The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN
DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK
Sequence Info Allergen Name Length Opt Bits Score E Value
ANC85026 Art si 3.0101 116 792 153.4 1.4e-39
ANC85027 Art si 3.0102 116 717 139.7 1.9e-35
ACE07187 Art v 3.0202 116 717 139.7 1.9e-35
ANC85020 Art ar 3.0102 116 717 139.7 1.9e-35
ANC85023 Art gm 3.0102 117 710 138.5 4.6e-35
EU564847 Art v 3.0301 117 702 137.0 1.3e-34
ANC85022 Art gm 3.0101 117 695 135.7 3.1e-34
ANC85025 Art la 3.0102 115 694 135.5 3.4e-34
ANC85024 Art la 3.0101 116 694 135.5 3.5e-34
ANC85019 Art ar 3.0101 116 694 135.5 3.5e-34
EU564845 Art v 3.0201 114 682 133.3 1.6e-33
QIN55516 Art ca 3.0102 117 675 132.1 3.8e-33
ANC85021 Art ca 3.0101 117 673 131.7 4.9e-33
ANC85017 Art an 3.0101 117 673 131.7 4.9e-33
ANC85018 Art an 3.0102 117 628 123.5 1.5e-30
Q4PLT6 Fra a 3.0202 117 422 86.0 3e-19
Q4PLU0 Fra a 3.0201 117 416 84.9 6.3e-19
Q8VX12 Fra a 3.0101 117 413 84.3 9.2e-19
AAK28533 Cor a 8 115 411 83.9 1.2e-18
Q0Z8V0 Rub i 3.0101 117 409 83.6 1.5e-18
Q4PLT9 Fra a 3.0102 117 403 82.5 3.3e-18
P85894 Mor n 3.0101 91 402 82.1 3.3e-18
Q9M5X8 Pru av 3 117 398 81.6 6.1e-18
XP_019446786 Lup an 3.0101 116 397 81.4 6.9e-18
ABY21307 Pla or 3.0101 118 397 81.4 7e-18
CAL07989 Pla a 3.0101 118 393 80.7 1.2e-17
Q9M5X6 Pyr c 3 115 392 80.5 1.3e-17
A0AT29 Len c 3.0101 118 386 79.4 2.8e-17
A0A161AT60 Pis s 3.0101 120 382 78.7 4.7e-17
AAB42069 Lyc e 3 114 381 78.5 5.2e-17
P93224 Sola l 3.0101 114 381 78.5 5.2e-17
AAL25839 Hev b 12 116 379 78.1 6.7e-17
Q9M5X7 Mal d 3 115 369 76.3 2.4e-16
ADC80503 Pha v 3.0201 118 367 75.9 3.1e-16
ADC80502 Pha v 3.0101 115 365 75.5 3.9e-16
ABX56711 Ara h 9.0101 116 362 75.0 5.8e-16
A0A059SSZ0 Pun g 1.0201 120 360 74.7 7.6e-16
W0U0V5 Can s 3.0101 91 346 71.9 3.9e-15
A0A059ST23 Pun g 1.0301 120 346 72.1 4.4e-15
CAB96876 Pru p 3 91 341 71.0 7.3e-15
A0A059STC4 Pun g 1.0101 120 342 71.4 7.4e-15
P81651 Pru ar 3 91 340 70.8 8.3e-15
ACN11576 Pru du 3.0101 123 340 71.0 9.6e-15
P81402 Pru p 3 91 336 70.1 1.4e-14
P19656-1 Zea m 14.0101 120 336 70.3 1.6e-14
P82534 Pru d 3 91 332 69.4 2.3e-14
ACV04796 Api g 2 118 332 69.5 2.6e-14
P19656-2 Zea m 14.0102 128 331 69.4 3.1e-14
A0A510A9S3 Ara h 17.0101 93 321 67.4 9.2e-14
ABX75045 Ara h 9.0201 92 318 66.8 1.3e-13
ABU95411 Sin a 3.0101 92 318 66.8 1.3e-13
AAA32970 Hor v 1 117 305 64.6 7.8e-13
CAH69206 Tri tu 14.0101 115 304 64.4 8.8e-13
NP_001316123 Sola l 7.0101 115 303 64.2 1e-12
CAA42832 Hor v 1 134 301 64.0 1.4e-12
19846220 Tri a 14.0101 90 292 62.1 3.5e-12
P82007 Hel a 3.0101 116 277 59.5 2.7e-11
P0C088 Art v 3.0101 37 251 53.9 4e-10
O04403 Par j 2 133 216 48.5 6.4e-08
P55958 Par j 2 133 206 46.7 2.3e-07
O04004 Amb a 6 118 197 44.9 6.6e-07
Q40905 Par j 1 138 196 44.9 8.1e-07
P43217 Par j 1 139 195 44.7 9.3e-07
CAI94601 Par j 1.0103 139 191 44.0 1.5e-06
CAA54587 Par j 1.0101 133 181 42.1 5.3e-06
O04404 Par j 1 176 181 42.3 6.1e-06
10998016 Cas s 8 36 124 30.8 0.0037
P80274 Vit v 1 37 117 29.5 0.0092
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 153.4 bits 792,  Expect = 1e-39
 Identities = 116/116 100%, Positives = 116/116 100%, Gaps = 0/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
            MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
Query  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK
Sbjct  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 2. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 139.7 bits 717,  Expect = 2e-35
 Identities = 101/116 87%, Positives = 108/116 93%, Gaps = 0/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
            MAMKMMK FC MVVCMV+SSSYAEALTCSDVSNKI+PCLNYLKQGGEVPA+CC GVKGLN
Sbjct  1    MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLN 60
Query  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            DAAKTTPDRQTAC CLK SFK+NKDLKSD+A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   DAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 3. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 139.7 bits 717,  Expect = 2e-35
 Identities = 101/116 87%, Positives = 108/116 93%, Gaps = 0/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
            MAMKMMK FC MVVCMV+SSSYAEALTCSDVSNKI+PCLNYLKQGGEVPA+CC GVKGLN
Sbjct  1    MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLN 60
Query  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            DAAKTTPDRQTAC CLK SFK+NKDLKSD+A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   DAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 4. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 139.7 bits 717,  Expect = 2e-35
