LLDTHNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQ-QRDL 230
Query  237  GNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGR-LQVVRPERSRQEWERQ 295
            GNNVFSGFDAEFLADAFNVD +TARRLQS  D R +IV+VEGR LQV+RP  SR+E E +
Sbjct  231  GNNVFSGFDAEFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHE 290
Query  296  ERQERESEQERERQRRQGGRG-RDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTV 354
            ER+ERE E+E E +RRQ  RG RD NG+EETIC+L LRENI   SRADIYTE+ GRI+TV
Sbjct  291  ERKERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTV 350
Query  355  NSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDD 414
            NS+ LP+LRWLQLSAERG L  + LYVPHWNLNAHSVVYA+RGRA VQVVD+ G TVFDD
Sbjct  351  NSHNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDD 410
Query  415  ELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAF 474
            ELR+GQ+LTIPQNFAV KRA  EGFEWV+FKTN+NA +SPLAGRTSAIRALP++VL NAF
Sbjct  411  ELREGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAF 470
Query  475  QISREEARRLKYNRQETTLVRSSRSSSERKRRSE 508
            QI RE+ARRLK+NRQE+TLVRS   SS  +RR+E
Sbjct  471  QIPREDARRLKFNRQESTLVRSRSRSSRSERRAE 504

Sequence Alignment: 5. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 332.4 bits 1431,  Expect = 4e-92
 Identities = 275/467 58%, Positives = 361/467 77%, Gaps = 61/467 13%
Query  28   RRQQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLL 87
            R+ Q     +C L++L A EP NRI+AEA QIE+W+ N   FQCAGVA  R TI+ NGL 
Sbjct  2    RQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLH 61
Query  88   LPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQG------------------- 128
            LP YSNAP+LIYI +GRG+ G +F GCPETFE+ QQ SQQG                   
Sbjct  62   LPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGR 121
Query  129  ---------QRQG-----------------QGQSQRSEQ-------DRHQKIRHFREGDI 155
                     +RQG                 QGQ  R +Q       DRHQK R  REGD+
Sbjct  122  QQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDV 181
Query  156  IALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQ---Q 212
            +A+PAGVA+W YNDGD  +V V+L+H ++  NQLD+NPR FYLAGNP++E  +QGQ   +
Sbjct  182  VAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPR 241
Query  213  QFGQRRRQQQHSH--GEQGEQEQQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKR 270
            Q G++ R  QH +  G   +QEQQG GNNVFSGF+ ++LA A+NV+ +TAR LQ   D R
Sbjct  242  QQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNR 301
Query  271  RNIVKVEGRLQVVRPERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLR 330
              I++V G L  V+P R RQE E +ERQ+ + +QER++Q    G     NG+EET CSLR
Sbjct  302  NQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQ----GEQLMANGLEETFCSLR 357
Query  331  LRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHS 390
            L+ENI    RADI++ + GRI+T+NS+ LP+LR+L+LSAERG + R G+Y PHWN+NAHS
Sbjct  358  LKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHS 417
Query  391  VVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNA 450
            VVY IRG ARVQVV++NG+ ++D E++QGQ++ +PQN  V ++A ++GFE+ AFKT +NA
Sbjct  418  VVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENA 477
Query  451  QISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTLVRSSR 498
             I+ LAGRTS +RALPD+VLANA+QISRE+AR+LKYNRQET  + SS+
Sbjct  478  FINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQ 525

Sequence Alignment: 6. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 332.4 bits 1431,  Expect = 4e-92
 Identities = 290/488 59%, Positives = 381/488 78%, Gaps = 67/488 13%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAK  +  FSLCLL++FNGCL      R+ Q     +C L++L A EP NRI+AEA QIE
Sbjct  1    MAKAFV--FSLCLLLVFNGCLAA----RQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIE 54
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +W+ N + FQCAGVA  R TI+ NGL LP YSNAP+LIYI +GRG+ G +F GCPETFE+
Sbjct  55   TWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEE 114
Query  121  PQQQSQQG----------------------------QRQG-----------------QGQ 135
             QQ SQQG                            +RQG                 QGQ
Sbjct  115  SQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQ 174
Query  136  SQRSEQ-------DRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQ 188
              R +Q       DRHQK R  REGD++A+PAGVA+W YNDGD  +V V+L+H ++  NQ
Sbjct  175  QGRPQQQQQFRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQ 234
Query  189  LDENPRHFYLAGNPDDEHQRQGQ---QQFGQRRRQQQHSH--GEQGEQEQQGEGNNVFSG 243
            LD+NPR FYLAGNP++E  +QGQ   +Q G++ R  QH +  G   +QEQQG GNNVFSG
Sbjct  235  LDQNPRKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSG 294
Query  244  FDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQERESE 303
            F+ ++LA A+NV+ +TAR LQ   D R  I++V G L  V+P R RQE E +ERQ+ + +
Sbjct  295  FNTQLLAQALNVNEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQ 354
Query  304  QERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLR 363
            QER++   QGG+    NG+EET CSLRL+ENI    RADI++ + GRI+T+NS+ LP+LR
Sbjct  355  QERQQ---QGGQLM-ANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILR 410
Query  364  WLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLT 423
            +L+LSAERG + R G+Y PHWN+NAHSVVY IRG ARVQVV++NG+ ++D E++QGQ++ 
Sbjct  411  FLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFI 470
Query  424  IPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARR 483
            +PQN  V ++A ++GFE+ AFKT +NA I+ LAGRTS +RALPD+VLANA+QISRE+AR+
Sbjct  471  VPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQ 530
Query  484  LKYNRQETTLVRSSR 498
            LKYNRQET  + SS+
Sbjct  531  LKYNRQETIALSSSQ 545

Sequence Alignment: 7. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 320.4 bits 1378,  Expect = 2e-88
 Identities = 236/479 49%, Positives = 336/479 70%, Gaps = 30/479 6%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKL+   FSLC+L LF+GC       R Q Q+   EC + +LNAL+P NRIE+E   IE
Sbjct  1    MAKLV---FSLCFL-LFSGCC-FAFSSREQPQQ--NECQIQKLNALKPDNRIESEGGLIE 53
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +W+ N++ FQCAGVA+ R T+  N L  P Y+N P+ IYI++G+GI G+++PGCP TFE+
Sbjct  54   TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEE 113
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
            PQQ  Q+GQ      S R  QDRHQKI +FREGD+IA+P GVA W YN+ D+PVV VS++
Sbjct  114  PQQPQQRGQ------SSRP-QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 166
Query  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
             TN+  NQLD+ PR FYLAGN + E  +  Q+Q G++ ++ +H      +QE++ EG ++
Sbjct  167  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKH------QQEEENEGGSI 220
Query  241  FSGFDAEFLADAFNVDVDTARRLQS-NQDKRRN-IVKVEGRLQVVRPERSRQEWERQERQ 298
            +SGF  EFL  AF+VD   A+ LQ  N+ + +  IV V+G L V++P    Q+   QE +
Sbjct  221  LSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE 280
Query  299  ERESEQ-------ERERQRRQGGRGRDV-NGFEETICSLRLRENICTRSRADIYTEQVGR 350
            E E ++       ++  QR +G + +   NG +ETIC++RLR NI   S  DIY  Q G 
Sbjct  281  EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGS 340
Query  351  INTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNT 410
            + T  S  +P L WL+LSAE G L++  ++VPH+NLNA+S++YA+ GRA +QVV+ NG  
Sbjct  341  VTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER 400
Query  411  VFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVL 470
            VFD EL++G+VL +PQNF VA R++S+ FE+V+FKTND   I  LAG  S + ALP++V+
Sbjct  401  VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVI 460
Query  471  ANAFQISREEARRLKYNRQETTLVRSSRS 499
             + F +  ++AR++K N     LV    S
Sbjct  461  QHTFNLKSQQARQIKNNNPFKFLVPPQES 489

Sequence Alignment: 8. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 320.4 bits 1378,  Expect = 2e-88
 Identities = 236/479 49%, Positives = 336/479 70%, Gaps = 30/479 6%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKL+   FSLC+L LF+GC       R Q Q+   EC + +LNAL+P NRIE+E   IE
Sbjct  1    MAKLV---FSLCFL-LFSGCC-FAFSSREQPQQ--NECQIQKLNALKPDNRIESEGGLIE 53
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +W+ N++ FQCAGVA+ R T+  N L  P Y+N P+ IYI++G+GI G+++PGCP TFE+
Sbjct  54   TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEE 113
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
            PQQ  Q+GQ      S R  QDRHQKI +FREGD+IA+P GVA W YN+ D+PVV VS++
Sbjct  114  PQQPQQRGQ------SSRP-QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 166
Query  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
             TN+  NQLD+ PR FYLAGN + E  +  Q+Q G++ ++ +H      +QE++ EG ++
Sbjct  167  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKH------QQEEENEGGSI 220
Query  241  FSGFDAEFLADAFNVDVDTARRLQS-NQDKRRN-IVKVEGRLQVVRPERSRQEWERQERQ 298
            +SGF  EFL  AF+VD   A+ LQ  N+ + +  IV V+G L V++P    Q+   QE +
Sbjct  221  LSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE 280
Query  299  ERESEQ-------ERERQRRQGGRGRDV-NGFEETICSLRLRENICTRSRADIYTEQVGR 350
            E E ++       ++  QR +G + +   NG +ETIC++RLR NI   S  DIY  Q G 
Sbjct  281  EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGS 340
Query  351  INTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNT 410
            + T  S  +P L WL+LSAE G L++  ++VPH+NLNA+S++YA+ GRA +QVV+ NG  
Sbjct  341  VTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER 400
Query  411  VFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVL 470
            VFD EL++G+VL +PQNF VA R++S+ FE+V+FKTND   I  LAG  S + ALP++V+
Sbjct  401  VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVI 460
Query  471  ANAFQISREEARRLKYNRQETTLVRSSRS 499
             + F +  ++AR++K N     LV    S
Sbjct  461  QHTFNLKSQQARQIKNNNPFKFLVPPQES 489

