The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRKVEHSRHDAINIFN
VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV
DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR
DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA
SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN
GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV
QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS
GHVIPACKNLSPSAKRKESKSHKHPKTVMVKNMGAYDKGNRTRILLGSRPPNCTNKCHGC
SPCKAKLVIVHRIMPQEYYPQRWMCSRHGKIYHP
Sequence Info Allergen Name Length Opt Bits Score E Value
P43212 Cry j 2 514 3531 811.1 0
BAA06172 Cry j 2 514 3458 794.5 0
Q7M1E7 Cha o 2.0101 514 2705 622.8 1.4e-179
CAC05582 Jun a 2 507 2533 583.6 8.7e-168
Q6H9K0 Pla a 2 377 897 210.8 1.1e-55
ABY21306 Pla or 2.0101 378 895 210.3 1.5e-55
C9EA45 Cari p 1.0101 494 891 209.3 3.9e-55
A0A077B155 Sor h 13.0101 422 874 205.5 4.8e-54
CAB42886 Phl p 13 394 865 203.5 1.8e-53
A0A077B569 Sor h 13.0201 410 862 202.8 3.1e-53
AHL24657 Sal k 6.0101 379 797 188.0 8.1e-49
ARS33724 Sal k 6.0101 401 797 188.0 8.7e-49
W8PPL3 Ole e 14.0101 379 781 184.3 1e-47
C0HKB1 Cup s 2.0101 164 257 65.4 2.8e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cry j 2 Sequence ID: P43212

 Score = 811.1 bits 3531,  Expect = 0
 Identities = 514/514 100%, Positives = 514/514 100%, Gaps = 0/514 0%
Query  1    MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRKVEHSRHDAINIFN 60
            MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRKVEHSRHDAINIFN
Sbjct  1    MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRKVEHSRHDAINIFN 60
Query  61   VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV 120
            VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV
Sbjct  61   VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV 120
Query  121  DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR 180
            DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR
Sbjct  121  DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR 180
Query  181  DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA 240
            DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA
Sbjct  181  DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA 240
Query  241  SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN 300
            SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN
Sbjct  241  SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN 300
Query  301  GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV 360
            GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV
Sbjct  301  GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV 360
Query  361  QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS 420
            QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS
Sbjct  361  QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS 420
Query  421  GHVIPACKNLSPSAKRKESKSHKHPKTVMVKNMGAYDKGNRTRILLGSRPPNCTNKCHGC 480
            GHVIPACKNLSPSAKRKESKSHKHPKTVMVKNMGAYDKGNRTRILLGSRPPNCTNKCHGC
Sbjct  421  GHVIPACKNLSPSAKRKESKSHKHPKTVMVKNMGAYDKGNRTRILLGSRPPNCTNKCHGC 480
Query  481  SPCKAKLVIVHRIMPQEYYPQRWMCSRHGKIYHP 514
            SPCKAKLVIVHRIMPQEYYPQRWMCSRHGKIYHP
Sbjct  481  SPCKAKLVIVHRIMPQEYYPQRWMCSRHGKIYHP 514

Sequence Alignment: 2. Allergen Name: Cry j 2 Sequence ID: BAA06172

 Score = 794.5 bits 3458,  Expect = 0
 Identities = 503/514 97%, Positives = 510/514 99%, Gaps = 0/514 0%
Query  1    MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRKVEHSRHDAINIFN 60
            MAMK+IAPMAF+AMQLIIMAAAEDQSAQIMLDS +E+YLRSNRSLRKVEHSRHDAINIFN
Sbjct  1    MAMKLIAPMAFLAMQLIIMAAAEDQSAQIMLDSVVEKYLRSNRSLRKVEHSRHDAINIFN 60
Query  61   VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV 120
            VEKYGAVGDGKHDCTEAFSTAWQAACK PSAMLLVPG+KKFVVNNLFFNGPCQPHFTFKV
Sbjct  61   VEKYGAVGDGKHDCTEAFSTAWQAACKNPSAMLLVPGSKKFVVNNLFFNGPCQPHFTFKV 120
Query  121  DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR 180
            DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR
Sbjct  121  DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR 180
Query  181  DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA 240
            DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA
Sbjct  181  DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA 240
Query  241  SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN 300
            SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN
Sbjct  241  SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN 300
Query  301  GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV 360
            GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV
Sbjct  301  GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV 360
Query  361  QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS 420
            QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS
Sbjct  361  QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS 420
Query  421  GHVIPACKNLSPSAKRKESKSHKHPKTVMVKNMGAYDKGNRTRILLGSRPPNCTNKCHGC 480
            GHVIPACKNLSPSAKRKESKSHKHPKTVMV+NM AYDKGNRTRILLGSRPPNCTNKCHGC
Sbjct  421  GHVIPACKNLSPSAKRKESKSHKHPKTVMVENMRAYDKGNRTRILLGSRPPNCTNKCHGC 480
Query  481  SPCKAKLVIVHRIMPQEYYPQRWMCSRHGKIYHP 514
            SPCKAKLVIVHRIMPQEYYPQRW+CS HGKIYHP
Sbjct  481  SPCKAKLVIVHRIMPQEYYPQRWICSCHGKIYHP 514

