The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN
QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR
RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT
DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR
PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNI
GGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYAL
RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF
AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD47382 Ara h 4 530 3654 839.1 0
AAC63045 Ara h 3 510 3130 719.7 9.7e-209
O82580 Ara h 3 507 3112 715.6 1.7e-207
Q7GC77 Gly m 6.0501 517 1084 253.3 2.4e-68
P11828 Gly m 6.0301 481 1047 244.9 7.8e-66
AAA33966 Gly m glycinin G1 495 1028 240.6 1.6e-64
P04776 Gly m 6.0101 495 1028 240.6 1.6e-64
CAA68460 Gly m glycinin G2 485 1022 239.2 4.1e-64
P04405 Gly m 6.0201 485 1022 239.2 4.1e-64
3EHK_A Pru du 6 531 797 187.9 1.2e-48
ADN39440 Pru du 6.0101 551 795 187.4 1.8e-48
ABW86978 Car i 4.0101 505 793 187.0 2.2e-48
AAL73404 Cor a 9 515 774 182.7 4.6e-47
A0A1L6K371 Jug n 4.0101 510 766 180.8 1.6e-46
Q2TPW5 Jug r 4.0101 507 758 179.0 5.6e-46
ADN39441 Pru du 6.0201 504 681 161.5 1.1e-40
AAN76862 Ana o 2 457 608 144.9 9.8e-36
EU410073 Pis v 5.0101 473 584 139.4 4.5e-34
DQ631676 Pis v 2.0101 496 535 128.2 1.1e-30
BAA21760 Fag e 1 504 510 122.5 5.8e-29
DQ631677 Pis v 2.0201 472 509 122.3 6.3e-29
Q9AUD2 Ses i 7.0101 497 508 122.0 7.8e-29
QYU76046 Zan b 2.0102 388 498 119.8 2.8e-28
QYU76045 Zan b 2.0101 389 489 117.8 1.2e-27
P13744 Cuc ma 4.0101 480 489 117.7 1.5e-27
QYS16039 Zan b 2.03 389 477 115.0 7.8e-27
BAA21758 Fag e 1 565 468 112.9 5e-26
Q9XFM4 Fag e 1 538 461 111.3 1.4e-25
AAO38859 Ber e 2 465 457 110.4 2.3e-25
QYU76044 Zan b 2.02 383 443 107.3 1.7e-24
Q9XHP0 Ses i 6.0101 459 438 106.1 4.5e-24
Q2TLW0 Sin a 2.0101 510 429 104.0 2.1e-23
Q9SB11 Gly m 6.0401 563 413 100.4 3e-22
AAM54366 Jug n 2 481 175 46.1 5.3e-06
A0A0S3B0K0 Coc n 1.0101 490 171 45.2 1e-05
AAF18269 Jug r 2 593 171 45.2 1.3e-05
B3STU4 Car i 2.0101 792 172 45.4 1.5e-05
BAB21619 Gly m Bd28K 473 145 39.3 0.0006
CAA35238 Tri a gliadin 307 125 34.9 0.0083
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 839.1 bits 3654,  Expect = 0
 Identities = 530/530 100%, Positives = 530/530 100%, Gaps = 0/530 0%
Query  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
            MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN
Sbjct  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
Query  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR 120
            QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR
Sbjct  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR 120
Query  121  RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
            RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT
Sbjct  121  RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
Query  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
            DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR
Sbjct  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
Query  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT 300
            PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT
Sbjct  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT 300
Query  301  VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNI 360
            VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNI
Sbjct  301  VRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNI 360
Query  361  GGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYAL 420
            GGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYAL
Sbjct  361  GGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYAL 420
Query  421  RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF 480
            RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF
Sbjct  421  RGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF 480
Query  481  AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530
            AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA
Sbjct  481  AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530

Sequence Alignment: 2. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 719.7 bits 3130,  Expect = 1e-208
 Identities = 466/510 91%, Positives = 478/510 93%, Gaps = 0/510 0%
Query  21   ISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNAL 80
            ISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNAL
Sbjct  1    ISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNAL 60
Query  81   RRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQ 140
            RRPFYSNAPQEIFIQQGRGYFGLIFPGCP  YEEP  QGRR QSQRPPRRLQ EDQSQQQ
Sbjct  61   RRPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQ 120
Query  141  QDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG 200
            +DSHQKVHRF+EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG
Sbjct  121  RDSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG 180
Query  201  NHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGG 260
            N EQEFLRYQQQSRQSRRRSLPYSPYSP+S+PR+EEREF PRGQHSRRERAGQEEE+EGG
Sbjct  181  NTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGG 240
Query  261  NIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEE 320
            NIFSGFTPEFLEQAFQVDDRQIVQNL GE ESEEEGAIVTVRGGLRILSPD  R ADEEE
Sbjct  241  NIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEE 300
Query  321  EYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCH 380
            EYDED+YEY E+D RRGRGSRG GNGIEETICTA  KKNIG NRSP IY+PQ    +  +
Sbjct  301  EYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAN 360
Query  381  DLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEE 440
            DLNLLILRWLG SAEYGNLYRNALFV HYNTNAHSIIY LRGRAHVQVVDSNGNRVYDEE
Sbjct  361  DLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEE 420
Query  441  LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYG 500
            LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN+AGENS IDNLPEEVVANSYG
Sbjct  421  LQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYG 480
Query  501  LPREQARQLKNNNPFKFFVPPFQQSPRAVA 530
            L REQARQLKNNNPFKFFVPP QQSPRAVA
Sbjct  481  LQREQARQLKNNNPFKFFVPPSQQSPRAVA 510

Sequence Alignment: 3. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 715.6 bits 3112,  Expect = 2e-207
 Identities = 463/507 91%, Positives = 475/507 93%, Gaps = 0/507 0%
Query  24   RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 83
            RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP
Sbjct  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
Query  84   FYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDS 143
            FYSNAPQEIFIQQGRGYFGLIFPGCP  YEEP  QGRR QSQRPPRRLQ EDQSQQQ+DS
Sbjct  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
Query  144  HQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHE 203
            HQKVHRF+EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN E
Sbjct  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
Query  204  QEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIF 263
            QEFLRYQQQSRQSRRRSLPYSPYSP+S+PR+EEREF PRGQHSRRERAGQEEE+EGGNIF
Sbjct  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
Query  264  SGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYD 323
            SGFTPEFLEQAFQVDDRQIVQNL GE ESEEEGAIVTVRGGLRILSPD  R ADEEEEYD
Sbjct  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYD 300
Query  324  EDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLN 383
            ED+YEY E+D RRGRGSRG GNGIEETICTA  KKNIG NRSP IY+PQ    +  +DLN
Sbjct  301  EDEYEYDEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLN 360
Query  384  LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQE 443
            LLILRWLG SAEYGNLYRNALFV HYNTNAHSIIY LRGRAHVQVVDSNGNRVYDEELQE
Sbjct  361  LLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQE 420
Query  444  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPR 503
            GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN+AGENS IDNLPEEVVANSYGL R
Sbjct  421  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQR 480
Query  504  EQARQLKNNNPFKFFVPPFQQSPRAVA 530
            EQARQLKNNNPFKFFVPP QQSPRAVA
Sbjct  481  EQARQLKNNNPFKFFVPPSQQSPRAVA 507

Sequence Alignment: 4. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 253.3 bits 1084,  Expect = 2e-68
 Identities = 219/468 46%, Positives = 305/468 65%, Gaps = 82/468 17%
Query  5    LELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFE 64
            L LS  +C+L+L ++  +     + N CQ+  LNA  PD+R+ESEGG IETWN  + E++
Sbjct  8    LSLS-SLCLLLLSSACFAITSS-KFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQ 65
Query  65   CAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQS 124
            CAGV +S+  L RN L  P YS  PQ I + QG+G  G+ FPGCP T+E+P QQ  R  S
Sbjct  66   CAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGS 125
Query  125  QRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNN 184
                 R Q     QQ QDSHQK+  FNEGD++ +P GV +W YN  D  VVA+SL DT+N
Sbjct  126  -----RSQ-----QQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSN 175
Query  185  NDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQ 244
             +NQLDQ PR F LAGN + E     QQ +Q +           H          R +GQ
Sbjct  176  FNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQK----------SHGG--------RKQGQ 217
Query  245  HSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGG 304
            H       Q++E+EGG+++SGF+  FL Q+F  ++    + L   +  +E   IVTV GG
Sbjct  218  H-------QQQEEEGGSVLSGFSKHFLAQSFNTNE-DTAEKL--RSPDDERKQIVTVEGG 267
Query  305  LRILSPDGTRGADEEEEYDE--------------------DQYEYHEQDGRRG-----RG 339
            L ++SP      DE+E+ DE                    D+ E  E+D  R      R 
Sbjct  268  LSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRP 327
Query  340  SR-------GGG----NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILR 388
            SR       G G    NG+EE ICT  + +NI        Y+P+       + L L  LR
Sbjct  328  SRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALR 387
Query  389  WLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLV 448
             +GLSA+Y  LYRN ++ PH+N NA+S+IY  RG+  V+VV+  GN V+D EL+ G++LV
Sbjct  388  QFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLV 447
Query  449  VPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQ 508
            VPQNF VA +   + +EYV FKT    +++++  +      +P EV++NSY L + Q RQ
Sbjct  448  VPQNFVVAEQGGEQGLEYVVFKTH-HNAVSSYIKD--VFRAIPSEVLSNSYNLGQSQVRQ 504
Query  509  LK---NNNPF 515
            LK   N+ P+
Sbjct  505  LKYQGNSGPL 514

Sequence Alignment: 5. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 244.9 bits 1047,  Expect = 8e-66
 Identities = 304/478 63%, Positives = 381/478 79%, Gaps = 55/478 11%
Query  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
            MAKL+ LS+CF ++     + SFR+QP++N CQ QRLNA +PDNRIESEGG+IETWNPNN
Sbjct  1    MAKLV-LSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNN 59
Query  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR 120
            + F+CAGVALSR  L RNALRRP Y+NAPQEI+IQQG G FG+IFPGCPST+EEP Q+G 
Sbjct  60   KPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQKG- 118
Query  121  RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
              QS RP             QD HQK++ F EGDLIAVPTG A+W+YN+ DT VVAVSL 
Sbjct  119  --QSSRP-------------QDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLI 163
Query  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
            DTN+  NQLDQ PRRF LAGN+EQEFL+YQ Q +Q                         
Sbjct  164  DTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQG------------------------ 199
Query  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT 300
              G +S++ +  QEEE+EGG+I+SGF PEFLE+AF VD RQIV+ L GENE EE+GAIVT
Sbjct  200  --GTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVD-RQIVRKLQGENEEEEKGAIVT 256
Query  301  VRGGLRILSP---DGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVK 357
            V+GGL ++SP   +  +  +EEE+ D D+ + H Q   R        NGI+ETICT  ++
Sbjct  257  VKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSR--------NGIDETICTMRLR 308
Query  358  KNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSII 417
             NIG   SP I++PQ         L++  L WL LSA++G+L +NA+FVPHYN NA+SII
Sbjct  309  HNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSII 368
Query  418  YALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSI 477
            YAL GRA VQVV+ NG RV+D ELQEG+VL+VPQNFAVA +SQS+NFEYV+FKT+ RPSI
Sbjct  369  YALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSI 428
Query  478  ANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530
             N+AG NS+++ LPEEV+  ++ L R+QARQ+KNNNPF F+VPP +   R VA
Sbjct  429  GNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQRRVVA 481