 Identities = 101/116 87%, Positives = 108/116 93%, Gaps = 0/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
            MAMKMMK FC MVVCMV+SSSYAEALTCSDVSNKI+PCLNYLKQGGEVPA+CC GVKGLN
Sbjct  1    MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLN 60
Query  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            DAAKTTPDRQTAC CLK SFK+NKDLKSD+A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   DAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 5. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 138.5 bits 710,  Expect = 5e-35
 Identities = 104/116 89%, Positives = 110/116 94%, Gaps = 1/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MAMKMMKVFCVMVVCMVVSSSYAEA LTCSDVSNKISPCL++LKQGGEVPA+CC GVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            NDAAKTTPDRQTAC CLK SFK+NKDLKSD AV LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   NDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 6. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 137.0 bits 702,  Expect = 1e-34
 Identities = 99/116 85%, Positives = 110/116 94%, Gaps = 1/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MA+KMMKVFC+MVVCMVVS+SYAE ALTCSDVS KISPCL+YLK+GGEVPA+CC GVKGL
Sbjct  1    MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            NDA KTTPDRQTAC CLK SFK+NKDLKSD+AVPLPSKCG+ +PYKLS+ETDCNKVK
Sbjct  61   NDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 7. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 135.7 bits 695,  Expect = 3e-34
 Identities = 101/116 87%, Positives = 108/116 93%, Gaps = 1/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MAMKMMKVFCVMVVCMVVSSSYAEA LTCSDVSNKISPC ++LKQGGEVPA+CC GVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            NDAAKTTPDRQTAC CLK SFK+NKD+KSD A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   NDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 8. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 135.5 bits 694,  Expect = 3e-34
 Identities = 99/114 86%, Positives = 107/114 93%, Gaps = 1/114 0%
Query  3    MKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            MKMMKVFCVMVVCMVV SSYAEA LTCSDVS KISPCL+YLK+GGEVPA+CC GVKGLND
Sbjct  1    MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLND 60
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            A KTTPDRQTAC CLK SFK+NKDLKSD+AVPLPSKCG+ +PYKLS+ETDCNKVK
Sbjct  61   ATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 9. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 135.5 bits 694,  Expect = 3e-34
 Identities = 98/116 84%, Positives = 106/116 91%, Gaps = 0/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
            MAMKMMK FC MVVCMVVSSSYAEAL CSDVSNKIS CL+YLKQGGEVPA+CC GVKGLN
Sbjct  1    MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLN 60
Query  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            DAAKTTPDRQTAC CLK +FK+NKD+KSD+A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   DAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 10. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 135.5 bits 694,  Expect = 3e-34
 Identities = 98/116 84%, Positives = 106/116 91%, Gaps = 0/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
            MAMKMMK FC MVVCMVVSSSYAEAL CSDVSNKIS CL+YLKQGGEVPA+CC GVKGLN
Sbjct  1    MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLN 60
Query  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            DAAKTTPDRQTAC CLK +FK+NKD+KSD+A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   DAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 11. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 133.3 bits 682,  Expect = 2e-33
 Identities = 96/114 84%, Positives = 104/114 91%, Gaps = 0/114 0%
Query  3    MKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDA 62
            MKMMK FC MVVCMVVSSSYAEAL CSDVSNKIS CL+YLKQGGEVPA+CC GVKGLNDA
Sbjct  1    MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDA 60
Query  63   AKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            AKTTPDRQTAC CLK +FK+NKD+KSD+A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   AKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 12. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 132.1 bits 675,  Expect = 4e-33