Sequence Alignment: 3. Allergen Name: Cha o 2.0101 Sequence ID: Q7M1E7

 Score = 622.8 bits 2705,  Expect = 1e-179
 Identities = 386/514 75%, Positives = 439/514 85%, Gaps = 0/514 0%
Query  1    MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRKVEHSRHDAINIFN 60
            M MKF+A +AF+A+QLI+MAAAEDQSAQIMLDSDIEQYLRSNRSL+K+ HSRHDA  +FN
Sbjct  1    MGMKFMAAVAFLALQLIVMAAAEDQSAQIMLDSDIEQYLRSNRSLKKLVHSRHDAATVFN 60
Query  61   VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV 120
            VE+YGAVGDGKHD TEAF+T W AACKK SA+LLVP NKKF VNNL F GPCQPH++FKV
Sbjct  61   VEQYGAVGDGKHDSTEAFATTWNAACKKASAVLLVPANKKFFVNNLVFRGPCQPHLSFKV 120
Query  121  DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR 180
            DG I A  +PA WKN++IWLQFA+LT F LMG GVIDGQG+QWWAGQCK VNGR +CNDR
Sbjct  121  DGTIVAQPDPARWKNSKIWLQFAQLTDFNLMGTGVIDGQGQQWWAGQCKVVNGRTVCNDR 180
Query  181  DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA 240
            +RPTAIK D+S  + ++ L LMNSPEFHLVFG CEGVKI G+ I APRDSPNTDGIDIFA
Sbjct  181  NRPTAIKIDYSKSVTVKELTLMNSPEFHLVFGECEGVKIQGLKIKAPRDSPNTDGIDIFA 240
Query  241  SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN 300
            SK FH++K  IGTGDDC+AIGTGSSNI I+DLICGPGHGISIGSLGR+NSRAEVS+VHVN
Sbjct  241  SKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDNSRAEVSHVHVN 300
Query  301  GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV 360
             AKFIDTQNGLRIKTWQGGSG+AS+I YENVEMINSENPILINQFYCTSASACQNQRSAV
Sbjct  301  RAKFIDTQNGLRIKTWQGGSGLASYITYENVEMINSENPILINQFYCTSASACQNQRSAV 360
Query  361  QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS 420
            QIQ VTYKNI GTSATAAAIQL CSDS+PC  I+LS++SLKLTSGK ASC++ NA G++S
Sbjct  361  QIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVSLKLTSGKPASCVDKNARGFYS 420
Query  421  GHVIPACKNLSPSAKRKESKSHKHPKTVMVKNMGAYDKGNRTRILLGSRPPNCTNKCHGC 480
            G +IP CKNL P    KE + +++P TVM +N GA  KG+ T I L S PPNC NKC GC
Sbjct  421  GRLIPTCKNLRPGPSPKEFELQQQPTTVMDENKGACAKGDSTCISLSSSPPNCKNKCKGC 480
Query  481  SPCKAKLVIVHRIMPQEYYPQRWMCSRHGKIYHP 514
             PCK KL+IVH   PQ+YYPQ+W+CS H KIY+P
Sbjct  481  QPCKPKLIIVHPNKPQDYYPQKWVCSCHNKIYNP 514