Sequence Alignment: 6. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 240.6 bits 1028,  Expect = 2e-64
 Identities = 299/485 61%, Positives = 382/485 78%, Gaps = 55/485 11%
Query  1    MAKLLELSFCFCFLVLGASSISF--RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNP 58
            MAKL+   F +CFL++     +F  R+QP++N CQ Q+LNA +PDNRIESEGG IETWNP
Sbjct  1    MAKLV---FSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNP 57
Query  59   NNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQ 118
            NN+ F+CAGVALSR  L RNALRRP Y+N PQEI+IQQG+G FG+I+PGCPST+EEP Q 
Sbjct  58   NNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQP 117
Query  119  GRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVS 178
             +R QS RP             QD HQK++ F EGDLIAVPTGVA+W+YN+ DT VVAVS
Sbjct  118  QQRGQSSRP-------------QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS 164
Query  179  LTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREERE 238
            + DTN+ +NQLDQ PRRF LAGN+EQEFL+YQQ+  Q   +S                  
Sbjct  165  IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQE--QGGHQS------------------ 204
Query  239  FRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAI 298
               +G+H       QEEE+EGG+I+SGFT EFLE+AF VD +QI +NL GENE E++GAI
Sbjct  205  --QKGKHQ------QEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAI 255
Query  299  VTVRGGLRILSP---DGTRGADEEEEYDED---QYEYHEQDGRRGRGSRGGG--NGIEET 350
            VTV+GGL ++ P   +  +   EEEE +ED   Q +  ++  +R RGS+     NGI+ET
Sbjct  256  VTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDET 315
Query  351  ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYN 410
            ICT  ++ NIG   SP IY+PQ         L++  L WL LSAE+G+L +NA+FVPHYN
Sbjct  316  ICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYN 375
Query  411  TNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK 470
             NA+SIIYAL GRA +QVV+ NG RV+D ELQEG VL+VPQNF VA +SQS+NFEYV+FK
Sbjct  376  LNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFK 435
Query  471  TDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530
            T+  P I  +AG NS+++ LPEEV+ +++ L  +QARQ+KNNNPFKF+VPP +   RAVA
Sbjct  436  TNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495

Sequence Alignment: 7. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 240.6 bits 1028,  Expect = 2e-64
 Identities = 299/485 61%, Positives = 382/485 78%, Gaps = 55/485 11%
Query  1    MAKLLELSFCFCFLVLGASSISF--RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNP 58
            MAKL+   F +CFL++     +F  R+QP++N CQ Q+LNA +PDNRIESEGG IETWNP
Sbjct  1    MAKLV---FSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNP 57
Query  59   NNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQ 118
            NN+ F+CAGVALSR  L RNALRRP Y+N PQEI+IQQG+G FG+I+PGCPST+EEP Q 
Sbjct  58   NNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQP 117
Query  119  GRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVS 178
             +R QS RP             QD HQK++ F EGDLIAVPTGVA+W+YN+ DT VVAVS
Sbjct  118  QQRGQSSRP-------------QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS 164
Query  179  LTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREERE 238
            + DTN+ +NQLDQ PRRF LAGN+EQEFL+YQQ+  Q   +S                  
Sbjct  165  IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQE--QGGHQS------------------ 204
Query  239  FRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAI 298
               +G+H       QEEE+EGG+I+SGFT EFLE+AF VD +QI +NL GENE E++GAI
Sbjct  205  --QKGKHQ------QEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAI 255
Query  299  VTVRGGLRILSP---DGTRGADEEEEYDED---QYEYHEQDGRRGRGSRGGG--NGIEET 350
            VTV+GGL ++ P   +  +   EEEE +ED   Q +  ++  +R RGS+     NGI+ET
Sbjct  256  VTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDET 315
Query  351  ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYN 410
            ICT  ++ NIG   SP IY+PQ         L++  L WL LSAE+G+L +NA+FVPHYN
Sbjct  316  ICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYN 375
Query  411  TNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK 470
             NA+SIIYAL GRA +QVV+ NG RV+D ELQEG VL+VPQNF VA +SQS+NFEYV+FK
Sbjct  376  LNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFK 435
Query  471  TDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530
            T+  P I  +AG NS+++ LPEEV+ +++ L  +QARQ+KNNNPFKF+VPP +   RAVA
Sbjct  436  TNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495

Sequence Alignment: 8. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 239.2 bits 1022,  Expect = 4e-64
 Identities = 302/484 62%, Positives = 382/484 78%, Gaps = 47/484 9%
Query  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
            MAKL+ LS+CF   +L +   ++R+Q ++N CQ Q+LNA +PDNRIESEGG+IETWNPNN
Sbjct  1    MAKLV-LSLCF---LLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNN 56
Query  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR 120
            + F+CAGVALSR  L RNALRRP Y+N PQEI+IQQG G FG+IFPGCPSTY+EP +  +
Sbjct  57   KPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQ 116
Query  121  RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
            R +SQRP             QD HQKVHRF EGDLIAVPTGVA+W+YN+ DT VVAVS+ 
Sbjct  117  RGRSQRP-------------QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 163
Query  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
            DTN+ +NQLDQ PRRF LAGN+EQEFL+YQQQ +                          
Sbjct  164  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQG------------------------- 198
Query  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT 300
              G +S++ +  QEEE+EG NI+SGF PEFL++AF V+  QIV+NL GENE E+ GAIVT
Sbjct  199  --GSQSQKGKQ-QEEENEGSNILSGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVT 254
Query  301  VRGGLRILSPDGTRGADEEEEYDED-QYEYHEQDGRRGRGSRGGGNGIEETICTACVKKN 359
            V+GGLR+ +P   +   EE++ DE+ Q +  E D    R S+   NGI+ETICT  +++N
Sbjct  255  VKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQN 314
Query  360  IGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYA 419
            IG N SP IY+PQ         L++  L  L LSA+YG+L +NA+FVPHY  NA+SIIYA
Sbjct  315  IGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYA 374
Query  420  LRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN 479
            L GRA VQVV+ NG RV+D ELQEG VL+VPQNFAVA KSQS+NFEYV+FKT+ RPSI N
Sbjct  375  LNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGN 434
Query  480  FAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530
            +AG NS+++ LPEEV+ +++ L  +QARQ+KNNNPF F+VPP +   RAVA
Sbjct  435  LAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA 485

Sequence Alignment: 9. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 239.2 bits 1022,  Expect = 4e-64
 Identities = 302/484 62%, Positives = 382/484 78%, Gaps = 47/484 9%
Query  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
            MAKL+ LS+CF   +L +   ++R+Q ++N CQ Q+LNA +PDNRIESEGG+IETWNPNN
Sbjct  1    MAKLV-LSLCF---LLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNN 56
Query  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR 120
            + F+CAGVALSR  L RNALRRP Y+N PQEI+IQQG G FG+IFPGCPSTY+EP +  +
Sbjct  57   KPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQ 116
Query  121  RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
            R +SQRP             QD HQKVHRF EGDLIAVPTGVA+W+YN+ DT VVAVS+ 
Sbjct  117  RGRSQRP-------------QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 163
Query  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
            DTN+ +NQLDQ PRRF LAGN+EQEFL+YQQQ +                          
Sbjct  164  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQG------------------------- 198
Query  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT 300
              G +S++ +  QEEE+EG NI+SGF PEFL++AF V+  QIV+NL GENE E+ GAIVT
Sbjct  199  --GSQSQKGKQ-QEEENEGSNILSGFAPEFLKEAFGVN-MQIVRNLQGENEEEDSGAIVT 254
Query  301  VRGGLRILSPDGTRGADEEEEYDED-QYEYHEQDGRRGRGSRGGGNGIEETICTACVKKN 359
            V+GGLR+ +P   +   EE++ DE+ Q +  E D    R S+   NGI+ETICT  +++N
Sbjct  255  VKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQN 314
Query  360  IGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYA 419
            IG N SP IY+PQ         L++  L  L LSA+YG+L +NA+FVPHY  NA+SIIYA
Sbjct  315  IGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYA 374
Query  420  LRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN 479
            L GRA VQVV+ NG RV+D ELQEG VL+VPQNFAVA KSQS+NFEYV+FKT+ RPSI N
Sbjct  375  LNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGN 434
Query  480  FAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530
            +AG NS+++ LPEEV+ +++ L  +QARQ+KNNNPF F+VPP +   RAVA
Sbjct  435  LAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA 485

Sequence Alignment: 10. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 187.9 bits 797,  Expect = 1e-48
 Identities = 232/477 48%, Positives = 326/477 68%, Gaps = 77/477 16%
Query  25   QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 84
            Q   +N CQ+ +L A+ PDNRI++E G IETWN N  +F+CAGVA SR+ ++RN L  P 
Sbjct  5    QLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPS 64
Query  85   YSNAPQEIFIQQGRGYFGLIFPGCPSTYEEP---AQQGR-----------------RYQS 124
            YSNAPQ I+I QGRG +G +F GCP T+EE    +QQGR                 R Q 
Sbjct  65   YSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQG 124
Query  125  QRPP----------RRLQEEDQSQQQQ----------------DSHQKVHRFNEGDLIAV 158
            Q+            R+ QEE + Q+QQ                D HQK  R  EGD++A+
Sbjct  125  QQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAI 184
Query  159  PTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRY-QQQSRQSR 217
            P GVA+W YND D ++VAV+L   +++ NQLDQ PR+F LAGN E EF +  Q Q RQ  
Sbjct  185  PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQG 244
Query  218  RRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQV 277
             +  P     P  RPR+                  QE++  G N+FSGF  ++L QA+ V
Sbjct  245  EQGRPGQHQQPFGRPRQ------------------QEQQGNGNNVFSGFNTQLLAQALNV 286
Query  278  DDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRG 337
            ++ +  +NL G+N++  +  I+ VRG L  + P   RG  +E E++E Q E  +Q+ R+ 
Sbjct  287  NE-ETARNLQGQNDNRNQ--IIQVRGNLDFVQPP--RGR-QEREHEERQQEQLQQE-RQQ 339
Query  338  RGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWLGLSAE 395
            +G +   NG+EET C+  +K+NIG      I+ P+  R  T N H  NL ILR+L LSAE
Sbjct  340  QGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSH--NLPILRFLRLSAE 397
Query  396  YGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAV 455
             G +YRN ++ PH+N NAHS++Y +RG A VQVV+ NG+ + D+E+Q+G++++VPQN  V
Sbjct  398  RGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGV 457
Query  456  AGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPF 515
              ++ ++ FEY AFKT+    I  +AG  SF+  LP+EV+AN+Y + REQARQLK N   
Sbjct  458  IQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQE 517
Query  516  KFFVPPFQQSPRAV 529
               +   QQ  RAV
Sbjct  518  TIALSSSQQR-RAV 530