Sequence Alignment: 9. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 319.9 bits 1376,  Expect = 2e-88
 Identities = 291/473 61%, Positives = 362/473 76%, Gaps = 45/473 9%
Query  12   CLLVLFNGCLGINVGLRRQQQRYFG---ECNLDRLNALEPTNRIEAEACQIESWDHNDQQ 68
            CLL+LFNGCL         +Q  FG   E  L++L A EP N I++EA   ESW+ +D Q
Sbjct  1    CLLLLFNGCLA-------SRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQ 53
Query  69   FQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED--PQQ-QS 125
            FQ AGVAV+RRTIEPNGL LP Y NAP+LIYI RGRG+ G +FPGC ETFED  PQQ Q 
Sbjct  54   FQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQ 113
Query  126  QQGQRQ--------GQGQSQ---RSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPV 174
            QQ Q+Q        GQGQ Q     +QDRHQKIRH REGDIIALPAGVA+W YN+G+ P+
Sbjct  114  QQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPL 173
Query  175  VTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQ 234
            V VSLL  NN  NQLD+ PR FYLAGNP DE   Q      Q+ RQQQ     Q +Q QQ
Sbjct  174  VAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQ------QQGRQQQ-----QQQQGQQ 222
Query  235  GEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRP-ERSRQEWE 293
            G GNN+FSGFD ++LA A+NV+ +TAR LQ   D R  IV+V+G+L  V P  RS     
Sbjct  223  GNGNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRG 282
Query  294  RQERQERESEQERER------QRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQ 347
             QERQ+ E + +RER      Q +QGG G+D NG EET CS RL +NI   SRAD Y  Q
Sbjct  283  DQERQQEEQQSQREREEKQREQEQQGGGGQD-NGVEETFCSARLSQNIGDPSRADFYNPQ 341
Query  348  VGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDN 407
             GRI+ VN N LP+LR+L+LSAE+G L    +Y PHW+ NA+++VYAIRG ARVQVV++N
Sbjct  342  GGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNEN 401
Query  408  GNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPD 467
            G+ ++DDE+R+GQ++ IPQN AV  +A +EGFE+++F+T++N   + LAGRTS +RALPD
Sbjct  402  GDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPD 461
Query  468  DVLANAFQISREEARRLKYNRQETTLVRSSRSSSERKR 505
            +VL NAF+ISR+EAR LKYNRQE+ L+  S +S  R R
Sbjct  462  EVLQNAFRISRQEARNLKYNRQESRLL--SATSPPRGR 497

Sequence Alignment: 10. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 298.0 bits 1280,  Expect = 8e-82
 Identities = 257/471 54%, Positives = 349/471 74%, Gaps = 49/471 10%
Query  11   LCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQ 70
            L LL LFNGCL       +Q Q    EC ++RL A  P  RI +EA   E W+ N QQ++
Sbjct  10   LSLLFLFNGCLARQTFSSQQSQ---NECQINRLRASAPQTRIRSEAGTTEWWNPNCQQLR 66
Query  71   CAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQR 130
            CAGV+V+R+TIEPNGL+LP ++NAP+L+YI +GRGI G++ PGC ETF+D    SQQ Q 
Sbjct  67   CAGVSVMRQTIEPNGLVLPSFTNAPQLLYIVQGRGIQGIVMPGCAETFQD----SQQWQH 122
Query  131  QGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLD 190
            Q +G+     QD+HQK+R FR+GDIIALP GV HW YNDG+  VVT++LL T N ANQLD
Sbjct  123  QSRGRF----QDQHQKVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLLDTGNSANQLD 178
Query  191  ENPRHFYLAGNPDDEHQRQ----GQQQFGQRRR----QQQHSHGEQGE-----------Q 231
              PR F+LAGNP++E QRQ     QQ  G+  R    +++   GE+ E           Q
Sbjct  179  NIPRRFHLAGNPEEE-QRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRHQ 237
Query  232  EQQGEG------NNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRP 285
            E++ +G      NN++  FD  FLA AFNVD D  R++Q  +  R  I++V  RLQVV P
Sbjct  238  EEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRVRGNRGTIIRVRDRLQVVTP 297
Query  286  ERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYT 345
             R     E +ER+ER+ EQ R R+ R G +    NG+EET CS+R++EN+    RADI+ 
Sbjct  298  PR----MEEEEREERQQEQ-RYRHTRGGSQD---NGLEETFCSMRIKENLADPERADIFN 349
Query  346  EQVGRINTVNSNTLPVLRWLQLSAERGDL-QREGLYVPHWNLNAHSVVYAIRGRARVQVV 404
             Q GRI+T+N   LP+L+ L+LSAERG L  R GL +P+WN+NAH ++Y +RG ARVQVV
Sbjct  350  PQAGRISTLNRFNLPILQRLELSAERGVLYNRAGL-IPQWNVNAHKILYMLRGCARVQVV 408
Query  405  DDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRA 464
            + NG+ VFDD + QGQ+LT+PQNFA  K+A +EG EW++F TN  A  +P+AG  S +RA
Sbjct  409  NHNGDAVFDDNVEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTPMAGSVSFMRA 468
Query  465  LPDDVLANAFQISREEARRLKYNRQETTLVRSSRSSSERK 504
            LP++V+A ++Q+SRE+ARR+K+N + T +   + S SER+
Sbjct  469  LPEEVVAASYQVSREDARRIKFNNKNTFFF--TPSQSERR 506

Sequence Alignment: 11. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 271.6 bits 1164,  Expect = 8e-74
 Identities = 257/491 52%, Positives = 352/491 71%, Gaps = 37/491 7%
Query  1    MAKLILVSFSLCLLVLFNGCLG-INV----------GLRRQQQ-RYFGECNLDRLNALEP 48
            MA   L+SFS+CLLVLF+GC   I++          G  +Q Q R+  +C L  LNAL+P
Sbjct  1    MAYTSLLSFSVCLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQCQLQNLNALQP 60
Query  49   TNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITG 108
             +R  +EA + E WD+N+ QFQCAGVA +R  I+  GLLLP +++AP L Y+E+G GI G
Sbjct  61   KHRFRSEAGETEFWDQNEDQFQCAGVAFLRHKIQRKGLLLPSFTSAPMLFYVEQGEGIHG 120
Query  109  VLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYN 168
             +FPGCPET+   Q QSQQ  +       R ++D+HQK+R ++EGD++ALPAGVAHW +N
Sbjct  121  AVFPGCPETY---QSQSQQNIQD------RPQRDQHQKLRRLKEGDVVALPAGVAHWIFN 171
Query  169  DGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQ 228
            +G S +V V+L+   N ANQLDEN R F+LAG+P     R GQ +  + +RQ +   GE+
Sbjct  172  NGRSQLVLVALVDVGNDANQLDENFRKFFLAGSPQGGVVRGGQSR-DRNQRQSRTQRGER 230
Query  229  GEQE-QQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVE--------GR 279
             E+E Q+  GNNV+SGF   +LA AF +D   AR+LQ+ +D R  IV++E        G+
Sbjct  231  EEEESQESGGNNVLSGFRDNLLAQAFGIDTRLARKLQNERDNRGAIVRMEHGFEWPEEGQ 290
Query  280  LQVVRPERSRQE----WERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENI 335
             +  R E   +E    W+R++  + E  +E ER+ R  GR R  NG+EET CS+RL+   
Sbjct  291  RRQGREEEGEEEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHRT 350
Query  336  CTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAI 395
               S AD++  + GRI TVNS  LP+L++LQLSAERG L    +Y PHWN+NAHS+VY  
Sbjct  351  -PASSADVFNPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVYIT 409
Query  396  RGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPL 455
            RG  R+Q+V +NG  +FD+++ +GQV+T+PQN AV K+A   GFEW+AFKTN NA+IS +
Sbjct  410  RGNGRIQIVSENGEAIFDEQVERGQVITVPQNHAVVKKAGRRGFEWIAFKTNANAKISQI 469
Query  456  AGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTLVRSSRSSSER 503
            AGR S +R LP DVLAN+F ISREEA RLK+NRQE + V S R  S++
Sbjct  470  AGRVSIMRGLPVDVLANSFGISREEAMRLKHNRQEVS-VFSPRQGSQQ 516

Sequence Alignment: 12. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 259.3 bits 1110,  Expect = 4e-70
 Identities = 243/472 51%, Positives = 337/472 71%, Gaps = 30/472 6%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKL+L   SLC+L LF+GC      +R Q Q+   EC + RLNAL+P NRIE+E   IE
Sbjct  1    MAKLVL---SLCFL-LFSGCC-FAFSFREQPQQ--NECQIQRLNALKPDNRIESEGGFIE 53
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +W+ N++ FQCAGVA+ R T+  N L  P Y+NAP+ IYI++G GI G++FPGCP TFE+
Sbjct  54   TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEE 113
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
            PQQ+         GQS R  QDRHQKI HFREGD+IA+P G A+W YN+ D+PVV VSL+
Sbjct  114  PQQK---------GQSSRP-QDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLI 163
Query  181  HTNNYANQLDENPRHFYLAGNPDDEH-QRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNN 239
             TN++ NQLD+ PR FYLAGN + E  Q Q Q+Q G  + Q+    G++ +QE++ EG +
Sbjct  164  DTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQK----GKR-QQEEENEGGS 218
Query  240  VFSGFDAEFLADAFNVDVDTARRLQS-NQDKRRN-IVKVEGRLQVVRPERSRQEWERQER 297
            ++SGF  EFL  AF VD    R+LQ  N+++ +  IV V+G L V+ P    Q+ +R E 
Sbjct  219  ILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQ-QRPEE 277
Query  298  QERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSN 357
            +E+    E++++ +   R    NG +ETIC++RLR NI   S  DI+  Q G I T  S 
Sbjct  278  EEKPDCDEKDKHCQSQSR----NGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSL 333
Query  358  TLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELR 417
             +P L WL+LSA+ G L++  ++VPH+NLNA+S++YA+ GRA VQVV+ NG  VFD EL+
Sbjct  334  DFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQ 393
Query  418  QGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQIS 477
            +GQVL +PQNFAVA R++S+ FE+V+FKTND   I  LAG  S + ALP++V+   F + 
Sbjct  394  EGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLR 453
Query  478  REEARRLKYNRQETTLVRSSRS 499
            R++AR++K N   + LV    S
Sbjct  454  RQQARQVKNNNPFSFLVPPKES 475