Sequence Alignment: 4. Allergen Name: Jun a 2 Sequence ID: CAC05582

 Score = 583.6 bits 2533,  Expect = 9e-168
 Identities = 357/505 70%, Positives = 426/505 84%, Gaps = 11/505 2%
Query  1    MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRK-VEHSRHDAINIF 59
            M+MKF+A +AF+A+QLI+MAA EDQSAQIMLDSD +QY RS+R+LRK V H+RHD   +F
Sbjct  1    MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVHHARHDVAIVF 60
Query  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFK 119
            NVE YGAVGDGKHD T+AF   W AAC K SA++LVP NKKFVVNNL F GPCQPHF+FK
Sbjct  61   NVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANKKFVVNNLVFYGPCQPHFSFK 120
Query  120  VDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICND 179
            VDG IAAY +PA WKN++IW++FA+LT F LMG GVIDGQG +WW+ QCK +NGR +CND
Sbjct  121  VDGTIAAYPDPAKWKNSKIWMHFARLTDFNLMGTGVIDGQGNRWWSDQCKTINGRTVCND 180
Query  180  RDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIF 239
            + RPTAIK DFS  + ++ L L NSPEFHLVFG C+GVKI GI I APRDSPNTDGIDIF
Sbjct  181  KGRPTAIKIDFSKSVTVKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIF 240
Query  240  ASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHV 299
            ASK F ++K TIGTGDDCVA+GTGSSNI I+DL CGPGHG+SIGSLG+ NSR+EVS+VH+
Sbjct  241  ASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL 300
Query  300  NGAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSA 359
            +GAKFIDTQNGLRIKTWQGGSG+ASHI YENVEMIN+ENPILINQFYCTSA+AC+NQRSA
Sbjct  301  DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTSAAACKNQRSA 360
Query  360  VQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYF 419
            V+IQDVT+KNI GTSAT AAIQL CSDS+PC +IKLS++ LKLTSGK+A+C+N NANGY+
Sbjct  361  VKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKLTSGKVATCVNKNANGYY 420
Query  420  SGHVIPACKNLSPSAKRKESKSHKHPKTVMV-KNMGAYDKGNRTRILLGSRPPNCTNKCH 478
            +  + P+CK+L P    KE + H+ P T+++ + MGA          L S PPNC NKC 
Sbjct  421  TNPLNPSCKSLHPGRTPKELELHQKPTTLLMDEKMGAS---------LNSSPPNCKNKCK 471
Query  479  GCSPCKAKLVIVHRIMPQEYYPQRWMCSRHGKIYHP 514
            GC PCK KL+IVH   P++YYPQRW+CS H KIY+P
Sbjct  472  GCQPCKPKLIIVHPNQPEDYYPQRWVCSCHNKIYNP 507

Sequence Alignment: 5. Allergen Name: Pla a 2 Sequence ID: Q6H9K0

 Score = 210.8 bits 897,  Expect = 1e-55
 Identities = 136/363 37%, Positives = 216/363 59%, Gaps = 14/363 3%
Query  57   NIFNVEKYGAVGDGKHDCTEAFSTAWQAAC--KKPSAMLLVPGNKKFVVNNLFFNGPCQ- 113
            ++FNV  YGA G G  D ++A   AW+AAC  + PS +L+  GN  + +  +   GPC+ 
Sbjct  8    SVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGN--YNMGEVAMQGPCKG 63
Query  114  PHFTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNG 173
                F++DG++ A  +P+ +K++  W+ F ++ G+T+ G G +DGQG+  WA      N 
Sbjct  64   SKIGFQIDGVVKAPADPSKFKSDG-WVSFYRIDGLTVSGTGTLDGQGQTAWAKN----NC 118
Query  174  REICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNT 233
             +  N +     ++FDF    +++ +  +NS  FH+    CE +    +++TAP  S NT
Sbjct  119  DKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINT 178
Query  234  DGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAE 293
            DGI +  SK   +    I TGDDC++IG GS N+ I  + CGPGHGISIGSLGR N+  E
Sbjct  179  DGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKE 238
Query  294  VSYVHVNGAKFIDTQNGLRIKTWQGGS-GMASHIIYENVEMINSENPILINQFYCTSASA 352
            V  + V G  F  T NG+R+KTW     G A+ + ++++ M N +NP++++Q YC     
Sbjct  239  VRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQC 298
Query  353  CQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLT-SGKIASCL 411
             +   S +++ ++ + NIRGTS    A+ + CS  MPC ++K+ +I+L    +G  A+  
Sbjct  299  SRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATST 358
Query  412  NDNANGYFSGHVIPACK 428
              N    FSG  +PA K
Sbjct  359  CSNVKPTFSGKQVPAIK 375