Sequence Alignment: 11. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 187.4 bits 795,  Expect = 2e-48
 Identities = 238/501 47%, Positives = 340/501 67%, Gaps = 77/501 15%
Query  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
            MAK + +S+C+ ++  G  +    Q   +N CQ+ +L A+ PDNRI++E G IETWN N 
Sbjct  1    MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQ 60
Query  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEP---AQ 117
            ++F+CAGVA SR+ ++RN L  P YSNAPQ I+I QGRG +G +F GCP T+EE    +Q
Sbjct  61   EDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ 120
Query  118  QGR-----------------RYQSQRPP----------RRLQEEDQSQQQQ--------- 141
            QGR                 R Q Q+            R+ QEE + Q+QQ         
Sbjct  121  QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQ 180
Query  142  -------DSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPR 194
                   D HQK  R  EGD++A+P GVA+W YND D ++VAV+L   +++ NQLDQ PR
Sbjct  181  QQQFRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPR 240
Query  195  RFNLAGNHEQEFLRY-QQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQ 253
            +F LAGN E EF +  Q Q RQ   +  P     P  RPR+                  Q
Sbjct  241  KFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQ------------------Q 282
Query  254  EEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGT 313
            E++  G N+FSGF  ++L QA+ V++ +  +NL G+N++  +  I+ VRG L  + P   
Sbjct  283  EQQGSGNNVFSGFNTQLLAQALNVNE-ETARNLQGQNDNRNQ--IIRVRGNLDFVQPP-- 337
Query  314  RGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQ- 372
            RG  +E E++E Q E  +Q+ R+ +G +   NG+EET C+  +K+NIG      I+ P+ 
Sbjct  338  RGR-QEREHEERQQEQLQQE-RQQQGGQLMANGLEETFCSLRLKENIGNPERADIFSPRA 395
Query  373  -RWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDS 431
             R  T N H  NL ILR+L LSAE G +YRN ++ PH+N NAHS++Y +RG A VQVV+ 
Sbjct  396  GRISTLNSH--NLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNE 453
Query  432  NGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLP 491
            NG+ + D+E+Q+G++++VPQN  V  ++ ++ FEY AFKT+    I  +AG  SF+  LP
Sbjct  454  NGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALP 513
Query  492  EEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAV 529
            +EV+AN+Y + REQARQLK N      +   QQ  RAV
Sbjct  514  DEVLANAYQISREQARQLKYNRQETIALSSSQQR-RAV 550

Sequence Alignment: 12. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 187.0 bits 793,  Expect = 2e-48
 Identities = 246/489 50%, Positives = 335/489 68%, Gaps = 49/489 10%
Query  1    MAKLLELSFCFCFLVL----GASSISF-RQQPEENACQFQRLNAQRPDNRIESEGGYIET 55
            MAK + LS  +C++++    G  + S  RQQ +   CQ+ RL+A  P NRIE+E G IE+
Sbjct  1    MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIES 60
Query  56   WNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEP 115
            W+PN+Q+++CAGVA+ R  +  N L  P YSNAPQ ++I +GRG  G++FPGCP T+EE 
Sbjct  61   WDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEE- 119
Query  116  AQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVV 175
            +Q+    QSQ+  RR       + QQD HQK+  F EGD+IA P GVA W YND  + VV
Sbjct  120  SQR----QSQQGQRR-------EFQQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVV 168
Query  176  AVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRRE 235
            A+ L DT+NN NQLDQ PR F LAGN + EF R Q Q             Y  H   RR+
Sbjct  169  AIFLLDTHNNANQLDQNPRNFYLAGNPDDEF-RPQGQQE-----------YEQH---RRQ 213
Query  236  EREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEE 295
            ++  + RG+H      G+++ D G N+FSGF  EFL  AF VD  +  + L  EN  +  
Sbjct  214  QQHQQRRGEH------GEQQRDLGNNVFSGFDAEFLADAFNVDT-ETARRLQSEN--DHR 264
Query  296  GAIVTVRG-GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGG--GNGIEETIC 352
            G+IV V G  L+++ P  +R   E EE  E + E  E +  R +  RGG   NG+EETIC
Sbjct  265  GSIVRVEGRQLQVIRPRWSREEQEHEERKERERE-RESESERRQSRRGGRDDNGLEETIC 323
Query  353  TACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYN 410
            T  +++NIG      IY  +  R  T N H  NL ILRWL LSAE G LY +AL+VPH+N
Sbjct  324  TLSLRENIGDPSRADIYTEEAGRISTVNSH--NLPILRWLQLSAERGALYSDALYVPHWN 381
Query  411  TNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK 470
             NAHS++YALRGRA VQVVD+ G  V+D+EL+EG++L +PQNFAV  +++ E FE+V+FK
Sbjct  382  LNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARDEGFEWVSFK 441
Query  471  TDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRA 528
            T+    ++ +AG  S I  LPEEV+ N++ +PRE AR+LK N     +V    +S R+
Sbjct  442  TNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRLKFNRQESTLVRSRSRSSRS 499

Sequence Alignment: 13. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 182.7 bits 774,  Expect = 5e-47
 Identities = 239/479 49%, Positives = 326/479 68%, Gaps = 41/479 8%
Query  1    MAKLLELSFCFCFLVL--GASSISF---RQQPEE-NACQFQRLNAQRPDNRIESEGGYIE 54
            MAKL+ +SF +C+LVL  G   I+    RQQ      C + RLNA  P NRIE+E   IE
Sbjct  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
Query  55   TWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEE 114
            +W+ N+Q+F+CAGVA+ R  +  N L  P YSNAP+ I+I++GRG  G++FPGCP T+E+
Sbjct  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
Query  115  PAQQGRRYQSQRPPRRLQEEDQSQQ-QQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTD 173
            P QQ +  Q QR     Q + QSQ+ +QD HQK+  F EGD+IA+P GVA W YND D+ 
Sbjct  121  PQQQSQ--QGQR-----QGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSP 173
Query  174  VVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPR 233
            VV VSL  TNN  NQLD+ PR F LAGN + E  R  QQ    RRR              
Sbjct  174  VVTVSLLHTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRR-------------- 219
Query  234  REEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESE 293
                    + QHS  E+  QE++ EG N+FSGF  EFL  AF VD     + L  ++  +
Sbjct  220  --------QQQHSHGEQGEQEQQGEGNNVFSGFDAEFLADAFNVD-VDTARRL--QSNQD 268
Query  294  EEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGG-NGIEETIC 352
            +   IV V G L+++ P+ +R   E +E  E + E +E++ +R +G RG   NG EETIC
Sbjct  269  KRRNIVKVEGRLQVVRPERSRQEWERQERQERESE-QERERQRRQGGRGRDVNGFEETIC 327
Query  353  TACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTN 412
            +  +++NI       IY  Q       +   L +LRWL LSAE G+L R  L+VPH+N N
Sbjct  328  SLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLN 387
Query  413  AHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTD 472
            AHS++YA+RGRA VQVVD NGN V+D+EL++G+VL +PQNFAVA +++SE FE+VAFKT+
Sbjct  388  AHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTN 447
Query  473  SRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNN 512
                I+ +AG  S I  LP++V+AN++ + RE+AR+LK N
Sbjct  448  DNAQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYN 487

Sequence Alignment: 14. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 180.8 bits 766,  Expect = 2e-46
 Identities = 252/491 51%, Positives = 332/491 67%, Gaps = 47/491 9%
Query  1    MAK--LLELSFCFCFLVLGASSISF-RQQPEENACQFQRLNAQRPDNRIESEGGYIETWN 57
            MAK  LL +S+C+  LV G  + S  RQQP    C+++RL A  P NRIE+E G IE+W+
Sbjct  1    MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESWD 60
Query  58   PNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQ 117
            PNNQ+F+CAGVA+ R  +  N L  P YSNAPQ ++I +GRG  G++FPGCP T+EE +Q
Sbjct  61   PNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEE-SQ 119
Query  118  QGRRYQSQ-RPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVA 176
            QG   QS+ RP  R      +  Q+D HQK+  F EGD+IA P GVA W YND DT VVA
Sbjct  120  QG---QSRIRPSLR-----SASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVA 171
Query  177  VSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREE 236
            V+L DT NN NQLDQ PR F LAGN + EF R Q Q             Y  H   RR++
Sbjct  172  VALMDTTNNANQLDQNPRNFYLAGNPDDEF-RPQGQQE-----------YEQH---RRQQ 216
Query  237  REFRPRGQHSRRE-RAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEE 295
                   QH +R    GQ++   G N+FSGF  +FL  AF VD  +  + L  EN+    
Sbjct  217  -------QHQQRHGEPGQQQRGSGNNVFSGFDADFLADAFNVDT-ETARRLQSENDHRR- 267
Query  296  GAIVTVRG-GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGG--GNGIEETIC 352
             +IV V G  L+++ P  +R   E EE  E + E  E +  R +  RGG   NG+EETIC
Sbjct  268  -SIVRVEGRQLQVIRPRWSREEQEREERKERERE-RESESERRQSRRGGRDDNGLEETIC 325
Query  353  TACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYN 410
            T  +++NIG      IY  +  R  T N H L   +LRWL LSAE G LY +AL+VPH+N
Sbjct  326  TLRLRENIGDPSRADIYTEEAGRISTANSHTLP--VLRWLQLSAERGALYSDALYVPHWN 383
Query  411  TNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK 470
             NAHS++YALRGRA VQVVD+ G  V+D+EL+EG++L +PQNFAV  ++++E FE+V+FK
Sbjct  384  LNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFK 443
Query  471  TDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRA 528
            T+    ++ +AG  S I  LPEEV+AN+  +PRE AR+LK N     +V     S R+
Sbjct  444  TNENAMVSPLAGRTSAIRALPEEVLANALQIPREDARRLKFNRQESTLVRSRPSSSRS 501