Sequence Alignment: 13. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 252.0 bits 1078,  Expect = 6e-68
 Identities = 240/478 50%, Positives = 337/478 70%, Gaps = 34/478 7%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKL+L   SLC+L LF+GC+     LR Q Q+   EC + +LNAL+P NRIE+E   IE
Sbjct  1    MAKLVL---SLCFL-LFSGCFA----LREQAQQ--NECQIQKLNALKPDNRIESEGGFIE 50
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +W+ N++ FQCAGVA+ R T+  N L  P Y+N P+ IYI++G GI G++FPGCP T+++
Sbjct  51   TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQE 110
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
            PQ+ SQQ     +G+SQR  QDRHQK+  FREGD+IA+P GVA W YN+ D+PVV VS++
Sbjct  111  PQE-SQQ-----RGRSQRP-QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 163
Query  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
             TN+  NQLD+ PR FYLAGN + E  +  QQQ G  + Q+    G+Q  QE++ EG+N+
Sbjct  164  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQK----GKQ--QEEENEGSNI 217
Query  241  FSGFDAEFLADAFNVDVDTARRLQSNQDKRRN--IVKVEGRLQVVRPERSRQEWERQERQ 298
            +SGF  EFL +AF V++   R LQ   ++  +  IV V+G L+V  P   + + E  +  
Sbjct  218  LSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDD 277
Query  299  ERESEQERERQR---RQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVN 355
            E E  Q  E  +   RQ  R R  NG +ETIC++RLR+NI   S  DIY  Q G I T  
Sbjct  278  EEEQPQCVETDKGCQRQSKRSR--NGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTAT 335
Query  356  SNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDE 415
            S  +P L  L+LSA+ G L++  ++VPH+ LNA+S++YA+ GRA VQVV+ NG  VFD E
Sbjct  336  SLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGE 395
Query  416  LRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQ 475
            L++G VL +PQNFAVA +++S+ FE+V+FKTND   I  LAG  S + ALP++V+ + F 
Sbjct  396  LQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFN 455
Query  476  ISREEARRLKYNRQETTLVRSSRSSSERKRRS 507
            +  ++AR++K N   + LV       E +RR+
Sbjct  456  LKSQQARQVKNNNPFSFLV----PPQESQRRA 483

Sequence Alignment: 14. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 252.0 bits 1078,  Expect = 6e-68
 Identities = 240/478 50%, Positives = 337/478 70%, Gaps = 34/478 7%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKL+L   SLC+L LF+GC+     LR Q Q+   EC + +LNAL+P NRIE+E   IE
Sbjct  1    MAKLVL---SLCFL-LFSGCFA----LREQAQQ--NECQIQKLNALKPDNRIESEGGFIE 50
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +W+ N++ FQCAGVA+ R T+  N L  P Y+N P+ IYI++G GI G++FPGCP T+++
Sbjct  51   TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQE 110
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
            PQ+ SQQ     +G+SQR  QDRHQK+  FREGD+IA+P GVA W YN+ D+PVV VS++
Sbjct  111  PQE-SQQ-----RGRSQRP-QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 163
Query  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
             TN+  NQLD+ PR FYLAGN + E  +  QQQ G  + Q+    G+Q  QE++ EG+N+
Sbjct  164  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQK----GKQ--QEEENEGSNI 217
Query  241  FSGFDAEFLADAFNVDVDTARRLQSNQDKRRN--IVKVEGRLQVVRPERSRQEWERQERQ 298
            +SGF  EFL +AF V++   R LQ   ++  +  IV V+G L+V  P   + + E  +  
Sbjct  218  LSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDD 277
Query  299  ERESEQERERQR---RQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVN 355
            E E  Q  E  +   RQ  R R  NG +ETIC++RLR+NI   S  DIY  Q G I T  
Sbjct  278  EEEQPQCVETDKGCQRQSKRSR--NGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTAT 335
Query  356  SNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDE 415
            S  +P L  L+LSA+ G L++  ++VPH+ LNA+S++YA+ GRA VQVV+ NG  VFD E
Sbjct  336  SLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGE 395
Query  416  LRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQ 475
            L++G VL +PQNFAVA +++S+ FE+V+FKTND   I  LAG  S + ALP++V+ + F 
Sbjct  396  LQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFN 455
Query  476  ISREEARRLKYNRQETTLVRSSRSSSERKRRS 507
            +  ++AR++K N   + LV       E +RR+
Sbjct  456  LKSQQARQVKNNNPFSFLV----PPQESQRRA 483

Sequence Alignment: 15. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 230.6 bits 984,  Expect = 1e-61
 Identities = 276/453 60%, Positives = 354/453 78%, Gaps = 43/453 9%
Query  9    FSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQ 68
            +S+C+L+LF+GCL       RQ+ +   EC +DRL+ALEP NR+E EA  +E+WD N +Q
Sbjct  1    LSVCFLILFHGCLA-----SRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQ 55
Query  69   FQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQG 128
            F+CAGVA++R TI+PNGLLLPQYSNAP+LIY+ +G G+TG+ +PGCPET++ PQQ  QQG
Sbjct  56   FRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQG 115
Query  129  QRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQ 188
            Q      S R  QDRHQKIR FR GDIIA+PAGVAHWCYN+G+SPVVTV+LL  +N  NQ
Sbjct  116  Q------SGRF-QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQ 168
Query  189  LDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEF 248
            LD  PR F+LAGNP D  Q+Q           QQH          Q  G N+FSGFD E+
Sbjct  169  LDRTPRKFHLAGNPKDVFQQQ-----------QQH----------QSRGRNLFSGFDTEL 207
Query  249  LADAFNVDVDTARRLQSNQDKRRNIVKV-EGRLQVVRPERSRQEWERQERQERESEQERE 307
            LA+AF VD    ++L+S +D R  IVKV +  L+V+RP RS+   ER    E ESE E+ 
Sbjct  208  LAEAFQVDERLIKQLKS-EDNRGGIVKVKDDELRVIRPSRSQS--ERGSESEEESEDEK- 263
Query  308  RQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQL 367
              RR G R    NG EETIC++RL+ENI   +RADIYT +VGR+ T+NS  LP+L+WLQL
Sbjct  264  --RRWGQRD---NGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQL 318
Query  368  SAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQN 427
            S E+G L +  L +PHWNLN+HS++Y  +G+ +VQVVD+ GN VFD E+R+GQ+L +PQN
Sbjct  319  SVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQN 378
Query  428  FAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYN 487
            FAV KRA  E FEW++FKTND A  SPLAGRTS +  +P++VLANAFQISRE+AR++K+N
Sbjct  379  FAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFN 438
Query  488  RQETTLVRSSRSSSER 503
             Q+TTL     S   R
Sbjct  439  NQQTTLTSGESSHHMR 454

Sequence Alignment: 16. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 229.9 bits 981,  Expect = 3e-61
 Identities = 244/457 53%, Positives = 332/457 72%, Gaps = 77/457 16%
Query  1    MAKL--ILVSFSLCLLVLFNGCLG-INVGLRRQQQRYFGECNLDRLNALEPTNRIEAEAC 57
            M KL  +LV+    LLVL NGCL   ++G+  Q +     CNLD L+ L+PT  I++EA 
Sbjct  1    MVKLAHLLVATVGVLLVL-NGCLARQSLGVPPQVK---DACNLDNLDVLQPTEVIKSEAG 56
Query  58   QIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPET 117
            Q+E WDHN  Q +CAGV++ R  I+  GL LP + ++P + Y+ +G GI+G + PGC ET
Sbjct  57   QVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAET 116
Query  118  FEDPQ-QQSQQGQRQGQ-GQS-QRSEQ--------------------------------D 142
            F D Q  Q QQGQ+QGQ GQ  Q+ +Q                                D
Sbjct  117  FMDSQPMQGQQGQQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRD 176
Query  143  RHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNP 202
             HQK+ H R GD IA+  G A+W YN GD P++ VSL+   NY NQLD NPR F LAGN 
Sbjct  177  MHQKVEHVRHGDAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGN- 235
Query  203  DDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVDVDTARR 262
                 +QG  Q      QQQ        Q+QQ    N++SGFD + LA A+ +DV  A+ 
Sbjct  236  ----NQQGSSQ------QQQ--------QQQQ----NILSGFDPQVLAQALKIDVRLAQE 273
Query  263  LQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQERESEQERERQRRQGGRGRDVNGF 322
            LQ+ QDKR NIV+V+G +QVVRP           RQ  ESEQ R   R      +D NG+
Sbjct  274  LQNQQDKRGNIVRVKGPFQVVRP---------PLRQAYESEQWRH-PRGPPQSPQD-NGL 322
Query  323  EETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVP 382
            EETICS+R  ENI   +RADIY   +GR+ +VNS TLP+L++++LSA RG LQ   + +P
Sbjct  323  EETICSMRTHENIDDPARADIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLP 382
Query  383  HWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWV 442
             +N+NA+ ++Y  +G+AR+QVV+DNG  V+D ++++GQ++ IPQ FA   ++++  FEW+
Sbjct  383  KYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQNN-FEWI 441
Query  443  AFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTLVRS 496
            +FKTN NA IS LAGRTSA+RALP +V+ NA+QIS EEAR++K+N  ETTL R+
Sbjct  442  SFKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFNTLETTLTRA 495

Sequence Alignment: 17. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 202.7 bits 862,  Expect = 4e-53
 Identities = 289/470 61%, Positives = 371/470 78%, Gaps = 35/470 7%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MA   L+S+S+CLL+LF+GCL       RQQ +   EC +D+L+ALEP NR+E EA  +E
Sbjct  1    MANPSLLSLSVCLLILFHGCLA-----SRQQGQQQNECQIDQLDALEPDNRVEYEAGMVE 55
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +WD N +QF+CAGVAV R TI+PNGL LP+YSNAP L+YI  G G+TG L PGCPET++ 
Sbjct  56   TWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQA 115
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
            PQ    QGQ++GQ  S R  QD+HQKI+ FR+GDIIALPAGVA+WCYN+G+SPVVTV+LL
Sbjct  116  PQ----QGQQHGQ--SSRF-QDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLL 168
Query  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
              +N  NQLD  PR F LAGNP+DE Q+Q QQQ   RR+ QQ S             NN+
Sbjct  169  DVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQQSRGRRQSQQKS------------CNNI 216
Query  241  FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER 300
            F GFD + LA+ F V+    ++LQ+ +D R  IVKV+G LQV+RP R      RQ  +  
Sbjct  217  FCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPR------RQSERGF 270
Query  301  ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP 360
            ESE+E E +R  G RGRD NG+EETIC+++L+ENI   SR+DIYT +VGRI ++NS  LP
Sbjct  271  ESEEESEYER--GRRGRD-NGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLP 327
Query  361  VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ 420
            +L+WLQLSAERG LQ   L VPHWN+NAHS+VY  +G A+VQVVD+ GNTVFD E+ +GQ
Sbjct  328  ILKWLQLSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQ 387
Query  421  VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE 480
            ++ +PQNFAV KRA  + FEW++FKTND A ISPLAG TS +RA+P++VLANAFQISRE+
Sbjct  388  IFVVPQNFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISRED 447
Query  481  ARRLKYNRQETTLVRSSRSSSERKR 505
            AR++K+N ++ TL  SS  SS++ R
Sbjct  448  ARKIKFNNEQPTL--SSGQSSQQMR 470