Sequence Alignment: 6. Allergen Name: Pla or 2.0101 Sequence ID: ABY21306

 Score = 210.3 bits 895,  Expect = 2e-55
 Identities = 140/360 38%, Positives = 218/360 60%, Gaps = 16/360 4%
Query  59   FNVEKYGAVGDGKHDCTEAFSTAWQAACKKPS-AMLLVP-GNKKFVVNNLFFNGPCQ-PH 115
            FNV  YGA G G  D ++A   AW+AAC  P  + +L+P GN  +++  +++ GPC+   
Sbjct  11   FNVNDYGAKGSG--DISQAVMKAWEAACASPGPSTVLIPTGN--YIMGEVLLEGPCKGSK 66
Query  116  FTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQG-KQWWAGQCKWVNGR 174
              F++DG++ A  + +++K+   W+ F  + G+T+ GKG  DGQG K W A  C   +  
Sbjct  67   IGFQLDGVVKAPADVSAFKSEG-WVVFNHVDGLTVSGKGTFDGQGQKAWAANNC---DKD 122
Query  175  EICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTD 234
            E CN R  P  I+F+F    +++ +  MNS  FH+    C+ +    ++I+AP  S NTD
Sbjct  123  ENCN-RP-PMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTD 180
Query  235  GIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEV 294
            GI I  S+   +    I TGDDCV+IG GS N+ +  + CGPGHGIS+GSLG+     +V
Sbjct  181  GIHIGLSRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDV 240
Query  295  SYVHVNGAKFIDTQNGLRIKTWQGGS-GMASHIIYENVEMINSENPILINQFYCTSASAC 353
              + V G  F  T NG+R+KTW     G+A+ + +E++ M N +NP++++Q YC      
Sbjct  241  RGITVTGCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCS 300
Query  354  QNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKL-TSGKIASCLN 412
                S V++ ++ + NIRGTS+   AI + CS   PC ++++ +I+L L  +G  A+   
Sbjct  301  LKAPSRVKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTC 360
Query  413  DNANGYFSGHVIPACK 428
             NA   FSG  +PA K
Sbjct  361  TNAKPIFSGKQVPAIK 376

Sequence Alignment: 7. Allergen Name: Cari p 1.0101 Sequence ID: C9EA45

 Score = 209.3 bits 891,  Expect = 4e-55
 Identities = 153/387 39%, Positives = 245/387 63%, Gaps = 18/387 4%
Query  33   SDIEQYLRSNRSLRKVEHSRHDAINIFNVEKYGAVGDGKHDCTE-AFSTAWQAACK-KPS 90
            ++ E  + S + +  +  ++  ++ IFNV+ +GA GDG HD T+  F  AW+ AC  K  
Sbjct  92   TEAEPSVLSFKGIEDLRSAKPRSV-IFNVDDFGAEGDGIHDDTQQVFEEAWEKACSYKGP 150
Query  91   AMLLVPGNKKFVVNNLFFNGPCQPHFTFKVD--GIIAAYQNPASW-KNNRIWLQFAKLTG 147
            A++LVP  + +++  + F GPC+ ++  +V   G I A  N + + K+ R W+    +  
Sbjct  151  ALFLVPERRTYLIGPIRFLGPCKSNLVIQVQISGTILASDNRSDYRKDPRHWIVIDSVDN 210
Query  148  FTLMGKGVIDGQGKQWWAGQCKWVNGREICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEF 207
            + + G G I G G+ WW   CK       C  ++ PT + F     L+++ +K+ ++ + 
Sbjct  211  LLVEGGGTIHGNGQIWWRNSCK-----APC--KEAPT-VTFYKCKNLMVRNVKVQDAQQM 262
Query  208  HLVFGNCEGVKIIGISITAPRDSPNTDGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNI 267
            ++ F  C  V    +++TAP  SPNTDGI +  ++N  +    IG GDDC++I +GS N+
Sbjct  263  QVSFEKCSEVTASDLTVTAPEKSPNTDGIHVTNTQNILITNTFIG-GDDCISIESGSHNV 321
Query  268  VIEDLICGPGHGISIGSLGRENSRAEVSYVHVNGAKFIDTQNGLRIKTWQGGSGMASHII 327
             IE+L CGPGHGI++ SLG  NS+A VS+V VNGAK+  T NG+RIKT+QGGSG AS+I 
Sbjct  322  QIEELTCGPGHGINVDSLGDNNSKAFVSFVTVNGAKLSGTTNGVRIKTYQGGSGSASNIK 381
Query  328  YENVEMINSENPILINQFYCTSASACQNQ-RSAVQIQDVTYKNIRGTSATAAAIQLKCSD 386
            ++NV+M N +NPI+I+Q YC     C+ Q +SAVQ++DV Y+NI+G SA+  AI + CS+
Sbjct  382  FQNVDMENVKNPIIIDQNYCDQKKPCKKQQKSAVQVKDVLYQNIQGNSASDVAIDFDCSE 441
Query  387  SMPCKDIKLSDISLKLTS--GKIASCLNDNANGYFSGHVIPACKN 429
            + PC  +KL ++ L+      + A  + ++     +G V P C +
Sbjct  442  NYPCLGVKLQNVRLQRADRVDEEAKAICNHVELTETGVVFPRCPD 486