Sequence Alignment: 15. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 179.0 bits 758,  Expect = 6e-46
 Identities = 244/488 50%, Positives = 331/488 67%, Gaps = 53/488 10%
Query  1    MAKLLELSFCFCFLVL----GASSISF-RQQPEENACQFQRLNAQRPDNRIESEGGYIET 55
            MAK + LS  + FL++    G  + S  RQQ +   CQ+ RL+A  P NRIE+E G IE+
Sbjct  1    MAKPILLSI-YLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRIEAEAGVIES 59
Query  56   WNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEP 115
            W+PNNQ+F+CAGVA+ R  +  N L  P YSNAPQ ++I +GRG  G++FPGCP T+EE 
Sbjct  60   WDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFEES 119
Query  116  AQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVV 175
             +Q ++ QS+            + QQD HQK+  F EGD+IA P GVA W YND    VV
Sbjct  120  QRQSQQGQSR------------EFQQDRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVV 167
Query  176  AVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRRE 235
            A+SL DTNNN NQLDQ PR F LAGN + EF    QQ  +  RR              ++
Sbjct  168  AISLLDTNNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRR--------------QQ 213
Query  236  EREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEE 295
            +R+ RP G+H      GQ++   G N+FSGF  +FL  AF VD  +  + L  EN+    
Sbjct  214  QRQQRP-GEH------GQQQRGLGNNVFSGFDADFLADAFNVDT-ETARRLQSENDHRR- 264
Query  296  GAIVTVRG-GLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGG--GNGIEETIC 352
             +IV V G  L+++ P  +R   E EE  E + E  E +  R +  RGG   NG+EETIC
Sbjct  265  -SIVRVEGRQLQVIRPRWSREEQEREERKERERE-RESESERRQSRRGGRDDNGLEETIC 322
Query  353  TACVKKNIGGNRSPHIYDPQ--RWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYN 410
            T  +++NIG      IY  +  R  T N H L   +LRWL LSAE G LY +AL+VPH+N
Sbjct  323  TLRLRENIGDPSRADIYTEEAGRISTVNSHTLP--VLRWLQLSAERGALYSDALYVPHWN 380
Query  411  TNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK 470
             NAHS++YALRGRA VQVVD+ G  V+D+EL+EG++L +PQNFAV  ++++E FE+V+FK
Sbjct  381  LNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFK 440
Query  471  TDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFV---PPFQQSPR 527
            T+    ++ +AG  S I  LPEEV+A ++ +PRE AR+LK N     +V   P   +S R
Sbjct  441  TNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLKFNRQESTLVRSRPSRSRSSR 500
Query  528  A 528
            +
Sbjct  501  S 501

Sequence Alignment: 16. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 161.5 bits 681,  Expect = 1e-40
 Identities = 211/463 45%, Positives = 314/463 67%, Gaps = 56/463 12%
Query  12   CFLVLGASSISFRQQ--PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVA 69
            C+L+L    ++ RQ+   +    Q+ +L A+ PDN I+SE G  E+WNP++ +F+ AGVA
Sbjct  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
Query  70   LSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEE--PAQ-QGRRYQSQR 126
            + R  +  N L  P Y NAPQ I+I +GRG +G +FPGC  T+E+  P Q Q ++ Q Q 
Sbjct  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
Query  127  PPRRLQEEDQSQQQ------QDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
             P R QE  Q QQQ      QD HQK+    EGD+IA+P GVA+W YN+ +  +VAVSL 
Sbjct  121  RPSR-QEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLL 179
Query  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
            D NN+ NQLDQ PRRF LAGN + EF   QQQ RQ +++                     
Sbjct  180  DLNNDQNQLDQVPRRFYLAGNPQDEF-NPQQQGRQQQQQQ-------------------- 218
Query  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVT 300
             +GQ+             G NIFSGF  ++L QA+ V+  +  +NL G++++  E  IV 
Sbjct  219  -QGQQG-----------NGNNIFSGFDTQLLAQALNVNP-ETARNLQGQDDNRNE--IVR 263
Query  301  VRGGLRILSP----DGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGG---NGIEETICT 353
            V+G L  +SP     G RG D+E + +E Q +   ++ +R +  +GGG   NG+EET C+
Sbjct  264  VQGQLDFVSPFSRSAGGRG-DQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCS 322
Query  354  ACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNA 413
            A + +NIG       Y+PQ       +  +L ILR+L LSAE G LY NA++ PH++TNA
Sbjct  323  ARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNA 382
Query  414  HSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDS 473
            ++++YA+RG A VQVV+ NG+ + D+E++EG+++++PQN AV  ++ +E FEY++F+TD 
Sbjct  383  NALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDE 442
Query  474  RPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNN 512
                  +AG  S +  LP+EV+ N++ + R++AR LK N
Sbjct  443  NGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYN 481

Sequence Alignment: 17. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 144.9 bits 608,  Expect = 1e-35
 Identities = 214/431 49%, Positives = 307/431 71%, Gaps = 76/431 17%
Query  12   CFLVLGASSISFRQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVAL 70
            CFL+L    ++ RQ+  +++ CQ  RL+A  PDNR+E E G +E W+PN+++F CAGVAL
Sbjct  4    CFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVAL 63
Query  71   SRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRR 130
             R  ++ N L  P YSNAPQ I++ QG G  G+ +PGCP TY+ P QQGR          
Sbjct  64   VRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAP-QQGR---------- 112
Query  131  LQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLD 190
              ++ QS + QD HQK+ RF  GD+IA+P GVA W YN+ ++ VV V+L D +N+ NQLD
Sbjct  113  --QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLD 170
Query  191  QFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRER 250
            + PR+F+LAGN +  F   QQQ  QSR                                 
Sbjct  171  RTPRKFHLAGNPKDVF--QQQQQHQSR--------------------------------- 195
Query  251  AGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGG-LRILS 309
                    G N+FSGF  E+L +AFQVD+R +++ L  E+     G IV V+   LR++ 
Sbjct  196  --------GRNLFSGFDTELLAEAFQVDER-LIKQLKSED---NRGGIVKVKDDELRVIR 243
Query  310  PDGT---RGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSP 366
            P  +   RG++ EEE ++++  + ++D           NGIEETICT  +K+NI      
Sbjct  244  PSRSQSERGSESEEESEDEKRRWGQRD-----------NGIEETICTMRLKENINDPARA 292
Query  367  HIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHV 426
             IY P+       + LNL IL+WL LS E G LY+NAL +PH+N N+HSIIY  +G+ +V
Sbjct  293  DIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQV 352
Query  427  QVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSF 486
            QVVD+ GNRV+D E++EG++LVVPQNFAV  +++ E FE+++FKT+ R   + +AG  S 
Sbjct  353  QVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSV 412
Query  487  IDNLPEEVVANSYGLPREQARQLKNNN 513
            +  +PEEV+AN++ + RE AR++K NN
Sbjct  413  LGGMPEEVLANAFQISREDARKIKFNN 439

Sequence Alignment: 18. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 139.4 bits 584,  Expect = 5e-34
 Identities = 226/451 50%, Positives = 317/451 70%, Gaps = 66/451 14%
Query  1    MAKLLELSFCFCFLVLGASSISFRQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWNPN 59
            MA    LS+  C+L+L    ++ RQQ  ++N CQ  +L+A  PDNR+E E G +ETW+PN
Sbjct  1    MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPN 60
Query  60   NQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQG 119
            +++F CAGVA++R  ++ N LR P YSNAP  ++I +G G  G + PGCP TY+ P QQG
Sbjct  61   HEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAP-QQG 119
Query  120  RRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSL 179
                        Q+  QS + QD HQK++RF +GD+IA+P GVA W YN+ ++ VV V+L
Sbjct  120  ------------QQHGQSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTL 167
Query  180  TDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREF 239
             D +N+ NQLD +PR+FNLAGN E EF   QQQ +QSR                      
Sbjct  168  LDVSNSQNQLDMYPRKFNLAGNPEDEF--QQQQQQQSR---------------------- 203
Query  240  RPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV 299
                   RR    Q ++    NIF GF  + L + FQV+ + +V+ L  +NE +  GAIV
Sbjct  204  ------GRR----QSQQKSCNNIFCGFDTKILAEVFQVE-QSLVKQL--QNEKDNRGAIV 250
Query  300  TVRGGLRILSP---DGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACV 356
             V+G L+++ P      RG + EEE    +YE     GRRGR      NG+EETICT  +
Sbjct  251  KVKGDLQVIRPPRRQSERGFESEEE---SEYER----GRRGRD-----NGLEETICTMKL 298
Query  357  KKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSI 416
            K+NI       IY P+     + + LNL IL+WL LSAE G L  NAL VPH+N NAHSI
Sbjct  299  KENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHSI 358
Query  417  IYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPS 476
            +Y  +G A+VQVVD+ GN V+D E+ EG+++VVPQNFAV  +++ + FE+++FKT+ R  
Sbjct  359  VYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTNDRAM 418
Query  477  IANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNN 513
            I+ +AG  S +  +PEEV+AN++ + RE AR++K NN
Sbjct  419  ISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNN 455

Sequence Alignment: 19. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 128.2 bits 535,  Expect = 1e-30
 Identities = 198/444 44%, Positives = 283/444 63%, Gaps = 60/444 13%
Query  24   RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 83
            +QQ  +  CQ Q LNA  P  RIESE G  E W+ N ++++CA VA+ R  ++   L  P
Sbjct  35   QQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVP 94
Query  84   FYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDS 143
             Y NAP+ +++ QG G  G +FPGCP T++E +Q   R +S+R          SQQ  + 
Sbjct  95   SYDNAPELVYVVQGSGIHGAVFPGCPETFQEESQS--RSRSER----------SQQSGEQ 142
Query  144  HQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHE 203
            HQKV    EGD+IA+P GVA W+YN+  + +V V+L D  N++NQLDQ+ R+F L G+ +
Sbjct  143  HQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQ 202
Query  204  QEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIF 263
            QE     Q S QSR RS                     + Q SRR + GQ+      NI+
Sbjct  203  QEI----QGSGQSRSRS---------------------QSQSSRRGQQGQQ----SNNIL 233
Query  264  SGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYD 323
            S F  E L Q+F +D  Q+ + L  + E  + G IV V+  L +LSP             
Sbjct  234  SAFDEEILAQSFNIDT-QLARRL--QKEKRQRGIIVRVQEDLEVLSP----------HRQ 280
Query  324  EDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLN 383
            E + EY E+  RR R      NG+EET CT  +K NI       +Y+P+     + + LN
Sbjct  281  EQEQEYEEERERRQR------NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALN 334
Query  384  LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQE 443
            L ILR+L LSA+ G L+R+A++ PH+N NAHSI+Y  RG   +Q+V  NG  V+DEE++E
Sbjct  335  LPILRFLQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIRE 394
Query  444  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPR 503
            G+++VVPQNFAV  ++ S+ FE+V+FKT+     + +AG  S    LP +V+ NS+ + R
Sbjct  395  GQLVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISR 454
Query  504  EQARQLKNNNPFKFFVPPFQQSPR 527
            E AR+LK +        P   S R
Sbjct  455  EDARRLKESRSETTIFAPGSSSQR 478