 Identities = 97/116 83%, Positives = 106/116 91%, Gaps = 1/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MAMKMMKVFCVM+VCMVV SSYAEA LTCSDVSNKI+PCL++LKQGGEVPA+CC GVKGL
Sbjct  1    MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            NDAAKT PDRQ AC CLK +FK+NKDLKSD AV LPSKCGV IPYK+S+ETDCN VK
Sbjct  61   NDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 13. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 131.7 bits 673,  Expect = 5e-33
 Identities = 98/116 84%, Positives = 106/116 91%, Gaps = 1/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MAMKMMKVFCVMVVCMVVSSSYAEA LTCSDVSNKI PC ++LKQGGEV A+CC GVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            NDAAKTTPDRQ AC CLK +FK+NKD+KSD AV LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   NDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 14. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 131.7 bits 673,  Expect = 5e-33
 Identities = 98/116 84%, Positives = 106/116 91%, Gaps = 1/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MAMKMMKVFCVMVVCMVVSSSYAEA LTCSDVSNKI PC ++LKQGGEV A+CC GVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            NDAAKTTPDRQ AC CLK +FK+NKD+KSD AV LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   NDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 15. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 123.5 bits 628,  Expect = 1e-30
 Identities = 88/116 75%, Positives = 103/116 88%, Gaps = 1/116 0%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MAMKMMKVFCVMVVCMVV+SSYAEA LTC+DV+ KISPC ++L++GGEVP +CC GVKGL
Sbjct  1    MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            NDAAKTTPDRQ AC CLK SFK++ ++K + A  LPSKCGV IPYK+S+ETDCNKVK
Sbjct  61   NDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 16. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 86.0 bits 422,  Expect = 3e-19
 Identities = 60/116 51%, Positives = 79/116 68%, Gaps = 1/116 0%
Query  1    MAMKM-MKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            MA+   MK+  V ++C+VV+   A+A+TC  V++ ISPC+NY+K GG VPA CC G++ L
Sbjct  1    MAISTAMKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            N AAKTT DRQT C CLK +    K L  + A  LP KCGV +PYK+S  T+C  VK
Sbjct  61   NSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 17. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 84.9 bits 416,  Expect = 6e-19
 Identities = 57/111 51%, Positives = 75/111 67%, Gaps = 0/111 0%
Query  6    MKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKT 65
            MK+  V ++C+VV+   A+A+TC  V++ ISPC+NY+K GG VPA CC G++ LN AAKT
Sbjct  7    MKLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKT 66
Query  66   TPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            T DRQ  C CLK +    K L    A  LP KCGV++PYK+S  T+C  VK
Sbjct  67   TADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 18. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 84.3 bits 413,  Expect = 9e-19
 Identities = 57/111 51%, Positives = 76/111 68%, Gaps = 0/111 0%
Query  6    MKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKT 65
            MK+  V ++C+VV+   A+A+TC  V++ ISPCL Y+K GG VPA CC+G++ LN  AKT
Sbjct  7    MKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKT 66
Query  66   TPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            T DRQ AC CLK +    K L  + A  LP KCGV++PYK+S  T+C  VK
Sbjct  67   TADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 19. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 83.9 bits 411,  Expect = 1e-18
 Identities = 55/114 48%, Positives = 79/114 69%, Gaps = 1/114 0%
Query  3    MKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            M  +K+ C +++CM+V++  A A LTC  +   ++PC+ YLK GG +P +CC GV+ +ND
Sbjct  1    MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVND 60
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            A++TT DRQ+AC CLK++ K    L  + A  LP KCGV IPYK+S  T+CN VK
Sbjct  61   ASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 20. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 83.6 bits 409,  Expect = 2e-18
 Identities = 55/112 49%, Positives = 75/112 66%, Gaps = 0/112 0%
Query  5    MMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAK 64
            +MK+  V ++C+VV+   A+A+TC  V+  ++PC+NY+K GG VPA CC GV+ LN  AK
Sbjct  6    VMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAK 65
Query  65   TTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            TT DRQ  C CLKN+  +   L    A  LP KCGV++PYK+S  T+C  VK