Sequence Alignment: 8. Allergen Name: Sor h 13.0101 Sequence ID: A0A077B155

 Score = 205.5 bits 874,  Expect = 5e-54
 Identities = 139/351 39%, Positives = 218/351 62%, Gaps = 19/351 5%
Query  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKK--PSAMLLVPGNKKFVVNNLFFNGPCQPHFT 117
            ++ K GA GDGK D T+A++ AW AAC K  P  +++  G+  ++   L F+GPC+   T
Sbjct  56   DISKLGAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKGD--YLTGPLNFSGPCKGSVT 113
Query  118  FKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWW-AGQCKWVNGREI 176
             ++DG +    + +++K N  W++   +  + + GKG +DGQGKQ W   +C     +  
Sbjct  114  IQLDGNLLGTTDLSAYKTN--WIEIEHVDNLVISGKGTLDGQGKQVWDNNKCAQ---KYD 168
Query  177  CNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGI 236
            C  +  P ++ +D+     + G+ L+N+  FH+    C+GV I  +++TAP DSPNTDGI
Sbjct  169  C--KILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGI 226
Query  237  DIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSY 296
             I  S    +   TIG GDDC++IG GS+ I +  + CGPGHGIS+GSLGR     +V+ 
Sbjct  227  HIGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTD 286
Query  297  VHVNGAKFIDTQNGLRIKTWQGGSGM--ASHIIYENVEMINSENPILINQFYCTSASACQ 354
            ++V    +  T NG+RIK+++  + +  AS + YEN+ M +  NPI+I+  YC +     
Sbjct  287  INVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTA 346
Query  355  NQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISL--KLTSGK-IASCL 411
               S V ++DVT+KNI GTS+T  A+ L CSD +PC  + + +I +  K T+ K +A C 
Sbjct  347  KGDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVC- 405
Query  412  NDNANGYFSG 421
              NA G  +G
Sbjct  406  -QNAKGSATG 414

Sequence Alignment: 9. Allergen Name: Phl p 13 Sequence ID: CAB42886

 Score = 203.5 bits 865,  Expect = 2e-53
 Identities = 139/344 40%, Positives = 208/344 60%, Gaps = 21/344 6%
Query  59   FNVEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQ-PHFT 117
            +++ K GA  DGK DCT+    AW +AC       +V     F+   L F GPC+    T
Sbjct  24   YDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDSVT 83
Query  118  FKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREIC 177
             K+DG + +  + A +K N  W++  ++  +T+ GKG +DGQGK  W        G+  C
Sbjct  84   IKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTITGKGTLDGQGKAVW--------GKNSC 133
Query  178  ----NDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNT 233
                N +  P  + +DF    +I+G+ L+N+  FH+    C+GV +  ++ITAP DSPNT
Sbjct  134  AKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNT 193
Query  234  DGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAE 293
            DGI I  S    +   TIGTGDDC++IG GS+ + I  + CGPGHGIS+GSLGR     +
Sbjct  194  DGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKD 253
Query  294  VSYVHVNGAKFIDTQNGLRIKTWQGGSG--MASHIIYENVEMINSENPILINQFYCTSAS 351
            V+ + V    +  + NGLRIK+++       AS + YENV+M +   PI+I+Q YC +  
Sbjct  254  VTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKI 313
Query  352  ACQNQRSA-VQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKL--TSGK-I 407
                  SA V ++DVT++NI GTS+T  A+ L CSD  PC  + ++D+ ++   T+ K +
Sbjct  314  CTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTM 373
Query  408  ASCLN 412
            A C N
Sbjct  374  AVCTN 378