Sequence Alignment: 20. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 122.5 bits 510,  Expect = 6e-29
 Identities = 184/476 38%, Positives = 276/476 57%, Gaps = 62/476 13%
Query  1    MAKLLELSFCFCFLVLGASSISF-------------RQQPE-ENACQFQRLNAQRPDNRI 46
            M+  L LSF +C++VL  S+  +             RQQ + ++ C  QRL A  P  R+
Sbjct  1    MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQRLTASEPSRRV 60
Query  47   ESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFP 106
             SE G  E W+ +  EF C G    R+V++   L  P YSNAP   F++QGRG  G++ P
Sbjct  61   RSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVIP 120
Query  107  GCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQ-DSHQKVHRFNEGDLIAVPTGVAFW 165
            GCP T++  ++     QSQR     Q E + +  + D HQK+ R  EGD+I  P GV  W
Sbjct  121  GCPETFQSDSEF-EYPQSQRGRHSRQSESEEESSRGDQHQKIFRIREGDVIPSPAGVVQW 179
Query  166  LYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSP 225
             +ND + D+++V+L D N+   QLD+  R F LAG  ++E  R +   RQSR        
Sbjct  180  THNDGNDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRE-TREEGSDRQSRE------- 231
Query  226  YSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQN 285
                                     +  +E   G NI+SGF  E L + F+  DR+ +  
Sbjct  232  -------------------------SDDDEALLGANILSGFQDEILHELFRDVDRETISK 266
Query  286  LWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGN 345
            L GEN+  + G IV  +  L++  P      D EEEY+ ++      D RRG+G  G  N
Sbjct  267  LRGEND--QRGFIVQAQD-LKLRVPQ-----DFEEEYERER-----GDRRRGQGGSGRSN 313
Query  346  GIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALF 405
            G+E+  C    ++N     + ++++P+       +  +L IL +L LSA++  LY+NA+ 
Sbjct  314  GVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAII 373
Query  406  VPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFE 465
             P +N NAHS +Y  RG   VQVV   G  V+D+++Q G++LVVPQ FAV  K+  E +E
Sbjct  374  GPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLE 433
Query  466  YVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQ 523
            +V +K       +   G  S +  +P EV+ANSY +  ++A +LKN         PFQ
Sbjct  434  WVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQ 491

Sequence Alignment: 21. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 122.3 bits 509,  Expect = 6e-29
 Identities = 193/435 44%, Positives = 277/435 63%, Gaps = 69/435 15%
Query  24   RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 83
            +QQ  +  CQ Q LNA  P  RIESE G  E W+ N ++++CA VA+ R  ++   L  P
Sbjct  35   QQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVP 94
Query  84   FYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDS 143
             Y+NAP+ +++ QG G  G +FPGCP T++E +Q   R Q  R  R       SQQ  + 
Sbjct  95   SYNNAPELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSER-------SQQSGEQ 147
Query  144  HQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHE 203
            HQKV    EGD+IA+P GVA W+YN+  + +V V+L D  N++NQLDQ+ R+F L G+ +
Sbjct  148  HQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGSPQ 207
Query  204  QEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIF 263
            QE     Q   QSR            SR          +GQ+S              NI+
Sbjct  208  QEIQGGGQSWSQSRS-----------SR----------KGQQS-------------NNIL 233
Query  264  SGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYD 323
            S F  E L Q+F +D  Q+V+ L  + E ++ G IV V+  L++LSP       +E+EY 
Sbjct  234  SAFDEEILAQSFNIDT-QLVKKL--QREEKQRGIIVRVKEDLQVLSPQ-----RQEKEYS 285
Query  324  EDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLN 383
            +                    NG+EET CT  +K NI       +Y+P+     + + LN
Sbjct  286  D--------------------NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALN 325
Query  384  LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQE 443
            L ILR+L LS E G LY+NA+  PH+N NAHSI+Y  RG   +Q+V  NG  V+DEE++E
Sbjct  326  LPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIRE 385
Query  444  GHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPR 503
            G+++VVPQNFAV  ++ S+ FE+V+FKT+    I+ +AG  S +  LP +V+ NS+ + R
Sbjct  386  GQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISR 445
Query  504  EQARQLKNNNPFKFFVPPFQQSPR 527
            E A  LK +        P  +S R
Sbjct  446  EDAWNLKESRSEMTIFAPGSRSQR 469

Sequence Alignment: 22. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 122.0 bits 508,  Expect = 8e-29
 Identities = 185/408 45%, Positives = 262/408 64%, Gaps = 74/408 18%
Query  32   CQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQE 91
            C+ +RL AQ P  R ESE G  E W+ NNQ+FECAGVA  R V++   L  P Y+NAPQ 
Sbjct  49   CRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLPHYNNAPQL 108
Query  92   IFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFN 151
            +++ +GRG  G + PGC  T+E   Q          PR    +D+ ++  D HQKV +F 
Sbjct  109  LYVVRGRGIQGTVIPGCAETFERDTQ----------PR----QDRRRRFMDRHQKVRQFR 154
Query  152  EGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQ 211
            +GD++A+P G+ +W+YN+    ++ V+L DT N  NQLDQ  R F LAGN         Q
Sbjct  155  QGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGN--------PQ 206
Query  212  QSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFL 271
              RQS              RP+ E+                  ++ E  NIF+GF  E L
Sbjct  207  GGRQSY-----------FGRPQTEK------------------QQGETKNIFNGFDDEIL 237
Query  272  EQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHE 331
              AF VD  Q  + L G+++    G IV     L I+ P    G +EEE ++ D Y    
Sbjct  238  ADAFGVD-VQTARRLKGQDDL--RGRIVRAER-LDIVLP----GEEEEERWERDPY---- 285
Query  332  QDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLG 391
                       G NG+EET+CTA +++N+       +Y+P+     + + L L +L WL 
Sbjct  286  ----------SGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLR 335
Query  392  LSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQ 451
            LSAE G LYRN L  PH+N NAHSIIY  RG    QVV   G  V+D  ++EG++++VPQ
Sbjct  336  LSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQ 395
Query  452  NFAVAGK-SQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLK 510
            N+ VA + SQ E +E+++FKT+     + +AG  S I  +PEEVV  +Y + R++AR+LK
Sbjct  396  NYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLK 455
Query  511  NN 512
             N
Sbjct  456  YN 457

Sequence Alignment: 23. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 119.8 bits 498,  Expect = 3e-28
 Identities = 168/388 43%, Positives = 252/388 64%, Gaps = 61/388 15%
Query  49   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 108
            E G  E W+ NN++++CA VA+ R  +++  L  P Y+N  +  ++ QGRG  G +FPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  109  PSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYN 168
            P TY++  QQ    QS+        + +  + QD HQKV ++ EGD++A+PTG A W+YN
Sbjct  61   PETYQDQQQQ----QSH--------QSEGSRSQDQHQKVRQLREGDIVAMPTGSAHWIYN 108
Query  169  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSP 228
            +  + +V V+L D  N+DNQLDQ+ R+F + GN +QE+  Y Q S+ SR           
Sbjct  109  NGQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQ-SQGSRSY--------- 158
Query  229  HSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWG 288
                           Q S+ E  G      GGNIF+GF   +L  AF V+  +I++ L  
Sbjct  159  ---------------QGSQGE--GGSRRSSGGNIFNGFDERLLADAFNVNP-EIIRRL-- 198
Query  289  ENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIE 348
            +      G IV V   L +L P   RG  E+E+      E+           RG  NG+E
Sbjct  199  QKPQLPRGIIVRVEEELEVLRPQ--RGEQEQEQ------EF-----------RGRDNGLE 239
Query  349  ETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPH 408
            ET CT  +K NI       +Y+P+       + +NL +LRW+ LSAE GNLY+NA + PH
Sbjct  240  ETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPH 299
Query  409  YNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 468
            +N N+HS++Y  RG   VQ+V  NGN VYD +++EG+++VVPQ +AV  K+ ++ +E+++
Sbjct  300  WNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKKASNQGLEWIS 359
Query  469  FKTDSRPSIANFAGENSFIDNLPEEVVAN 497
            FKT+     + +AG NS I  LP +V+ N
Sbjct  360  FKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 24. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 117.8 bits 489,  Expect = 1e-27
 Identities = 168/389 43%, Positives = 253/389 65%, Gaps = 60/389 15%
Query  49   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 108
            E G  E W+ NN++++CA VA+ R  +++  L  P Y+N  +  ++ QGRG  G +FPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  109  PSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYN 168
            P TY++  QQ    QS+        + +  + QD HQKV ++ EGD++AVPTG A W+YN
Sbjct  61   PETYQDQQQQ----QSH--------QSEGSRSQDQHQKVRQLREGDIVAVPTGSAHWIYN 108
Query  169  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSP 228
            +  + +V V+L D  N+DNQLDQ+ R+F + GN +QE+  Y Q S+ SR           
Sbjct  109  NGQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQ-SQGSRSY--------- 158
Query  229  HSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWG 288
                           Q S+ E  G      GGNIF+GF   +L  AF V+  +I++ L  
Sbjct  159  ---------------QGSQGE--GSSRRSSGGNIFNGFDERLLADAFNVNP-EIIRRL-- 198
Query  289  ENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIE 348
            +      G IV V   L +L P   RG ++E+E      E+           RG  NG+E
Sbjct  199  QKPQLPRGIIVRVEEELEVLRPQ--RGQEQEQEQ-----EF-----------RGRDNGLE 240
Query  349  ETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPH 408
            ET CT  +K NI       +Y+P+       + +NL +LRW+ LSAE GNLY+NA + PH
Sbjct  241  ETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPH 300
Query  409  YNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 468
            +N N+HS++Y  RG   VQ+V  NGN VYD +++EG+++VVPQ +AV  ++ ++ +E+++
Sbjct  301  WNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKRASNQGLEWIS 360
Query  469  FKTDSRPSIANFAGENSFIDNLPEEVVAN 497
            FKT+     + +AG NS I  LP +V+ N
Sbjct  361  FKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 25. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 117.7 bits 489,  Expect = 2e-27
 Identities = 190/434 43%, Positives = 270/434 62%, Gaps = 72/434 16%
Query  25   QQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPF 84
            Q P   AC+++ L AQ P  R E+E  + E W+ +N EF+CAGV + R  +R   L  P 
Sbjct  43   QSPR--ACRLENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPG 100
Query  85   YSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSH 144
            +SNAP+ IF+ QG G  G+  PGC  TY+      RR QS                +D H
Sbjct  101  FSNAPKLIFVAQGFGIRGIAIPGCAETYQTDL---RRSQSA-----------GSAFKDQH 146
Query  145  QKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQ 204
            QK+  F EGDL+ VP GV+ W+YN   +D+V + + DT N  NQ+D + R+F LAG    
Sbjct  147  QKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAG---- 202
Query  205  EFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFS 264
                                      RP + ER      + SR+  +G++     GNIFS
Sbjct  203  --------------------------RPEQVERGVEEWERSSRKGSSGEK----SGNIFS 232
Query  265  GFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDE 324
            GF  EFLE+AFQ+D   +V+ L GE+  +E   IV V   + +L P+      +EEE   
Sbjct  233  GFADEFLEEAFQIDG-GLVRKLKGED--DERDRIVQVDEDFEVLLPE-----KDEEERSR 284
Query  325  DQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQ--RWFTQNCHDL 382
             +Y   E +           NG+EETICT  +K+NIG +    +++P+  R  T N H L
Sbjct  285  GRYIESESESE---------NGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTL 335
Query  383  NLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQ 442
               ILR + LSAE G LY NA+  PHY  N+HS++YA RG A VQVVD+ G  V+D E++
Sbjct  336  P--ILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVR 393
Query  443  EGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLP 502
            EG+VL++PQNF V  ++    FE++AFKT+       +AG  S +  LP  V++N Y + 
Sbjct  394  EGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLSNMYRIS 453
Query  503  REQARQLK-NNNPFKFFVPPFQQSPR 527
            RE+A++LK      + + P   Q  R
Sbjct  454  REEAQRLKYGQQEMRVLSPGRSQGRR 479