Sequence Alignment: 18. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 197.5 bits 839,  Expect = 2e-51
 Identities = 233/470 49%, Positives = 314/470 66%, Gaps = 33/470 7%
Query  30   QQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLP 89
            +QQ     C + RLNA  P NRIE+E   IE+W+ N+Q+F+CAGVA+ R  +  N L  P
Sbjct  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
Query  90   QYSNAPELIYIERGRGITGVLFPGCPETFEDPQ-----QQSQQGQRQGQGQSQRSEQ-DR 143
             YSNAP+ I+I++GRG  G++FPGCP  +E+P+      QSQ+  R+ QG+ Q  +Q D 
Sbjct  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
Query  144  HQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPD 203
            HQK+  F EGD+IA+P GVA W YND D+ VV VSL  TNN  NQLD+ PR F LAGN +
Sbjct  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
Query  204  DEHQRQGQQQFGQRRR--------------QQ--------QHSHGEQGEQEQQGEGNNVF 241
             E  R  QQ    RRR              Q+        QHS  E+  QE++ EG N+F
Sbjct  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
Query  242  SGFDAEFLADAFNVD---VDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQ 298
            SGF  EFL  AF VD   +    R ++  ++   IV V G L+++ P+R R+  E +E  
Sbjct  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
Query  299  ERESEQERERQRR-QGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSN 357
            E E E + E +RR +G RGR  NG EETIC+   ++NI      DIY  Q G + T N  
Sbjct  301  EDEYEYDEEDRRRGRGSRGRG-NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 359
Query  358  TLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELR 417
             L +LRWL  SAE G+L R  L+V H+N NAHS++Y +RGRA VQVVD NGN V+D+EL+
Sbjct  360  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 419
Query  418  QGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQIS 477
            +G+VL +PQNFAVA +++SE FE+VAFKT+    I+ LAG  S I  LP++V+AN++ + 
Sbjct  420  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQ 479
Query  478  REEARRLKYNRQETTLVRSSRSS 500
            RE+AR+LK N     +V  S+ S
Sbjct  480  REQARQLKNNNPFKFFVPPSQQS 502

Sequence Alignment: 19. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 197.5 bits 839,  Expect = 2e-51
 Identities = 233/470 49%, Positives = 314/470 66%, Gaps = 33/470 7%
Query  30   QQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLP 89
            +QQ     C + RLNA  P NRIE+E   IE+W+ N+Q+F+CAGVA+ R  +  N L  P
Sbjct  4    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 63
Query  90   QYSNAPELIYIERGRGITGVLFPGCPETFEDPQ-----QQSQQGQRQGQGQSQRSEQ-DR 143
             YSNAP+ I+I++GRG  G++FPGCP  +E+P+      QSQ+  R+ QG+ Q  +Q D 
Sbjct  64   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 123
Query  144  HQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPD 203
            HQK+  F EGD+IA+P GVA W YND D+ VV VSL  TNN  NQLD+ PR F LAGN +
Sbjct  124  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 183
Query  204  DEHQRQGQQQFGQRRR--------------QQ--------QHSHGEQGEQEQQGEGNNVF 241
             E  R  QQ    RRR              Q+        QHS  E+  QE++ EG N+F
Sbjct  184  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 243
Query  242  SGFDAEFLADAFNVD---VDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQ 298
            SGF  EFL  AF VD   +    R ++  ++   IV V G L+++ P+R R+  E +E  
Sbjct  244  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 303
Query  299  ERESEQERERQRR-QGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSN 357
            E E E + E +RR +G RGR  NG EETIC+   ++NI      DIY  Q G + T N  
Sbjct  304  EDEYEYDEEDRRRGRGSRGRG-NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDL 362
Query  358  TLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELR 417
             L +LRWL  SAE G+L R  L+V H+N NAHS++Y +RGRA VQVVD NGN V+D+EL+
Sbjct  363  NLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQ 422
Query  418  QGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQIS 477
            +G+VL +PQNFAVA +++SE FE+VAFKT+    I+ LAG  S I  LP++V+AN++ + 
Sbjct  423  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQ 482
Query  478  REEARRLKYNRQETTLVRSSRSS 500
            RE+AR+LK N     +V  S+ S
Sbjct  483  REQARQLKNNNPFKFFVPPSQQS 505

Sequence Alignment: 20. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 190.2 bits 807,  Expect = 2e-49
 Identities = 259/479 54%, Positives = 350/479 73%, Gaps = 35/479 7%
Query  6    LVSFSLCLLVLFNGCLG-----INVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            L+SFSL +L+LF+  +      +N   R+QQQR+  +C +  LNALEP  RIE+EA   E
Sbjct  6    LLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTE 65
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
             WD+N++Q+QCA VAV R TI+  GLL+P Y NAPEL+Y+ +G GI G +FPGCPETF  
Sbjct  66   FWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCPETF-- 123
Query  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
             Q++SQ   R  + Q Q  EQ  HQK+R  +EGD+IALPAGVAHW YN+G S +V V+L 
Sbjct  124  -QEESQSRSRSERSQ-QSGEQ--HQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALA 179
Query  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
               N  NQLD+  R F L G+P  E Q  GQ +   R + Q    G+QG+Q      NN+
Sbjct  180  DVGNSENQLDQYLRKFVLGGSPQQEIQGSGQSR--SRSQSQSSRRGQQGQQ-----SNNI 232
Query  241  FSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER 300
            +S FD E LA +FN+D   ARRLQ  + +R  IV+V+  L+V+ P   RQE      QE+
Sbjct  233  LSAFDEEILAQSFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPH--RQE------QEQ 284
Query  301  ESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLP 360
            E E+ERER++R        NG+EET C++ L+ NI   SRAD+Y  + GR+++VN+  LP
Sbjct  285  EYEEERERRQR--------NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLP 336
Query  361  VLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQ 420
            +LR+LQLSA++G L+R+ +  PHWN+NAHS+VY  RG  R+Q+V +NG +VFD+E+R+GQ
Sbjct  337  ILRFLQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREGQ 396
Query  421  VLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREE 480
            ++ +PQNFAV KRA S+ FEWV+FKTN  +Q S LAGR S  RALP DV+ N+F ISRE+
Sbjct  397  LVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISRED 456
Query  481  ARRLKYNRQETTLVRSSRSSSERKRRSESEGRAE 514
            ARRLK +R ETT+  +  SSS+RK +SE E + E
Sbjct  457  ARRLKESRSETTIF-APGSSSQRKSQSERERQRE 489

Sequence Alignment: 21. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 182.7 bits 774,  Expect = 5e-47
 Identities = 239/479 49%, Positives = 326/479 68%, Gaps = 41/479 8%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKL+ +SF +C+LVL  G   I+    RQQ      C + RLNA  P NRIE+E   IE
Sbjct  1    MAKLLELSFCFCFLVL--GASSISF---RQQPEE-NACQFQRLNAQRPDNRIESEGGYIE 54
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
            +W+ N+Q+F+CAGVA+ R  +  N L  P YSNAP+ I+I++GRG  G++FPGCP T+E+
Sbjct  55   TWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEE 114
Query  121  PQQQSQ--QGQR-----QGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSP 173
            P QQ +  Q QR     Q + QSQ+ +QD HQK+  F EGD+IA+P GVA W YND D+ 
Sbjct  115  PAQQGRRYQSQRPPRRLQEEDQSQQ-QQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTD 173
Query  174  VVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRR-------------- 219
            VV VSL  TNN  NQLD+ PR F LAGN + E  R  QQ    RRR              
Sbjct  174  VVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPR 233
Query  220  --------QQQHSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVD-VDTARRL--QSNQD 268
                    + QHS  E+  QE++ EG N+FSGF  EFL  AF VD     + L  ++  +
Sbjct  234  REEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESE 293
Query  269  KRRNIVKVEGRLQVVRPERSRQEWERQERQERESE-QERERQRRQGGRGRDVNGFEETIC 327
            +   IV V G L+++ P+ +R   E +E  E + E +E++ +R +G RG   NG EETIC
Sbjct  294  EEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGG-NGIEETIC 352
Query  328  SLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLN 387
            +  +++NI       IY  Q       +   L +LRWL LSAE G+L R  L+VPH+N N
Sbjct  353  TACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTN 412
Query  388  AHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTN 447
            AHS++YA+RGRA VQVVD NGN V+D+EL++G+VL +PQNFAVA +++SE FE+VAFKT+
Sbjct  413  AHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTD 472
Query  448  DNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYN 487
                I+ +AG  S I  LP++V+AN++ + RE+AR+LK N
Sbjct  473  SRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNN 512

Sequence Alignment: 22. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 181.3 bits 768,  Expect = 1e-46
 Identities = 232/483 48%, Positives = 335/483 69%, Gaps = 72/483 14%
Query  3    KLILVSFSLCLLVLFNGC----LGINVGLRRQ----QQRYFGECNLDRLNALEPTNRIEA 54
            KLIL SFSLCL+VL   C    L    G R +    +Q++  +C++ RL A EP+ R+ +
Sbjct  4    KLIL-SFSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLTASEPSRRVRS 60
Query  55   EACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGC 114
            EA   E WDH+  +F+CAG   +R  I+P GLLLP YSNAP + ++E+GRG+ GV+ PGC
Sbjct  61   EAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGC 120
Query  115  PETF------EDPQQQSQQGQRQGQ-GQSQRSEQ-------------------------- 141
            PETF      E P+ Q  Q  RQ + G+S R +Q                          
Sbjct  121  PETFQSGSEFEYPRSQRDQRSRQSESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFS 180
Query  142  --DRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLA 199
              D+HQKI   R+GD+I  PAGV +W +N+GD+ +++++L   N++ NQLDEN R+F+LA
Sbjct  181  RGDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLA 240
Query  200  GNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEG---NNVFSGFDAEFLADAF-NV 255
            G     + +Q ++    +R+ ++     Q  + Q  E     N++SGF+ E L + F NV
Sbjct  241  G-----QSKQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNV 295
Query  256  DVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQERESEQERER-QRRQGG 314
            D +T  +L+   D+R  IV+    L++  PE            E E E +RER  R++GG
Sbjct  296  DQETISKLRGENDQRGFIVQARD-LKLRVPE------------EYEEELQRERGDRKRGG 342
Query  315  RGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDL 374
             GR  NG+E+  C+L++R+N+   SRAD++  + GRINTV+SN LP+L ++QLSA+   L
Sbjct  343  SGRS-NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVL 401
Query  375  QREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRA 434
             +  +  P WNLNAHS +Y  RG  RVQVV D G +VFDD +++GQ+L +PQ FAV  +A
Sbjct  402  YKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKA 461
Query  435  ESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTLV 494
              EG+EWV +K +DNA  SP+AG+TS +RA+P +VLAN++ IS +EA RLK  RQE  + 
Sbjct  462  GREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVF 521
Query  495  R--SSRSSSERKRRS 507
            R   SR   ER+R S
Sbjct  522  RPFQSRDEKERERFS 536