Sequence Alignment: 10. Allergen Name: Sor h 13.0201 Sequence ID: A0A077B569

 Score = 202.8 bits 862,  Expect = 3e-53
 Identities = 137/354 38%, Positives = 211/354 59%, Gaps = 15/354 4%
Query  59   FNVEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTF 118
            F++ K GA GDGK D T+A   AW +AC       ++     ++V  L F GPC+   T 
Sbjct  43   FDISKLGASGDGKKDSTKAVQEAWTSACGGTGKQTILIPKGDYLVGPLNFTGPCKGDVTI 102
Query  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWA-GQCKWVNGREIC 177
            +VDG + A  + + +K N  W++  ++  + + GKG +DGQG   W+   C     +  C
Sbjct  103  QVDGNLLATTDLSQYKGN--WIEILRVDNLVITGKGKLDGQGPAVWSKNSCA---KKYDC 157
Query  178  NDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGID 237
              +  P ++ +D+     + G+ L+N+  FH+    C+GV I  +++TAP DSPNTDGI 
Sbjct  158  --KILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIH 215
Query  238  IFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYV 297
            I  S    +   TIG GDDC++IG GS+ I +  + CGPGHGIS+GSLGR     +V+ +
Sbjct  216  IGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDI 275
Query  298  HVNGAKFIDTQNGLRIKTWQGGSGM--ASHIIYENVEMINSENPILINQFYCTSASACQN 355
            +V    +  T NG+RIK+++  + +  AS + YEN+ M +  NPI+I+  YC +      
Sbjct  276  NVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTAK 335
Query  356  QRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISL--KLTSGK-IASCLN 412
              S V ++DVT+KNI GTS+T  A+ L CSD +PC  + + +I +  K T+ K +A C  
Sbjct  336  GDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVC-- 393
Query  413  DNANGYFSG 421
             NA G  +G
Sbjct  394  QNAKGSATG 402

Sequence Alignment: 11. Allergen Name: Sal k 6.0101 Sequence ID: AHL24657

 Score = 188.0 bits 797,  Expect = 8e-49
 Identities = 127/365 34%, Positives = 213/365 58%, Gaps = 19/365 5%
Query  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKKPS-AMLLVPGNKKFVVNNLFFNGPCQPHFTF 118
            ++ K+GA  +   D T A+  AW+ AC   + A ++VP  + F++N + + GPC+  +T 
Sbjct  5    DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 61
Query  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFT---LMGKGVIDGQGKQWWA-GQCKWVNGR 174
            ++ G   A  + A  K    W++   + G+T   L   G  DGQG+  W   +C   +G 
Sbjct  62   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 119
Query  175  EICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTD 234
             +CN    P   +F+  T   I G+K +NS  +H+    C+ + + G++I AP+DS NTD
Sbjct  120  -MCNS--LPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 176
Query  235  GIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEV 294
            G+ I  S   H   + IGTGDDC+++G G+ ++ +E + CGPGHGISIGS+G+  + A  
Sbjct  177  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 236
Query  295  SYVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASAC 353
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  237  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 296
Query  354  QNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGK-IASCLN 412
            +   S V++  +++KN+ G + +A  ++L CS ++PC  ++L+DI L +  G  ++ C  
Sbjct  297  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 354
Query  413  DNANGYFSGHVIP-ACKN-LSPSA 434
             N     +G   P AC    +P+A
Sbjct  355  KNVKPIVTGKQNPVACGAPATPAA 378