Sequence Alignment: 26. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 115.0 bits 477,  Expect = 8e-27
 Identities = 171/389 43%, Positives = 252/389 64%, Gaps = 60/389 15%
Query  49   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 108
            E G  E W+ NNQ+++CA VA+ R  +++N L  P Y+N P+  ++ QGRG  G + PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  109  PSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYN 168
            P TY++  QQ    QS   P       +  + QD HQKV +  EGD+IA+PTG A W+YN
Sbjct  61   PETYQDEQQQ---QQSFSYP------SEGSRSQDQHQKVRQIREGDIIALPTGSAHWIYN 111
Query  169  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSP 228
            +  + +V V+L D  N+DNQLDQ+ R+F L GN + ++    Q + QS+           
Sbjct  112  NGQSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQPQL----QGTSQSQ----------- 156
Query  229  HSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWG 288
                R +ER     G  SRR            NIF+GF   +L +AF V+  ++++ L  
Sbjct  157  --GGRYQERL--GGGDSSRR----------SANIFNGFDERLLAEAFNVNP-ELIRRL-- 199
Query  289  ENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIE 348
            +    + G I+ V   +R+L+P   RG   +E Y+ D Y      GR         NG+E
Sbjct  200  QRPQMQRGIIIRVEEEFRVLTPQ--RG---QESYESDPY------GRY--------NGVE 240
Query  349  ETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPH 408
            ET+CT  ++ NI       +Y+P+       + LNL +LRWL LSAE GNLY+NAL  PH
Sbjct  241  ETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGNLYKNALTAPH 300
Query  409  YNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 468
            +N NAHSI+Y  RG   VQ+V  NGN V+D E++EG+++VVPQ FAV  ++ +  +E+++
Sbjct  301  WNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVKRASNRGLEWIS 360
Query  469  FKTDSRPSIANFAGENSFIDNLPEEVVAN 497
            FKT+       +AG  S +  LP +V+ N
Sbjct  361  FKTNDYAMTNQLAGRVSVLRALPLDVIQN 389

Sequence Alignment: 27. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 112.9 bits 468,  Expect = 5e-26
 Identities = 190/484 39%, Positives = 285/484 58%, Gaps = 110/484 22%
Query  1    MAKLLELSFCFCFLVLGASS--ISFRQ----------QPEENACQFQRLNAQRPDNRIES 48
            M+  L LSF +C++VL  S+  + +R+          Q   + C  QRL A  P  R+ S
Sbjct  1    MSTKLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLTASEPSRRVRS 60
Query  49   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 108
            E G  E W+ +  EF CAG    R+V++   L  P YSNAP   F++QGRG  G++ PGC
Sbjct  61   EAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGC 120
Query  109  PSTY------EEPA----QQGRRYQSQRPPRRLQEEDQSQQQQ----------------- 141
            P T+      E P     Q+ R+ +S+   R  Q   QS+ ++                 
Sbjct  121  PETFQSESEFEYPQSQRDQRSRQSESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFS 180
Query  142  --------------------------------DSHQKVHRFNEGDLIAVPTGVAFWLYND 169
                                            D HQK+ R  +GD+I  P GV  W +ND
Sbjct  181  RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHND 240
Query  170  HDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPH 229
             D D+++++L D N+  NQLD   R F LAG           QS+QSR            
Sbjct  241  GDNDLISITLYDANSFQNQLDGNVRNFFLAG-----------QSKQSRE----------- 278
Query  230  SRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGE 289
               RR +R+ R  G   +   +  +E     NI++GF  E L++ F+  D++ +  L G+
Sbjct  279  --DRRSQRQTREEGSDRQSRESDDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGD 336
Query  290  NESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEE 349
            N+  + G IV  R  L++  P         EEY+E   E + + G R RG  G  NG+E+
Sbjct  337  ND--QRGFIVQARD-LKLRVP---------EEYEE---ELQRERGDRKRGGSGRSNGLEQ 381
Query  350  TICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHY 409
              C    K+N+       +++P+       +  NL IL ++ LSA++  LY+NA++ P +
Sbjct  382  AFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRW 441
Query  410  NTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAF 469
            N NAHS +Y  RG   VQVV   G  V+D+ +Q G++LVVPQ FAV  K+  E +E+V +
Sbjct  442  NLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVEL 501
Query  470  KTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQ 523
            K D     +  AG+ S +  +P EV+ANSY +  ++A +LKN         PFQ
Sbjct  502  KNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQ 555

Sequence Alignment: 28. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 111.3 bits 461,  Expect = 1e-25
 Identities = 197/483 40%, Positives = 287/483 59%, Gaps = 82/483 16%
Query  1    MAKLLELSFCFCFLVLGASSISF------RQQPE------ENACQFQRLNAQRPDNRIES 48
            M+  L LSF +C++VL  S+  +      R +P       ++ C  QRL A  P  R+ S
Sbjct  1    MSTKLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLTASEPSRRVRS 60
Query  49   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 108
            E G  E W+ +  EF CAG    R+V++   L  P YSNAP   F++QGRG  G++ PGC
Sbjct  61   EAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGC 120
Query  109  PSTY------EEPAQQ--GRRYQS---------QRPPRRLQEE----DQSQQQQ------ 141
            P T+      E P  Q   R  QS         QR  +   EE    DQ  +Q       
Sbjct  121  PETFQSGSEFEYPRSQRDQRSRQSESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFS 180
Query  142  --DSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA 199
              D HQK+ R  +GD+I  P GV  W +N+ D D+++++L D N+  NQLD+  R F LA
Sbjct  181  RGDQHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLA 240
Query  200  GNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDE- 258
            G           QS+QSR               RR +R+ R  G   R+ R  Q++E   
Sbjct  241  G-----------QSKQSRE-------------DRRSQRQTREEGS-DRQSRESQDDEALL 275
Query  259  GGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADE 318
              NI+SGF  E L++ F+  D++ +  L GEN+  + G IV  R  L++  P        
Sbjct  276  EANILSGFEDEILQEIFRNVDQETISKLRGEND--QRGFIVQARD-LKLRVP-------- 324
Query  319  EEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQN 378
             EEY+E   E + + G R RG  G  NG+E+  C    ++N+       +++P+      
Sbjct  325  -EEYEE---ELQRERGDRKRGGSGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINT 380
Query  379  CHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYD 438
                NL IL ++ LSA++  LY+NA++ P +N NAHS +Y  RG   VQVV   G  V+D
Sbjct  381  VDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFD 440
Query  439  EELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANS 498
            + +Q G++LVVPQ FAV  K+  E +E+V +K D     +  AG+ S +  +P EV+ANS
Sbjct  441  DNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANS 500
Query  499  YGLPREQARQLKNNNPFKFFVPPFQ 523
            Y +  ++A +LKN         PFQ
Sbjct  501  YDISTKEAFRLKNGRQEVEVFRPFQ 525

Sequence Alignment: 29. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 110.4 bits 457,  Expect = 2e-25
 Identities = 195/463 42%, Positives = 287/463 61%, Gaps = 69/463 14%
Query  1    MAKLLELSFCFCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNN 60
            MAKL+ LS+   +L     +I + Q+ E   C+ QRL AQ P  R+E+E G  E W+  +
Sbjct  1    MAKLFLLSLGIFLLFHCCLAIEYEQE-ELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTD 59
Query  61   QEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGR 120
            Q+F CAGVA  R  +R   L  P Y+NAP+  ++ QGRG +G++ PGCP T++  +Q   
Sbjct  60   QQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQ--- 116
Query  121  RYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLT 180
             +Q  R     ++E++  + QD HQKVH + +GD+IA+P GVA+W YND D D+V V + 
Sbjct  117  -FQGSR-----EQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQ 170
Query  181  DTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFR 240
             T ++ NQLDQ PR F LAGN      R Q+Q  +  R  L                   
Sbjct  171  HTASDLNQLDQNPRHFFLAGN----IQRSQKQ--RGERYGL------------------- 205
Query  241  PRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVD-DRQIVQNLWGENESEEEGAIV 299
                     R GQ+   +  N+F GF  E L   +    D +  + + GE++  + G IV
Sbjct  206  ---------RGGQQILAD--NVFKGFNMEALADVLGFGMDTETARKVRGEDD--QRGHIV 252
Query  300  TVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKN 359
             V  GL+++ P   R   EE E         +Q+G       GG NG+EETIC+A   +N
Sbjct  253  RVEQGLKVIRPPRIR---EELE---------QQEG-------GGYNGLEETICSATFIQN 293
Query  360  IGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYA 419
            I        Y+P+       + L + IL +L LSA  G LY NA+  P +  NA+S++YA
Sbjct  294  IDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYA 353
Query  420  LRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIAN 479
            +RG A VQ+VD  G  V+D+ L+EG+++VVPQNF V  ++ S  FE+V F T+     + 
Sbjct  354  VRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFST 413
Query  480  FAGENSFIDNLPEEVVANSYGLPREQARQLK-NNNPFKFFVPPFQQSPRAVA 530
             AG  S +  +P  V+AN+Y L +E+AR++K N +   +F P  +   RA A
Sbjct  414  AAGRTSPLRGIPVGVLANAYRLSQEEARRIKLNRDEAVLFQPGSRSRGRASA 465