Sequence Alignment: 23. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 179.7 bits 761,  Expect = 3e-46
 Identities = 259/467 55%, Positives = 336/467 71%, Gaps = 55/467 11%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVG--------LRRQQQRYFG---ECNLDRLNALEPT 49
            MA   L+SF + + +L  G      G        L+ QQQ  +    +C ++RL A EPT
Sbjct  1    MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCRVERLTAQEPT 60
Query  50   NRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGV 109
             R E+EA   E WD N+QQF+CAGVA +R  I+P GLLLP+Y+NAP+L+Y+ RGRGI G 
Sbjct  61   IRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLPHYNNAPQLLYVVRGRGIQGT 120
Query  110  LFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYND 169
            + PGC ETFE   Q  Q  +R+          DRHQK+R+FR+GDI+ALPAG+  W YN+
Sbjct  121  VIPGCAETFERDTQPRQDRRRR--------FMDRHQKVRQFRQGDILALPAGLTLWFYNN 172
Query  170  GDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQG 229
            G  P++TV+LL T N ANQLD+  RHF+LAGNP    Q   Q  FG   R Q        
Sbjct  173  GGEPLITVALLDTGNAANQLDQTFRHFFLAGNP----QGGRQSYFG---RPQT------- 218
Query  230  EQEQQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSR 289
             ++QQGE  N+F+GFD E LADAF VDV TARRL+   D R  IV+ E RL +V P    
Sbjct  219  -EKQQGETKNIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRAE-RLDIVLP---- 272
Query  290  QEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVG 349
                         E+E ER  R    G   NG+EET+C+ +LREN+   +RAD+Y  + G
Sbjct  273  ------------GEEEEERWERDPYSG--ANGLEETLCTAKLRENLDEPARADVYNPHGG 318
Query  350  RINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGN 409
            RI+++NS TLPVL WL+LSAE+G L R GL  PHWNLNAHS++Y  RG  R QVV   G 
Sbjct  319  RISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGR 378
Query  410  TVFDDELRQGQVLTIPQNFAVAKRA-ESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDD 468
            +VFD  +R+GQ++ +PQN+ VAKRA + EG+EW++FKTNDNA  S LAGR SAIRA+P++
Sbjct  379  SVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEE 438
Query  469  VLANAFQISREEARRLKYNRQETTLVRS-SRSSSERKRRSES 509
            V+  A+Q+SR+EARRLKYNR+E+ +  S SR S  R  R  S
Sbjct  439  VVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMS 480

Sequence Alignment: 24. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 177.6 bits 752,  Expect = 2e-45
 Identities = 228/484 47%, Positives = 331/484 68%, Gaps = 96/484 19%
Query  3    KLILVSFSLCLLVLFNGC----LGINVGLR----RQQQRYFGECNLDRLNALEPTNRIEA 54
            KLIL SFSLCL+VL   C    L    G R    R +Q++  +C++ RL A EP+ R+ +
Sbjct  4    KLIL-SFSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLTASEPSRRVRS 60
Query  55   EACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGC 114
            EA   E WD++  +F+CAG   +R  I+P GLLLP YSNAP + ++E+GRG+ GV+ PGC
Sbjct  61   EAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGC 120
Query  115  PETF------EDPQQQSQQGQRQGQGQ-----SQRSEQ---------------------- 141
            PETF      E PQ Q  Q  RQ + +      QR+ Q                      
Sbjct  121  PETFQSESEFEYPQSQRDQRSRQSESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFS 180
Query  142  --------------------------------DRHQKIRHFREGDIIALPAGVAHWCYND 169
                                            D+HQKI   R+GD+I  PAGV +W +ND
Sbjct  181  RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHND 240
Query  170  GDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQG 229
            GD+ +++++L   N++ NQLD N R+F+LAG    ++ R+ ++   Q R +    +  + 
Sbjct  241  GDNDLISITLYDANSFQNQLDGNVRNFFLAGQ--SKQSREDRRSQRQTREEGSDRQSRES 298
Query  230  EQEQQGEGNNVFSGFDAEFLADAF-NVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERS 288
            + ++     N+++GF  E L + F NVD +T  +L+ + D+R  IV+    L++  PE  
Sbjct  299  DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD-LKLRVPE-- 355
Query  289  RQEWERQERQERESEQERER-QRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQ 347
                      E E E +RER  R++GG GR  NG+E+  C+L++++N+   SRAD++  +
Sbjct  356  ----------EYEEELQRERGDRKRGGSGRS-NGLEQAFCNLKFKQNVNRPSRADVFNPR 404
Query  348  VGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDN 407
             GRINTVNSN LP+L ++QLSA+   L +  +  P WNLNAHS +Y  RG  RVQVV D 
Sbjct  405  AGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDE 464
Query  408  GNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPD 467
            G +VFDD +++GQ+L +PQ FAV  +A  EG+EWV +K +DNA  SP+AG+TS +RA+P 
Sbjct  465  GRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPV 524
Query  468  DVLANAFQISREEARRLKYNRQETT--LVRSSRSSSERKR 505
            +VLAN++ IS +EA RLK  RQE    L   SR   ER+R
Sbjct  525  EVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERER 564

Sequence Alignment: 25. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 171.7 bits 726,  Expect = 8e-44
 Identities = 238/469 50%, Positives = 323/469 68%, Gaps = 46/469 9%
Query  1    MAKLILVSFSLCLLVLFNGCLG---------INVGLRRQQQRYFGE--CNLDRLNALEPT 49
            MA+  L +F LCL V+ NGCL                 QQ+RY     C L+ L A +P 
Sbjct  1    MARSSLFTF-LCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACRLENLRAQDPV 59
Query  50   NRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGV 109
             R EAEA   E WD+++ +FQCAGV +IR TI P GLLLP +SNAP+LI++ +G GI G+
Sbjct  60   RRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKLIFVAQGFGIRGI 119
Query  110  LFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYND 169
              PGC ET++   ++SQ     G      + +D+HQKIR FREGD++ +PAGV+HW YN 
Sbjct  120  AIPGCAETYQTDLRRSQSA---GS-----AFKDQHQKIRPFREGDLLVVPAGVSHWMYNR 171
Query  170  GDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQG 229
            G S +V + +  T N ANQ+D   R FYLAG P  E+  +G +++ +  R+     G  G
Sbjct  172  GQSDLVLIVFADTRNVANQIDPYLRKFYLAGRP--EQVERGVEEWERSSRK-----GSSG 224
Query  230  EQEQQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSR 289
            E+       N+FSGF  EFL +AF +D    R+L+   D+R  IV+V+  ++V+ PE+  
Sbjct  225  EK-----SGNIFSGFADEFLEEAFQIDGGLVRKLKGEDDERDRIVQVDEDFEVLLPEKDE 279
Query  290  QEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVG 349
            +E  R    E ESE E              NG+EETIC+LRL++NI    RAD++  + G
Sbjct  280  EERSRGRYIESESESE--------------NGLEETICTLRLKQNIGRSVRADVFNPRGG 325
Query  350  RINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGN 409
            RI+T N +TLP+LR ++LSAERG L    +  PH+ +N+HSV+YA RG ARVQVVD+ G 
Sbjct  326  RISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQ 385
Query  410  TVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDV 469
            +VFD E+R+GQVL IPQNF V KRA   GFEW+AFKTNDNA  + LAGR S +R LP  V
Sbjct  386  SVFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGV 445
Query  470  LANAFQISREEARRLKYNRQETTLVRSSRSSSERK 504
            L+N ++ISREEA+RLKY +QE  ++   RS   R+
Sbjct  446  LSNMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE 480

Sequence Alignment: 26. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 165.8 bits 700,  Expect = 5e-42
 Identities = 242/459 52%, Positives = 333/459 72%, Gaps = 48/459 10%
Query  6    LVSFSLCLLVLFNGCLG-----INVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            L+SFSL +L+LF+  +      +N   R+QQQR+  +C +  LNALEP  RIE+EA   E
Sbjct  6    LLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTE 65
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
             WD+N++Q+QCA VAV R TI+  GLL+P Y+NAPEL+Y+ +G GI G +FPGCPETF  
Sbjct  66   FWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCPETF-- 123
Query  121  PQQQSQQGQRQGQGQSQRSEQ--DRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVS 178
             Q++SQ   R  + +S+RS+Q  ++HQK+RH REGDIIALPAGVAHW YN+G S +V V+
Sbjct  124  -QEESQSQSRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVA 182
Query  179  LLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGN 238
            L    N  NQLD+  R F L G+P  E Q  G Q + Q R  ++      G+Q      N
Sbjct  183  LADVGNSENQLDQYLRKFVLGGSPQQEIQ-GGGQSWSQSRSSRK------GQQ-----SN 230
Query  239  NVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQ 298
            N++S FD E LA +FN+D    ++LQ  + +R  IV+V+  LQV+ P+R           
Sbjct  231  NILSAFDEEILAQSFNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQR----------- 279
Query  299  ERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNT 358
                 QE+E          D NG+EET C++ L+ NI   SRAD+Y  + GR+ ++N+  
Sbjct  280  -----QEKEYS--------D-NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALN 325
Query  359  LPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQ 418
            LP+LR+LQLS E+G L +  +  PHWN+NAHS+VY  RG  R+Q+V +NG +VFD+E+R+
Sbjct  326  LPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIRE 385
Query  419  GQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISR 478
            GQ++ +PQNFAV KRA S+GFEWV+FKTN  A+IS LAGR S +R LP DV+ N+F ISR
Sbjct  386  GQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISR 445
Query  479  EEARRLKYNRQETTLVRSSRSSSERKR 505
            E+A  LK +R E T+     S S+R+R
Sbjct  446  EDAWNLKESRSEMTIFAPG-SRSQRQR 471