Sbjct  66   TTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 21. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 82.5 bits 403,  Expect = 3e-18
 Identities = 55/111 49%, Positives = 75/111 67%, Gaps = 0/111 0%
Query  6    MKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKT 65
            MK+  V ++C+VV+   A+A+TC  V++ ISPC+ Y+K GG VPA CC+G++ LN  AKT
Sbjct  7    MKLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKT 66
Query  66   TPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            T DRQ  C CLK +    K L  + A  LP KCGV++PYK+S  T+C  VK
Sbjct  67   TADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 22. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 82.1 bits 402,  Expect = 3e-18
 Identities = 53/91 58%, Positives = 68/91 74%, Gaps = 0/91 0%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            +TC  VS+ ++PC+NYL+ GG VPANCC GV+ LN+AAKTT DRQ AC CLK++F + K 
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            L  + A  LP KCGV++PYK+S  TDC  VK
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 23. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 81.6 bits 398,  Expect = 6e-18
 Identities = 54/112 48%, Positives = 75/112 66%, Gaps = 0/112 0%
Query  5    MMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAK 64
            M K+  V+ +CMVVS   A+ALTC  VS+ ++PC+ Y++ GG VP  CC G++ +N+ AK
Sbjct  6    MTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAK 65
Query  65   TTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            TT DRQTAC CLK    +   + ++ A  LP KCGV +PYK+S  T+C  VK
Sbjct  66   TTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 24. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 81.4 bits 397,  Expect = 7e-18
 Identities = 54/112 48%, Positives = 75/112 66%, Gaps = 1/112 0%
Query  5    MMKVFCVMVVCMVV-SSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAA 63
            ++K+ C +++CMVV S+   +A+TC  V+  ++ CLNYL+ GG VPA CC G+K + + A
Sbjct  4    IVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLA 63
Query  64   KTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            KTTPDR+TAC CLK +      L    A  LP KCGV IPYK+S  T+C  +K
Sbjct  64   KTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 25. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 81.4 bits 397,  Expect = 7e-18
 Identities = 54/113 47%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  4    KMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDA 62
            ++ K+ C+++ CMV ++ +AEA +TC  V  +++PCL YL+ GG V   CC GVK LN+ 
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNND 64
Query  63   AKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            AKTTPDRQ AC CLK +  +   ++   A  L  KCGV +PYK+S   DC+KVK
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 26. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 80.7 bits 393,  Expect = 1e-17
 Identities = 53/113 46%, Positives = 76/113 67%, Gaps = 1/113 0%
Query  4    KMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDA 62
            ++ K+ C+++ CMV ++ +AEA +TC  V  +++PCL +L+ GG V   CC GVK LN+ 
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNND 64
Query  63   AKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            AKTTPDRQ AC CLK +  +   ++   A  L  KCGV +PYK+S   DC+KVK
Sbjct  65   AKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 27. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 80.5 bits 392,  Expect = 1e-17
 Identities = 55/110 50%, Positives = 73/110 66%, Gaps = 2/110 1%
Query  5    MMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAK 64
            ++K+  V+ +CM VS   A A+TCS VS  ++PC+NY++ GG VP  CC G+K +N  AK
Sbjct  6    VIKLALVVALCMAVS--VAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAK 63
Query  65   TTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            TTPDRQ AC CLKN   +   +    A  LP KCGV +PYK+S  T+C  VK
Sbjct  64   TTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 28. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 79.4 bits 386,  Expect = 3e-17
 Identities = 60/110 54%, Positives = 77/110 70%, Gaps = 4/110 3%
Query  6    MKVFCV-MVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVPA-NCCAGVKGLNDA 62
            MK+ CV +V+CMVV +  AE A++C  V++ +SPCL YL  GG  P+  CC GVK L  A
Sbjct  5    MKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA 63
Query  63   AKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            A TTPDRQ AC CLK++  +   L ++ A  LP KCGV IPYK+S  T+CN VK