Sequence Alignment: 30. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 107.3 bits 443,  Expect = 2e-24
 Identities = 166/383 43%, Positives = 245/383 63%, Gaps = 63/383 16%
Query  49   EGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGC 108
            E G  E W+ NN +++CA VA+ R  +++N L  P Y+N  +  ++ QGRG  G +FPGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  109  PSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYN 168
            P TY++  QQ + YQSQ             + QD HQKV +  EGD+IA+PTG A W+YN
Sbjct  61   PETYQDQQQQ-QSYQSQ-----------GSRSQDQHQKVRQIREGDIIALPTGAAHWIYN 108
Query  169  DHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSP 228
            +  + +V V+L D  N+DNQLDQ+ R+F L GN + E+     Q    R++   Y     
Sbjct  109  NGGSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQPEL-----QGTSQRQQGGGYQGSQG 163
Query  229  HSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWG 288
                          G  SRR           GN+F+GF   +L  AF V+  ++++ L  
Sbjct  164  G-------------GGGSRR-----------GNMFNGFDERLLADAFNVNP-ELIRRL-- 196
Query  289  ENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIE 348
            +    + G IV V   +R+LSP   RG ++E+E        +EQD           NG+E
Sbjct  197  QRPQMQRGIIVRVEEEFRVLSPQ--RGQEQEQE--------QEQDC---------DNGVE 237
Query  349  ETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPH 408
            ET CT  ++ NI       +Y+P+       + +NL +LRWL LSAE GNLY+NAL  PH
Sbjct  238  ETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLYQNALTSPH 297
Query  409  YNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVA 468
            +N N HSI+Y  RG   +Q+V  NGN V++ E++EG+++V+PQ FAV  K+ +  +E++A
Sbjct  298  WNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKASNRGLEWIA 357
Query  469  FKTDSRPSIANFAGENSFIDNLPEEV 494
            FKT+       +AG  S +  LP +V
Sbjct  358  FKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 31. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 106.1 bits 438,  Expect = 5e-24
 Identities = 176/438 40%, Positives = 272/438 62%, Gaps = 86/438 19%
Query  7    LSFCFCFLVLGASSISFRQQP---EENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEF 63
            L++ + +LV  +++I+  ++P   +   C+FQR++  +P  RI+SEGG  E W+   ++F
Sbjct  8    LALSLSLLV--SAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQF 65
Query  64   ECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQ 123
            +CAG+   R  +R N L  P Y  +P+ ++I++G+G   ++ PGC  TY          Q
Sbjct  66   QCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETY----------Q 115
Query  124  SQRPPRRLQEEDQSQQQ-----QDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVS 178
             +R  R ++  + S+QQ     +D HQKVHR+ +GD++A+P+G A W YND   D+VAVS
Sbjct  116  VHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVS 175
Query  179  LTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREERE 238
            + D N+  NQLDQ  R F LAG                               PR  E+E
Sbjct  176  INDVNHLSNQLDQKFRAFYLAGG-----------------------------VPRSGEQE 206
Query  239  FRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAI 298
                 Q++R+            NIF  F  E+L +AF V    I +    ++E EE G I
Sbjct  207  -----QQARQTFH---------NIFRAFDAELLSEAFNVPQETIRRM---QSEEEERGLI 249
Query  299  VTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKK 358
            V  R  +  + PD       EEE ++++         RGR      NG+EET CT   + 
Sbjct  250  VMARERMTFVRPD-------EEEGEQEH---------RGRQL---DNGLEETFCTMKFRT 290
Query  359  NIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIY 418
            N+   R   I+  Q    +      L IL+++ LSAE GNLY NAL  P ++   H+I+Y
Sbjct  291  NVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVY 350
Query  419  ALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIA 478
              RG A+VQVVD NG  + ++ + +G ++VVPQ +    ++ +  FE+VAFKT   P  +
Sbjct  351  VTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRS 410
Query  479  NFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFK-FFVPP 521
             +AG  S I  +P +V+ NSY +   QA+ LK N   + F++ P
Sbjct  411  PLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSP 454

Sequence Alignment: 32. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 104.0 bits 429,  Expect = 2e-23
 Identities = 174/442 39%, Positives = 277/442 62%, Gaps = 97/442 21%
Query  4    LLELSFCFCFLVLGASSISFRQQPE-ENACQFQRLNAQRPDNRIESEGGYIETWNPNNQE 62
            LL L+ C+    LG         P+ ++AC +  L+  +P   I+SE G +E W+ N+ +
Sbjct  15   LLVLNGCLARQSLGVP-------PQVKDACNLDNLDVLQPTEVIKSEAGQVEYWDHNHPQ 67
Query  63   FECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTY---------- 112
              CAGV+++RLV+++  L  P + ++P   ++ QG G  G + PGC  T+          
Sbjct  68   IRCAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQ 127
Query  113  -EEPAQQGRRYQSQRPPRRLQEEDQSQQQQ------------------DSHQKVHRFNEG 153
             ++  QQG++ Q  +  ++ Q+  Q QQ Q                  D HQKV     G
Sbjct  128  GQQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHG 187
Query  154  DLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQS 213
            D IA+  G A W+YN  D  ++ VSL D  N  NQLD+ PR F LAGN++Q   + QQQ 
Sbjct  188  DAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGSSQQQQQQ 247
Query  214  RQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQ 273
            +Q                                             NI+SGF P+ L Q
Sbjct  248  QQ---------------------------------------------NILSGFDPQVLAQ 262
Query  274  AFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQD 333
            A+++D R + Q L  +N+ ++ G IV V+G ++++ P   R A     Y+ +Q+ +    
Sbjct  263  ALKIDVR-LAQEL--QNQQDKRGNIVRVKGPFQVVRPP-LRQA-----YESEQWRHP--- 310
Query  334  GRRGRGSRGGGNGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLS 393
              RG       NG+EETIC+    +NI       IY P      + +   L IL+++ LS
Sbjct  311  --RGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRVTSVNSYTLPILQYIRLS 368
Query  394  AEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNF 453
            A  G L  +A+ +P YN NA+ I+Y  +G+A +QVV+ NG  V D+++Q+G+++V+PQ F
Sbjct  369  ATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGF 428
Query  454  AVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNN 512
            A   +SQ+ NFE+++FKT++   I+ +AG  S +  LP EV+ N+Y +  E+AR++K N
Sbjct  429  AYVVQSQN-NFEWISFKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFN 486

Sequence Alignment: 33. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 100.4 bits 413,  Expect = 3e-22
 Identities = 222/487 45%, Positives = 314/487 64%, Gaps = 112/487 22%
Query  1    MAKLLELSFC-FCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPN 59
            M K + LS+  +C+L+L ++  +     + N CQ+  LNA  PD+R+ESEGG I+TWN  
Sbjct  1    MGKPFTLSLSSLCLLLLSSACFAI-SSSKLNECQLNNLNALEPDHRVESEGGLIQTWNSQ 59
Query  60   NQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQG 119
            + E++CAGV +S+L L RN L  P YS  P+ I I QG+G +G+  PGCP T+EEP +Q 
Sbjct  60   HPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQS 119
Query  120  RRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSL 179
             R  S+          Q QQ QDSHQK+  FNEGD++ +P GV +W YN  D  VVA+SL
Sbjct  120  NRRGSR---------SQKQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISL 170
Query  180  TDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREF 239
             DT+N +NQLDQ PR F LAGN + E+    QQ +Q +           H          
Sbjct  171  LDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKS----------HGG-------- 212
Query  240  RPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV 299
            R +GQH       QEEE+EGG+++SGF+  FL Q+F  ++  I + L  ++  +E   IV
Sbjct  213  RKQGQHQ------QEEEEEGGSVLSGFSKHFLAQSFNTNE-DIAEKL--QSPDDERKQIV 263
Query  300  TVRGGLRILSPDGTRGADEEEEYDED----QYEYH----------EQD---------GRR 336
            TV GGL ++SP      DE+E+ DED    Q   H          EQD          R 
Sbjct  264  TVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRP 323
Query  337  GRGSRGG------------------------------------------G----NGIEET 350
             R S+G                                           G    NG+EE 
Sbjct  324  SRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEEN 383
Query  351  ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYN 410
            ICT  + +NI        Y+P+       + L L  LR + LSA+Y  LY+N ++ PH+N
Sbjct  384  ICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWN 443
Query  411  TNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK 470
             NA+S+IY  RG+  V+VV+  GN V+D EL+ G++LVVPQNF VA ++  + FEY+ FK
Sbjct  444  LNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFK 503
Query  471  TDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQ--SPR 527
            T    ++ ++  +      +P EV+A+SY L + Q  +LK    +  +V P  Q  SPR
Sbjct  504  TH-HNAVTSYLKD--VFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPR 559

Sequence Alignment: 34. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 46.1 bits 175,  Expect = 5e-06
 Identities = 105/408 25%, Positives = 183/408 44%, Gaps = 59/408 14%
Query  113  EEPAQQGRR------YQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWL 166
            ++P QQ  R       Q Q P R+ Q + + ++Q   +Q   R  E        G     
Sbjct  5    QDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESKGREEEQ 64
Query  167  YNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPY 226
               +     + S+   + ++    ++  RF        E+LR  +  R     + P +  
Sbjct  65   QRHNPYYFHSQSIRSRHESEEGEVKYLERFA----ERTELLRGIENYRVVILDANPNTFM 120
Query  227  SPHSRPRREEREFRPRGQHSRRERAGQEEED---EGGNIF---SGFTPEFLEQAFQ---- 276
             PH +   E      RG+ +    + +  E    E G++    +G T   + Q       
Sbjct  121  LPHHKDA-ESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLE 179
Query  277  -VDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGR 335
             V   Q V N     E    GA    +  LR++S D    A      D  +  + +Q+ R
Sbjct  180  MVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAA-LNTPRDRLERFFDQQEQR 238
Query  336  RG---RGSRGGGNGIEETICTACVK----KNIGG-----NRSPHIYDPQRWFTQNCHDLN 383
             G   R S+     + +   +A  +    ++ GG     +  P   +    F + C + +
Sbjct  239  EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFEACPEEH 298
Query  384  LLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRA-------HV--QVVDSNGN 434
               L+ + +   Y  + R A+ VPHYN+ A  ++Y + G         HV  Q  +  G 
Sbjct  299  RQ-LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGR 357
Query  435  RVYDEE------------LQEGHVLVVPQNFAVA-GKSQSENFEYVAFKTDSRPSIANF- 480
            R  +EE            L  G ++V+P    +A   SQ+EN+  + F  +   +  NF 
Sbjct  358  REQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNFL 417
Query  481  AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPR 527
            AG+NS I+ L  E    S+ +PRE+  ++  +    +FVP  +QS R
Sbjct  418  AGQNSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTERQSRR 464