Sequence Alignment: 27. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 165.1 bits 697,  Expect = 8e-42
 Identities = 229/480 47%, Positives = 324/480 67%, Gaps = 44/480 9%
Query  3    KLILVSFSLCLLVLFNGCLGI------NVGLR----RQQQRYFGECNLDRLNALEPTNRI 52
            KLIL SFSLCL+VL   C           G R    RQQ+++  +C++ RL A EP+ R+
Sbjct  4    KLIL-SFSLCLMVL--SCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQRLTASEPSRRV 60
Query  53   EAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFP 112
             +EA   E WDH+  +F+C G   +R  I+P GLLLP YSNAP + ++E+GRG+ GV+ P
Sbjct  61   RSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVIP 120
Query  113  GCPETF------EDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWC 166
            GCPETF      E PQ Q  +  RQ + + + S  D+HQKI   REGD+I  PAGV +W 
Sbjct  121  GCPETFQSDSEFEYPQSQRGRHSRQSESEEESSRGDQHQKIFRIREGDVIPSPAGVVQWT 180
Query  167  YNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHG 226
            +NDG+  +++V+LL  N+Y  QLDEN R F+LAG    E + +G        RQ + S  
Sbjct  181  HNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRETREEGSD------RQSRES-- 232
Query  227  EQGEQEQQGEGNNVFSGFDAEFLADAF-NVDVDTARRLQSNQDKRRNIVKVEGRLQVVRP 285
               + ++   G N++SGF  E L + F +VD +T  +L+   D+R  IV+ +  L++  P
Sbjct  233  ---DDDEALLGANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQD-LKLRVP 288
Query  286  ERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYT 345
            +   +E+ER ER +R        +R QGG GR  NG E+  C+L++R N  T +   ++ 
Sbjct  289  QDFEEEYER-ERGDR--------RRGQGGSGRS-NGVEQGFCNLKFRRNFNTPTNTYVFN 338
Query  346  EQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVD 405
             + GRINTVNSN+LP+L +LQLSA+   L +  +  P WNLNAHS +Y  RG  RVQVV 
Sbjct  339  PRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVG 398
Query  406  DNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRAL 465
            D G +VFDD++++GQ+L +PQ FAV  +A  EG+EWV +K + NA  SP+ GRTS +RA+
Sbjct  399  DEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAI 458
Query  466  PDDVLANAFQISREEARRLKYNRQETTLVR--SSRSSSERKRRS 507
            P +VLAN++ IS +EA +LK  RQE  + R   SR   ER+R S
Sbjct  459  PVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFS 502

Sequence Alignment: 28. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 164.0 bits 692,  Expect = 2e-41
 Identities = 259/455 56%, Positives = 334/455 73%, Gaps = 48/455 10%
Query  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
            MAKL L+  SL +++LF+ CL I      Q++ Y  EC + RL A EP  R+EAEA   E
Sbjct  1    MAKLFLL--SLGIFLLFHCCLAIE---YEQEELY--ECRIQRLTAQEPQYRLEAEAGVSE 53
Query  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
             WD+ DQQF+CAGVA +R TI P GLLLP Y+NAP+L Y+ +GRGI GVL PGCPETF  
Sbjct  54   VWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF-- 111
Query  121  PQQQSQ-QGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSL 179
             Q  SQ QG R+ + +  R  QD+HQK+ H+++GDIIA+PAGVA WCYNDGD  +VTV +
Sbjct  112  -QSMSQFQGSREQEEERGRF-QDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLV 169
Query  180  LHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNN 239
             HT +  NQLD+NPRHF+LAGN     QR  Q+Q G+R       +G +G Q  Q   +N
Sbjct  170  QHTASDLNQLDQNPRHFFLAGNI----QRS-QKQRGER-------YGLRGGQ--QILADN 215
Query  240  VFSGFDAEFLADA--FNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQER 297
            VF GF+ E LAD   F +D +TAR+++   D+R +IV+VE  L+V+RP R R+E E+QE 
Sbjct  216  VFKGFNMEALADVLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQE- 274
Query  298  QERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSN 357
                           GG     NG+EETICS  + +NI   + AD Y  + GR+ TVNS 
Sbjct  275  ---------------GG---GYNGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSL 316
Query  358  TLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELR 417
             +P+L +LQLSA +G L    +  P W LNA+SVVYA+RG ARVQ+VD  G TVFDD LR
Sbjct  317  KVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLR 376
Query  418  QGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQIS 477
            +GQ++ +PQNF V K+A S GFEWV F TNDNA  S  AGRTS +R +P  VLANA+++S
Sbjct  377  EGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLS 436
Query  478  REEARRLKYNRQETTLVR-SSRS 499
            +EEARR+K NR E  L +  SRS
Sbjct  437  QEEARRIKLNRDEAVLFQPGSRS 459

Sequence Alignment: 29. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 163.4 bits 689,  Expect = 2e-41
 Identities = 217/388 55%, Positives = 285/388 73%, Gaps = 31/388 7%
Query  55   EACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGC 114
            EA   E WD+N++Q+QCA VAV R  I+  GLL+P Y+N  EL Y+ +GRGI G +FPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  115  PETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPV 174
            PET++D QQQ Q  Q +G     RS QD+HQK+R++REGDI+A+P G AHW YN+G S +
Sbjct  61   PETYQD-QQQQQSHQSEGS----RS-QDQHQKVRQLREGDIVAVPTGSAHWIYNNGQSQL 114
Query  175  VTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGE-QEQ 233
            V V+L+   N  NQLD+  R FY+ GNP  E Q   Q Q G R  Q     G QGE   +
Sbjct  115  VLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQ-GSRSYQ-----GSQGEGSSR 168
Query  234  QGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWE 293
            +  G N+F+GFD  +LADAFNV+ +  RRLQ  Q  R  IV+VE  L+V+RP+R      
Sbjct  169  RSSGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRG----- 223
Query  294  RQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINT 353
                QE+E EQE         RGRD NG+EET C+++L+ NI   S AD+Y  + GRI+T
Sbjct  224  ----QEQEQEQEF--------RGRD-NGLEETYCTIKLKHNINNPSDADVYNPRGGRIST 270
Query  354  VNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFD 413
            VNS  LPVLRW+QLSAE+G+L +     PHWNLN+HSVVY  RG  RVQ+V +NGN V+D
Sbjct  271  VNSFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYD 330
Query  414  DELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLAN 472
             ++++GQ++ +PQ +AV KRA ++G+EW++FKTNDNA+ S LAGR S IRALP DV+ N
Sbjct  331  GQIKEGQLIVVPQGYAVLKRASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 30. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 162.5 bits 685,  Expect = 4e-41
 Identities = 209/389 53%, Positives = 274/389 70%, Gaps = 29/389 7%
Query  55   EACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGC 114
            EA   E WD+N+QQ+QCA VAV R  I+ NGLL+P Y+N PEL Y+ +GRGI G + PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  115  PETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPV 174
            PET++D QQQ Q      +G   RS QD+HQK+R+ REGDIIALP G AHW YN+G S +
Sbjct  61   PETYQDEQQQQQSFSYPSEGS--RS-QDQHQKVRQIREGDIIALPTGSAHWIYNNGQSQL 117
Query  175  VTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQ 234
            V V+L+   N  NQLD+  R FYL GNP  + Q   Q Q G  R Q++   G+   +   
Sbjct  118  VLVALVDVGNSDNQLDQYFRKFYLGGNPQPQLQGTSQSQGG--RYQERLGGGDSSRR--- 172
Query  235  GEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWER 294
                N+F+GFD  +LA+AFNV+ +  RRLQ  Q +R  I++VE  ++V+ P+R ++ +E 
Sbjct  173  --SANIFNGFDERLLAEAFNVNPELIRRLQRPQMQRGIIIRVEEEFRVLTPQRGQESYES 230
Query  295  QERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTV 354
                               GR    NG EET+C++RLR NI   SRAD+Y  + GR+ TV
Sbjct  231  DPY----------------GR---YNGVEETLCTMRLRHNINDPSRADVYNPRAGRVTTV 271
Query  355  NSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDD 414
            N   LPVLRWLQLSAE+G+L +  L  PHWNLNAHS+VY  RG  RVQ+V +NGN VFD 
Sbjct  272  NRLNLPVLRWLQLSAEKGNLYKNALTAPHWNLNAHSIVYITRGNGRVQIVSENGNNVFDG 331
Query  415  ELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLAN 472
            E+R+GQ++ +PQ FAV KRA + G+EW++FKTND A  + LAGR S +RALP DV+ N
Sbjct  332  EIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLDVIQN 389