Sequence Alignment: 12. Allergen Name: Sal k 6.0101 Sequence ID: ARS33724

 Score = 188.0 bits 797,  Expect = 9e-49
 Identities = 127/365 34%, Positives = 213/365 58%, Gaps = 19/365 5%
Query  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKKPS-AMLLVPGNKKFVVNNLFFNGPCQPHFTF 118
            ++ K+GA  +   D T A+  AW+ AC   + A ++VP  + F++N + + GPC+  +T 
Sbjct  27   DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 83
Query  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFT---LMGKGVIDGQGKQWWA-GQCKWVNGR 174
            ++ G   A  + A  K    W++   + G+T   L   G  DGQG+  W   +C   +G 
Sbjct  84   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 141
Query  175  EICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTD 234
             +CN    P   +F+  T   I G+K +NS  +H+    C+ + + G++I AP+DS NTD
Sbjct  142  -MCNS--LPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 198
Query  235  GIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEV 294
            G+ I  S   H   + IGTGDDC+++G G+ ++ +E + CGPGHGISIGS+G+  + A  
Sbjct  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
Query  295  SYVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASAC 353
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 318
Query  354  QNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGK-IASCLN 412
            +   S V++  +++KN+ G + +A  ++L CS ++PC  ++L+DI L +  G  ++ C  
Sbjct  319  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 376
Query  413  DNANGYFSGHVIP-ACKN-LSPSA 434
             N     +G   P AC    +P+A
Sbjct  377  KNVKPIVTGKQNPVACGAPATPAA 400

Sequence Alignment: 13. Allergen Name: Ole e 14.0101 Sequence ID: W8PPL3

 Score = 184.3 bits 781,  Expect = 1e-47
 Identities = 133/359 37%, Positives = 212/359 59%, Gaps = 17/359 4%
Query  58   IFNVEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQ-PH- 115
            IF+V KYGA  DG+ D  +AF  AW+AAC+      +V     FV   + F GPC  P  
Sbjct  15   IFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKP 74
Query  116  FTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGRE 175
             T ++ G + A  + +++ +   W+ + ++ G+ + G G I+G+GK  W  Q    N   
Sbjct  75   ITIEIQGNVLASTDVSAYTSGS-WIMLEEIDGLVINGGGTINGRGKSSW--QFAGANNEG 131
Query  176  ICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDG 235
                   P ++ F       ++ + +++S  FH    + E +KI  + I+AP DSPNTDG
Sbjct  132  PL----LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDG 187
Query  236  IDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVS 295
            + I  S N ++  + IGTGDDCV+IG G+++I++  + CGPGHGIS+GSLG+     +V 
Sbjct  188  MHISCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVK 247
Query  296  YVHVNGAKFIDTQNGLRIKTWQGGSGM-ASHIIYENVEMINSENPILINQFYCTSASACQ 354
             + V    +  T NG RIKT++    + AS I+Y+++ + + +NPILI+Q Y    S  +
Sbjct  248  GISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSKKK 304
Query  355  NQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDN 414
             ++S V+I  V + NI+GT+ +   + L CS+++PC+D++L+DI L   SG   S  +  
Sbjct  305  PEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKSVC 363
Query  415  ANGYF--SGHVIP-AC 427
            AN  F   G  IP  C
Sbjct  364  ANAKFVLKGKPIPPGC 379

Sequence Alignment: 14. Allergen Name: Cup s 2.0101 Sequence ID: C0HKB1

 Score = 65.4 bits 257,  Expect = 3e-12
 Identities = 85/116 73%, Positives = 100/116 86%, Gaps = 78/116 67%
Query  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICN 178
            KVDGIIAAY +P      +IW++FA                              R +CN
Sbjct  23   KVDGIIAAYPDPV-----KIWMHFA------------------------------RTVCN 47
Query  179  DRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDI 238
            D+ RPTAIK DFS       L LMNSPEFHLVFG C+GVKI GI I              
Sbjct  48   DKGRPTAIKIDFSKS----ELTLMNSPEFHLVFGECDGVKIQGIKI-------------- 89
Query  239  FASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVH 298
               K F ++K                      DL CGPGHG+SIGSLG+ NSR+EVS+VH
Sbjct  90   ---KRFEIEK----------------------DLTCGPGHGMSIGSLGKGNSRSEVSFVH 124
Query  299  VNGAKFIDTQNGLR 312
            ++GAKFIDTQNGLR
Sbjct  125  LDGAKFIDTQNGLR 138

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.