Sequence Alignment: 35. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 45.2 bits 171,  Expect = 1e-05
 Identities = 65/246 26%, Positives = 110/246 44%, Gaps = 18/246 7%
Query  261  NIFSGFTPEFLEQAFQVDDRQ---IVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGAD 317
            +++SGF    L  AF V   Q   I+ +  G       G     R  L  +     R   
Sbjct  190  SVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQ 249
Query  318  EEE--EYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIGGNR-SPHIYDPQRW 374
            E+E    D+D+ E  E D    R       G  +  C    K  +  +  S ++YD +  
Sbjct  250  EKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGD--CRVQRKHKLAHSPGSYNLYDTEPS 307
Query  375  FTQNCHDLNLLI-------LRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQ 427
            + QN +  ++ I       L+   L     NL   A++ PH N  A      LRG   +Q
Sbjct  308  Y-QNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQ 366
Query  428  VVDSNGNRVYDEELQEGHVLVVPQNFAVAG-KSQSENFEYVAFKTDSRPSIANF-AGENS 485
            VV  NG    + ++ EG V+ +P+ F      S    +E+  F T +R +   F  G++S
Sbjct  367  VVFPNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGKSS 426
Query  486  FIDNLPEEVVANSYGLPREQARQL 509
            ++ ++    +A ++G+  EQ  ++
Sbjct  427  LLHSMRGPELAAAFGVSEEQLERI 450

Sequence Alignment: 36. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 45.2 bits 171,  Expect = 1e-05
 Identities = 121/491 24%, Positives = 214/491 43%, Gaps = 65/491 13%
Query  24   RQQPEENACQFQRLNAQRP-DNRIESEGGYIETWNPNN--QEFE-CAGVALSRLVLRRNA 79
            +QQ  +  C+ +    QR  + R    G  ++  NP +  Q +E C      +   +   
Sbjct  34   QQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQT 93
Query  80   L--RRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQS 137
            L  RR       +E   Q+GR          P       Q+  + Q Q P R+ Q + + 
Sbjct  94   LCRRRCEQRRQQEERERQRGRDRQD------PQQQYHRCQRRCQIQEQSPERQRQCQQRC 147
Query  138  QQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFN 197
            ++Q   +Q   R  E        G        +     + S+   + ++    ++  RF 
Sbjct  148  ERQYKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERF- 206
Query  198  LAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEED 257
                   E+LR  +  R     + P +   PH +   E      RG+ +    + +  E 
Sbjct  207  ---TERTELLRGIENYRVVILDANPNTSMLPHHKDA-ESVAVVTRGRATLTLVSQETRES 262
Query  258  ---EGGNIF---SGFTPEFLEQAFQ-----VDDRQIVQNLWGENESEEEGAIVTVRGGLR 306
               E G++    +G T   + Q        V   Q V N     E    GA    +  LR
Sbjct  263  FNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLR 322
Query  307  ILSPDGTRGADEEEEYDEDQYEYHEQDGRRG---RGSRGGGNGIEETICTACVK----KN 359
            ++S D    A      D  +  + +Q+ R G   R S+     + +   +A  +    ++
Sbjct  323  VFSNDILVAA-LNTPRDRLERFFDQQEQREGVIIRASQEKLRALSQHAMSAGQRPWGRRS 381
Query  360  IGG-----NRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAH 414
             GG     + SP   +    F + C + +   L+ + +   Y  + R A+ VPHYN+ A 
Sbjct  382  SGGPISLKSESPSYSNQFGQFFEACPEEHRQ-LQEMDVLVNYAEIKRGAMMVPHYNSKAT 440
Query  415  SIIYALRGRA-------HV--QVVDSNGNRVYDEE------------LQEGHVLVVPQNF 453
             ++Y + G         HV  Q  +  G R  +EE            L  G ++V+P   
Sbjct  441  VVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGH 500
Query  454  AVA-GKSQSENFEYVAFKTDSRPSIANF-AGENSFIDNLPEEVVANSYGLPREQARQLKN 511
             +A   SQ+EN+  + F  +   +  +F AG+N+ I+ L  E    S+ +PRE+  ++  
Sbjct  501  PIAITASQNENLRLLGFDINGENNQRDFLAGQNNIINQLEREAKELSFNMPREEIEEIFE 560
Query  512  NNPFKFFVPPFQQSPR 527
            +    +FVP  +QS R
Sbjct  561  SQMESYFVPTERQSRR 576

Sequence Alignment: 37. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 45.4 bits 172,  Expect = 2e-05
 Identities = 128/452 28%, Positives = 205/452 45%, Gaps = 92/452 20%
Query  24   RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 83
            R+  E+  C+ +R   QR     E + G  +  +P  Q   C          RR   +  
Sbjct  283  RRGQEQQLCR-RRCEQQRQQEERERQRGR-DRQDPQQQYHRCQ---------RRCQTQE- 330
Query  84   FYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRY-QSQRPPRRLQEEDQSQQQQD 142
                +P+     Q R         C   Y+E  QQGR +   Q  PRR  E    +++Q 
Sbjct  331  ---QSPERQRQCQQR---------CERQYKE--QQGREWGPDQASPRR--ESRGREEEQQ 374
Query  143  SHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNH 202
             H   +  ++G      +G     Y +  T+   +     N     L+  P  F L  + 
Sbjct  375  RHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHK 434
Query  203  EQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNI 262
            + E +    + R     +L +      S+ RRE   F        R  AG  E      +
Sbjct  435  DAESVIVVTRGRA----TLTFV-----SQERRE--SFNLEYGDVIRVPAGATEY-----V 478
Query  263  FSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGLRILSPDGTRGADEEEEY 322
             +  + E LE    V   Q V N     E    GA  T    LR++S D    A      
Sbjct  479  INQDSNERLE---MVKLLQPVNNPGQFREYYAAGAQST-ESYLRVFSNDILVAA-LNTPR 533
Query  323  DEDQYEYHEQDGRRG---RGSRGGGNGIEETICTACVKKNIGGNRS---PHIYDPQR--- 373
            D  +  + +Q+ R G   R S+     + +   +A   +   G RS   P     QR   
Sbjct  534  DRLERFFDQQEQREGVIIRASQEKLRALSQHAMSA--GQRPWGRRSSGGPISLKSQRSSY 591
Query  374  -----WFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHV-- 426
                  F + C + +   L+ + +   Y  + R A+ VPHYN+ A  ++Y + G      
Sbjct  592  SNQFGQFFEACPEEHRQ-LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEM 650
Query  427  --------QVVDSNGNRVYDEE-------------LQEGHVLVVPQNFAVA-GKSQSENF 464
                    Q  +  G R  +EE             L  G ++V+P    +A   SQ+EN+
Sbjct  651  ACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENL 710
Query  465  EYVAFKTDSRPSIANF-AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQ 523
              V F  + + +  NF AG+N+ I+ L  E    S+ +PRE+  ++       +FVP  +
Sbjct  711  RLVGFGINGKNNQRNFLAGQNNIINQLEREAKELSFNMPREEIEEIFERQVESYFVPMER 770
Query  524  QSPR 527
            QS R
Sbjct  771  QSRR 774

Sequence Alignment: 38. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 39.3 bits 145,  Expect = 0.0006
 Identities = 59/261 22%, Positives = 121/261 46%, Gaps = 21/261 8%
Query  261  NIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTVRGGL--RILSPDGTRGADE 318
            +++SGF P  LE AF  + R +V+ ++ +   E +G I+ V       + +       D+
Sbjct  169  SVLSGFEPAILETAFN-ESRTVVEEIFSK---ELDGPIMFVDDSHAPSLWTKFLQLKKDD 224
Query  319  EEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVK---KNIGGN-RSPHIYDPQR- 373
            +E+  +   + +E+D    + SR     +E        K   K+  G+  S ++YD ++ 
Sbjct  225  KEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKA 284
Query  374  -------WFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHV 426
                   W ++  H      L    +      L   +++ PH N  +      L G   +
Sbjct  285  DFKNAYGW-SKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLSGYGEL 343
Query  427  QVVDSNGNRVYDEELQEGHVLVVPQNFAVAG-KSQSENFEYVAFKTDSRPSIANF-AGEN 484
            ++   NG+R    ++++G V+VVP+ F      S+   +E+  F T +R +   F AG  
Sbjct  344  HIGYPNGSRAMKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAA 403
Query  485  SFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSP 526
            S++  L    ++ ++G+  +  R+  +       +P    +P
Sbjct  404  SLLRTLMGPELSAAFGVSEDTLRRAVDAQHEAVILPSAWAAP 445

Sequence Alignment: 39. Allergen Name: Tri a gliadin Sequence ID: CAA35238

 Score = 34.9 bits 125,  Expect = 0.008
 Identities = 39/156 25%, Positives = 74/156 47%, Gaps = 18/156 11%
Query  105  FPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHR--FNEGDLIAVPTGV 162
            +P     Y +P Q   + Q Q+  ++ Q++ Q QQQQ  +Q +++      D++     +
Sbjct  114  YPQSQPQYSQPQQPISQQQQQQQQQQQQKQQQQQQQQILQQILQQQLIPCRDVVLQQHSI 173
Query  163  AFWLYNDHDTDVVAVSLTDTNNND--NQLDQFPRRFNLAGNHE--QEFLRYQQQSRQSRR 218
            A+       + V+  S           QL Q P +      H   +  + +QQQ +Q ++
Sbjct  174  AY-----GSSQVLQQSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQ 228
Query  219  RSLPYSPYSPHSRPRREEREFRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLE 272
            +  P S  S   +P+++     P GQ S +    Q+     G++     P+F E
Sbjct  229  QQQPLSQVS-FQQPQQQ----YPSGQGSFQP--SQQNPQAQGSVQPQQLPQFEE 275

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.