Sequence Alignment: 31. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 162.0 bits 683,  Expect = 6e-41
 Identities = 215/388 55%, Positives = 285/388 73%, Gaps = 30/388 7%
Query  55   EACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGC 114
            EA   E WD+N++Q+QCA VAV R  I+  GLL+P Y+N  EL Y+ +GRGI G +FPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  115  PETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPV 174
            PET++D QQQ Q  Q +G     RS QD+HQK+R++REGDI+A+P G AHW YN+G S +
Sbjct  61   PETYQD-QQQQQSHQSEGS----RS-QDQHQKVRQLREGDIVAMPTGSAHWIYNNGQSQL 114
Query  175  VTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQ 234
            V V+L+   N  NQLD+  R FY+ GNP  E Q   Q Q G R    Q S+GE G   ++
Sbjct  115  VLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQ-GSR--SYQGSQGEGGS--RR 169
Query  235  GEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWER 294
              G N+F+GFD  +LADAFNV+ +  RRLQ  Q  R  IV+VE  L+V+RP+R  QE   
Sbjct  170  SSGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRGEQE--- 226
Query  295  QERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTV 354
               QE+E             RGRD NG+EET C+++L+ NI   S AD+Y  + GRI+TV
Sbjct  227  ---QEQEF------------RGRD-NGLEETYCTIKLKHNINNPSDADVYNPRGGRISTV 270
Query  355  NSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDD 414
            NS  LPVLRW+QLSAE+G+L +     PHWNLN+HSVVY  RG  RVQ+V +NGN V+D 
Sbjct  271  NSFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDG 330
Query  415  ELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLAN 472
            ++++GQ++ +PQ +AV K+A ++G+EW++FKTNDNA+ S LAGR S IRALP DV+ N
Sbjct  331  QIKEGQLIVVPQGYAVLKKASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 32. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 156.5 bits 659,  Expect = 2e-39
 Identities = 216/381 56%, Positives = 274/381 71%, Gaps = 36/381 9%
Query  55   EACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGC 114
            EA   E WD+N+ Q+QCA VAV R  I+ NGLL+P Y+N  EL Y+ +GRGI G +FPGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  115  PETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPV 174
            PET++D QQQ Q  Q QG     RS QD+HQK+R+ REGDIIALP G AHW YN+G S +
Sbjct  61   PETYQD-QQQQQSYQSQGS----RS-QDQHQKVRQIREGDIIALPTGAAHWIYNNGGSQL 114
Query  175  VTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQ 234
            V V+L+   N  NQLD+  R FYL GNP  E Q       G  +RQQ    G QG Q   
Sbjct  115  VLVALVDVGNSDNQLDQYFRKFYLGGNPQPELQ-------GTSQRQQ--GGGYQGSQGGG 165
Query  235  GEG--NNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEW 292
            G     N+F+GFD  +LADAFNV+ +  RRLQ  Q +R  IV+VE  ++V+ P+R     
Sbjct  166  GGSRRGNMFNGFDERLLADAFNVNPELIRRLQRPQMQRGIIVRVEEEFRVLSPQRG---- 221
Query  293  ERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVGRIN 352
                 QE+E EQE++            NG EET C+++LR NI   SRAD+Y  + GR+ 
Sbjct  222  -----QEQEQEQEQDCD----------NGVEETFCTMKLRHNINDPSRADVYNPRGGRVT 266
Query  353  TVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVF 412
            TVN   LPVLRWLQLSAE+G+L +  L  PHWNLN HS+VY  RG  R+Q+V +NGN VF
Sbjct  267  TVNRFNLPVLRWLQLSAEKGNLYQNALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVF 326
Query  413  DDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDV 469
            + E+R+GQ++ IPQ FAV K+A + G+EW+AFKTNDNA  + LAGR S +RALP DV
Sbjct  327  NGEIREGQLIVIPQGFAVVKKASNRGLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 33. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 150.3 bits 632,  Expect = 3e-37
 Identities = 246/484 50%, Positives = 331/484 68%, Gaps = 94/484 19%
Query  1    MAKLILVSFS-LCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQI 59
            M K   +S+S LCLL+L + C+ I+          + EC L+ LNALEP +R+E+E   I
Sbjct  1    MGKPFTLSLSSLCLLLLSSACFAIS-------SSKLNECQLNNLNALEPDHRVESEGGLI 53
Query  60   ESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFE 119
            ++W+    +++CAGV V + T+  NGL LP YS  P +I I +G+G  GV  PGCPETFE
Sbjct  54   QTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFE 113
Query  120  DPQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSL 179
            +PQ+QS    R+G    ++  QD HQKIRHF EGD++ +P GV +W YN GD PVV +SL
Sbjct  114  EPQEQS---NRRGSRSQKQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISL 170
Query  180  LHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHG--EQGE--QEQQG 235
            L T+N+ NQLD+ PR FYLAGNPD E+    QQQ      QQQ SHG  +QG+  QE++ 
Sbjct  171  LDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQ------QQQKSHGGRKQGQHQQEEEE 224
Query  236  EGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVV------------ 283
            EG +V+SGF   FLA +FN + D A +LQS  D+R+ IV VEG L V+            
Sbjct  225  EGGSVLSGFSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDE 284
Query  284  -------------------------------------RPERSRQ--------------EW 292
                                                 RP R  Q              E 
Sbjct  285  DEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDED 344
Query  293  ERQERQERE-----SEQERERQRRQGGRGRDV-NGFEETICSLRLRENICTRSRADIYTE 346
            E Q R+ RE     ++  R RQ     RG +  NG EE IC+L+L ENI   SRAD Y  
Sbjct  345  EDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNP 404
Query  347  QVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDD 406
            + GRI+T+NS TLP LR +QLSA+   L + G+Y PHWNLNA+SV+Y  RG+ +V+VV+ 
Sbjct  405  KAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNC 464
Query  407  NGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALP 466
             GN VFD ELR+GQ+L +PQNF VA++A  +GFE++ FKT+ NA  S L       RA+P
Sbjct  465  QGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIP 521
Query  467  DDVLANAFQISREEARRLKYNRQETTLVRS-SRSSSER 503
             +VLA+++ + + +   LKY      LV   S+  S R
Sbjct  522  SEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPR 559

Sequence Alignment: 34. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 146.7 bits 616,  Expect = 3e-36
 Identities = 198/450 44%, Positives = 299/450 66%, Gaps = 44/450 9%
Query  6    LVSFSLCLLVLFNGCLGINVGLRRQQQRYFGE-CNLDRLNALEPTNRIEAEACQIESWDH 64
            +V+F + L + ++  +   +   R+ +   G+ C + R++  +P+ RI++E    E WD 
Sbjct  1    MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDE 60
Query  65   NDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQ 124
              +QFQCAG+  +R TI PNGL LP Y  +P L+YIERG+G+  ++ PGC ET++  + Q
Sbjct  61   RQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQ 120
Query  125  SQQGQRQGQGQSQR-SEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTN 183
                + +   Q  R S +D HQK+  +R+GDI+A+P+G AHWCYNDG   +V VS+   N
Sbjct  121  RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN 180
Query  184  NYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSG 243
            + +NQLD+  R FYLAG       R G+Q+  Q+ RQ  H               N+F  
Sbjct  181  HLSNQLDQKFRAFYLAGGVP----RSGEQE--QQARQTFH---------------NIFRA 219
Query  244  FDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQERESE 303
            FDAE+L++AFNV  +T RR+QS +++R  IV    R+  VRP+            E E E
Sbjct  220  FDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPD------------EEEGE 267
Query  304  QERERQRRQGGRGRDV-NGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVL 362
            QE         RGR + NG+EET C++++R N+ +R  ADI++ Q GR++ V+ N LP+L
Sbjct  268  QEH--------RGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPIL 319
Query  363  RWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVL 422
            +++ LSAE+G+L    L  P W++  H++VY  RG A+VQVVD NG  + +D + QG+++
Sbjct  320  KYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMF 379
Query  423  TIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEAR 482
             +PQ +    RA + GFEWVAFKT  +   SPLAG TS IRA+P  V+ N++QIS  +A+
Sbjct  380  VVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQ 439
Query  483  RLKYNRQETTLVRS 496
             LK NR   +++ S
Sbjct  440  ALKMNRGSQSFLLS 453

Sequence Alignment: 35. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 141.0 bits 591,  Expect = 2e-34
 Identities = 247/465 53%, Positives = 325/465 69%, Gaps = 59/465 12%
Query  10   SLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIESWDHNDQQF 69
            SLCLL+L + C+ I           F EC L+ LNALEP +R+E+E   IE+W+    ++
Sbjct  12   SLCLLLLSSACFAIT-------SSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPEL 64
Query  70   QCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQ 129
            QCAGV V +RT+  NGL LP YS  P++I + +G+G  G  FPGCPETFE PQQQS    
Sbjct  65   QCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSS--- 121
Query  130  RQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQL 189
            R+G  +SQ+  QD HQKIRHF EGD++ +P GV +W YN GD PVV +SLL T+N+ NQL
Sbjct  122  RRGS-RSQQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQL 180
Query  190  DENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHG--EQGE-QEQQGEGNNVFSGFDA 246
            D+NPR FYLAGNPD EH    QQQ      QQQ SHG  +QG+ Q+Q+ EG +V+SGF  
Sbjct  181  DQNPRVFYLAGNPDIEHPETMQQQ------QQQKSHGGRKQGQHQQQEEEGGSVLSGFSK 234
Query  247  EFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQER------ 300
             FLA +FN + DTA +L+S  D+R+ IV VEG L V+ P+   QE E ++  E       
Sbjct  235  HFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPS 294
Query  301  --------------ESEQERERQRR-------------QGGRGRDV---NGFEETICSLR 330
                          E E E E Q R             Q  RGR     NG EE IC+++
Sbjct  295  YPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMK 354
Query  331  LRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHS 390
            L ENI   SRAD Y  + GRI+T+NS TLP LR + LSA+   L R G+Y PHWNLNA+S
Sbjct  355  LHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANS 414
Query  391  VVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNA 450
            V+Y  RG+ RV+VV+  GN VFD ELR+GQ+L +PQNF VA++   +G+E+V FKT+ NA
Sbjct  415  VIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNA 474
Query  451  QISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTLV 494
              S +       RA+P +VL+N++ + + + R+LKY      LV
Sbjct  475  VSSYIK---DVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLV 515

Sequence Alignment: 36. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 44.8 bits 169,  Expect = 1e-05
 Identities = 92/349 26%, Positives = 177/349 50%, Gaps = 91/349 26%
Query  80   TIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRS 139
            T+EPN L +PQY +A  ++++ RG    G ++                       +++  
Sbjct  93   TMEPNTLYIPQYIDASLILFVRRGEAKVGYIY-----------------------KNKLV 129
Query  140  EQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSP----VVTVSLLHTNNYANQLDENPRH 195
            E       + ++ G + A+PAG + +  N   S     + ++  L +  Y       P+ 
Sbjct  130  E-------KRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAY---PQS 179
Query  196  FYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNV 255
            FY+ G              G   R                   +V+SGFDA  L+ AFNV
Sbjct  180  FYVGG--------------GVLPR-------------------SVLSGFDASTLSAAFNV 206
Query  256  DVDTARRLQSNQDKRRNIVKVEGR-------LQVVRPERSRQEWERQERQERESEQERER 308
              D    + ++Q +   I+++ G        L  +   + R   E++   + + E E+E 
Sbjct  207  SSDQLEMILNSQ-RGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEE 265
Query  309  QRRQGGRGRDVNGFEETICSLRLRENIC----TRSRADI---YTEQVGRINTVNSNTLPV 361
                  R    + + +  C ++ +  +     + +  D    Y    G    ++ +    
Sbjct  266  DDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSA 325
Query  362  LRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQV 421
            L+   L     +L+   +  PH N  A      +RG   +QVV  NG    + ++ +G V
Sbjct  326  LKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFPNGTAAMNAKVSEGDV 385
Query  422  LTIPQNFAVAKRAESEG--FEWVAFKTNDNAQISP--LAGRTSAIRALPDDVLANAFQIS 477
            + IP+ F   + A S+G  +E+  F T+   +  P  L G++S + ++    LA AF +S
Sbjct  386  FWIPRYFPFCQIA-SDGAPLEFFGFTTS-ARKNRPQFLVGKSSLLHSMRGPELAAAFGVS 443
Query  478  REEARRLKYNRQETTLVRSS 497
             E+  R+   ++E  ++ +S
Sbjct  444  EEQLERIVKAQREAVILPTS 463

Sequence Alignment: 37. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 43.4 bits 163,  Expect = 3e-05
 Identities = 86/361 23%, Positives = 167/361 46%, Gaps = 64/361 17%
Query  80   TIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRS 139
            ++EP  L++PQY ++  +I+I RG    G ++                            
Sbjct  74   SMEPKSLFVPQYLDSNLIIFIRRGEAKLGFIY---------------------------- 105
Query  140  EQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLD-ENPRHFYL 198
              D     R ++ GD+  +P+G A +  N G+   + V  + + + +  L  E  + FY+
Sbjct  106  --DDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHV--ICSIDPSTSLGLETFQSFYI 161
Query  199  AGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSG-FDAE--FLADAFNV 255
             G  +      G   F       + +  E    E +     +FS  +D    F+ D+   
Sbjct  162  GGGANSHSVLSG---F-------EPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAP 211
Query  256  DVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQERESEQERERQRRQGGR 315
             + T + LQ  +D +   +K           +  Q+ E  E +++ S   R+      G+
Sbjct  212  SLWT-KFLQLKKDDKEQQLK-----------KMMQDQEEDEEEKQTSRSWRKLLETVFGK 259
Query  316  GRDVNGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQ 375
              +    ++T  S     N+    +AD +    G    ++    P L    +      L 
Sbjct  260  VNEKIENKDTAGS-PASYNLYDDKKAD-FKNAYGWSKALHGGEYPPLSEPDIGVLLVKLS 317
Query  376  REGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAE 435
               +  PH N  +      + G   +++   NG+     +++QG V+ +P+ F   + A 
Sbjct  318  AGSMLAPHVNPISDEYTIVLSGYGELHIGYPNGSRAMKTKIKQGDVFVVPRYFPFCQVAS 377
Query  436  SEG-FEWVAFKTNDNAQISP--LAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETT 492
             +G +E+  F T+   +  P  LAG  S +R L    L+ AF +S +  RR    ++E  
Sbjct  378  RDGPLEFFGFSTS-ARKNKPQFLAGAASLLRTLMGPELSAAFGVSEDTLRRAVDAQHEAV 436
Query  493  LVRSS 497
            ++ S+
Sbjct  437  ILPSA 441

Sequence Alignment: 38. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 40.7 bits 151,  Expect = 0.0002
 Identities = 50/210 23%, Positives = 106/210 50%, Gaps = 15/210 7%
Query  284  RPERSRQEWERQERQERESEQERERQRRQGGRGRDVNGFEETICSLRLR-ENICTRSRAD 342
            R ER   E +R++ ++   E+ RERQ+ +G    +  G E+      ++ E+  +R + +
Sbjct  17   RDERQFDEQQRRDGKQICEEKARERQQEEGNSSEESYGKEQEENPYVFQDEHFESRVKTE 76
Query  343  IYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQ 402
                QV    T  S  L  +  ++L+    + +    ++   +++A  V++  +GRA + 
Sbjct  77   EGRVQVLENFTKRSRLLSGIENFRLAILEANPHT---FISPAHFDAELVLFVAKGRATIT 133
Query  403  VVDDNGNTVFDDELRQGQVLTIPQNFAV--AKRAESEGFEWVAFKTNDNA--QISPLAGR 458
            +V +     F+ E  +G ++ IP    V    R E+E +  V      +A  +   + G 
Sbjct  134  MVREEKRESFNVE--HGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFEAFYGA 191
Query  459  -----TSAIRALPDDVLANAFQISREEARRLKYNRQETTLVRSSR 498
                  S  RA+  +VL  A+++ RE+  ++   + + ++V++SR
Sbjct  192  GGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASR 236

Sequence Alignment: 39. Allergen Name: Tri a gliadin Sequence ID: CAA26385

 Score = 37.4 bits 136,  Expect = 0.001
 Identities = 43/137 31%, Positives = 73/137 53%, Gaps = 17/137 12%
Query  89   PQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRS-EQDRHQKI 147
            PQ  + P      + R +   L P  P + +  QQQ QQ Q+Q Q Q Q+  +Q  +Q++
Sbjct  91   PQPQSFPPQQPYPQQRPM--YLQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQL 148
Query  148  RHFREGDIIALPAGVAHWCYNDGDSPVV---TVSLLHT--NNYANQLDENPR--HFYLAG 200
               R  D++     +AH       S V+   T  LL+        Q+ E  R    +   
Sbjct  149  IPCR--DVVLQQHNIAH-----ASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQAIHNVV 201
Query  201  NPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQ 234
            +    HQ++ QQQ+ Q+++QQ + + +Q +Q+QQ
Sbjct  202  HAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQ 235

Sequence Alignment: 40. Allergen Name: Tri a gliadin Sequence ID: AAA34275

 Score = 37.2 bits 135,  Expect = 0.002
 Identities = 39/142 27%, Positives = 69/142 48%, Gaps = 18/142 12%
Query  88   LPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKI 147
            +PQ    P L Y +         +P     +  PQQ   Q Q Q Q Q Q+ +Q ++Q +
Sbjct  81   FPQPQPFPPLPYPQPQSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQIL 140
Query  148  RHFREG------DIIALPAGVAHWCYNDGDSPVVTVSLLHTNNY--ANQLDENPRH---- 195
            ++  +       D++     +AH       S V+  S  +        QL + P +    
Sbjct  141  QQILQQQLIPCRDVVLQQHNIAH-----ASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQ 195
Query  196  -FYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQ 234
              +   +    HQ+Q QQQ  +++ QQQ+ + +Q +Q+QQ
Sbjct  196  AIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQ 235

Sequence Alignment: 41. Allergen Name: Tri a gliadin Sequence ID: AAA34278

 Score = 37.2 bits 135,  Expect = 0.002
 Identities = 45/141 31%, Positives = 73/141 51%, Gaps = 19/141 13%
Query  83   PNGLLLPQ-YSNAPELIYIERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQ 141
            P  L  PQ  S  P+  Y ++       L P  P + +  QQQ QQ Q+Q Q Q Q  +Q
Sbjct  88   PPQLPYPQPQSFPPQQPYPQQQ---PQYLQPQQPISQQQAQQQQQQ-QQQQQQQQQILQQ 143
Query  142  DRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNY--ANQLDENPRH---- 195
              +Q++   R  D++     +AH       S V+  S  +        QL + P +    
Sbjct  144  ILQQQLIPCR--DVVLQQHNIAH-----ASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQ 196
Query  196  -FYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQ 234
              +   +    HQ+Q QQQ  +++ QQQ+ + +Q +Q+QQ
Sbjct  197  AIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQ 236

Sequence Alignment: 42. Allergen Name: Tri a gliadin Sequence ID: AAA34279

 Score = 36.9 bits 134,  Expect = 0.002
 Identities = 39/118 33%, Positives = 66/118 55%, Gaps = 15/118 12%
Query  110  LFPGCPETFEDPQQQSQQGQRQGQGQSQRS-EQDRHQKIRHFREGDIIALPAGVAHWCYN 168
            L P  P + +  QQQ QQ Q+Q Q Q Q+  +Q  +Q++   R  D++     +AH    
Sbjct  110  LQPQQPISQQQAQQQQQQQQQQQQQQQQQILQQILQQQLIPCR--DVVLQQHNIAH---- 163
Query  169  DGDSPVV---TVSLLHT--NNYANQLDENPR--HFYLAGNPDDEHQRQGQQQFGQRRRQQ 221
               S V+   T  LL+        Q+ E  R    +   +    HQ++ QQQ+ Q+++QQ
Sbjct  164  -ASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQAIHNVVHAIIMHQQEQQQQLQQQQQQQ 222
Query  222  QHSHGEQGEQEQQ 234
             + + +Q +Q+QQ
Sbjct  223  LQQQQQQQQQQQQ 235

Sequence Alignment: 43. Allergen Name: Tri a 21.0101 Sequence ID: CAY54134

 Score = 36.8 bits 133,  Expect = 0.002
 Identities = 39/115 33%, Positives = 62/115 53%, Gaps = 17/115 14%
Query  112  PGCPETFEDP--QQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYND 169
            P  P+  + P  QQQ+Q  Q+Q Q Q Q  +Q  +Q++   R  D++     +AH     
Sbjct  80   PQYPQP-QQPISQQQAQLQQQQQQQQQQILQQILQQQLIPCR--DVVLQQPNIAH----- 131
Query  170  GDSPVVTVSL-LHTNNYANQLDENPRHFYLAGNPDD------EHQRQGQQQFGQRRRQQQ 222
              S V   S  L       QL + P +       +        HQ+Q QQQ  Q+++QQQ
Sbjct  132  ASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQ 191
Query  223  HSHGEQGEQEQQ 234
            + + +Q +Q+QQ
Sbjct  192  QQQQQQQQQQQQ 203

Sequence Alignment: 44. Allergen Name: Tri a glutenin Sequence ID: AAB02788

 Score = 37.8 bits 139,  Expect = 0.003
 Identities = 55/199 27%, Positives = 94/199 47%, Gaps = 23/199 11%
Query  104  RGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQR-----SEQDRHQKIRHFREGDIIAL 158
            RG  G    G  + +   QQ  Q GQ+Q  GQ Q+     S Q   Q  ++  +G +   
Sbjct  244  RGQQGQQ-SGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQG-QQSGQGQLGYY 301
Query  159  PAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQ--QFGQ 216
            P    +     G S     S         QL ++ +   L     D++  QG+Q  Q GQ
Sbjct  302  PTSPQQ--SGQGQSGYYPTS----AQQPGQLQQSTQEQQLGQEQQDQQSGQGRQGQQSGQ 355
Query  217  RRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKV 276
            R++ QQ  +G+Q  Q Q G     +     + L         T+ +    + + R + + 
Sbjct  356  RQQDQQSGQGQQPGQRQPG-----YYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQP 410
Query  277  EGRLQVVRPERSRQEWERQERQERESEQERERQR-RQGGRGR 317
            E   Q  +PE+ +Q   +Q+RQ  + +Q  + Q+ +Q G+G+
Sbjct  411  EQGQQGQQPEQGQQG--QQQRQGEQGQQPGQGQQGQQPGQGQ 450

Sequence Alignment: 45. Allergen Name: Tri a glutenin Sequence ID: CAA31396

 Score = 36.1 bits 131,  Expect = 0.008
 Identities = 34/100 34%, Positives = 47/100 47%, Gaps = 15/100 15%
Query  122  QQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLH 181
            +QQ  QGQ+ GQGQ    EQ   Q  + +    +     G  +     G  P    SL +
Sbjct  389  KQQPGQGQQTGQGQQPEQEQQPGQGQQGYYPTSLQQPGQGQQQGQGQQGYYPT---SLQQ 445
Query  182  TNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGE 236
                  Q    P  +          Q+ GQ Q GQR++  Q  H EQG+Q  QG+
Sbjct  446  PGQ--GQQGHYPASL----------QQPGQGQPGQRQQPGQGQHPEQGKQPGQGQ 488

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.