Sbjct  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 29. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 78.7 bits 382,  Expect = 5e-17
 Identities = 58/113 51%, Positives = 77/113 68%, Gaps = 4/113 3%
Query  4    KMMKVFCV-MVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEV--PANCCAGVKGL 59
            + MK+ CV +V+CMVV +  AEA L+C  VS  ++PC+ YL+       P  CCAGVK L
Sbjct  3    RSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKL 62
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
              AA TTPDRQ AC CLK++  +   L ++ A  LP KCGV+IPYK+S  T+CN V+
Sbjct  63   LAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 30. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 78.5 bits 381,  Expect = 5e-17
 Identities = 56/113 49%, Positives = 79/113 69%, Gaps = 2/113 1%
Query  3    MKMM-KVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            M+M  K+ C +V CMVV + +AE+L+C +V++ ++PCL YL+  G +   CC GVKGL  
Sbjct  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            AAKT  DR+TACTCLK++  + K + +  A  LP  CGV IPYK+S  TDC+ V+
Sbjct  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 31. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 78.5 bits 381,  Expect = 5e-17
 Identities = 56/113 49%, Positives = 79/113 69%, Gaps = 2/113 1%
Query  3    MKMM-KVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            M+M  K+ C +V CMVV + +AE+L+C +V++ ++PCL YL+  G +   CC GVKGL  
Sbjct  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            AAKT  DR+TACTCLK++  + K + +  A  LP  CGV IPYK+S  TDC+ V+
Sbjct  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 32. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 78.1 bits 379,  Expect = 7e-17
 Identities = 55/114 48%, Positives = 77/114 67%, Gaps = 2/114 1%
Query  3    MKMMKVFCVMVVCMVVSSSY-AEALTCSDVSNKISPCLNYLKQGGEVP-ANCCAGVKGLN 60
            M  +K+   +V+CM+V++   A+A+TC  V + + PCL+YLK  G  P A CC GV+ +N
Sbjct  1    MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTIN 60
Query  61   DAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            +AAKTT DR+TAC CLK++  + K L       LP KCGV IPYK+S+ T+C  VK
Sbjct  61   NAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 33. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 76.3 bits 369,  Expect = 2e-16
 Identities = 50/108 46%, Positives = 71/108 65%, Gaps = 2/108 1%
Query  7    KVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTT 66
            K+  V+ +CM VS   A A+TC  V++ ++PC+ Y++ GG VP  CC G++ +N  A+TT
Sbjct  8    KLALVVALCMAVS--VAHAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTT 65
Query  67   PDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
             DRQTAC CLKN   +   +  + A  LP KCGV +PYK+S  T+C  VK
Sbjct  66   ADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 34. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 75.9 bits 367,  Expect = 3e-16
 Identities = 51/114 44%, Positives = 78/114 68%, Gaps = 3/114 2%
Query  3    MKMMKVFCVM-VVCMVV--SSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGL 59
            M  +   CV+ V+C+VV  + +   A++C  V++ ++ C+ +L +GG VPA+CC+GV+ L
Sbjct  1    MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSL 60
Query  60   NDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            N AAKTTPDRQ  C CLK++      + ++ A  LP KCGV+IPYK+S  T+C  +K
Sbjct  61   NAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 35. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 75.5 bits 365,  Expect = 4e-16
 Identities = 48/113 42%, Positives = 73/113 64%, Gaps = 1/113 0%
Query  3    MKMMKVFCVMVVCMVVSSSY-AEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            M  +K  CV+V+CMVV  ++ A+ +TC  V + + PC+ +L+ GG VPA CC GV+ + +
Sbjct  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMN 60
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115
            +A++T DR+  C CLK +    + L  + A  LP KCGV IPYK+S  T+C  +
Sbjct  61   SARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 36. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 75.0 bits 362,  Expect = 6e-16
 Identities = 49/114 42%, Positives = 73/114 64%, Gaps = 1/114 0%
Query  3    MKMMKVFCVMVVCM-VVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            M  +K   VM+VCM +V +    A++C  V++ ++PC+ +L +GG  P  CC+GV+GL  
Sbjct  1    MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLG 60
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            A +TT DRQ AC CLK +  + + L    A  LP +CGV+IPYK+S  T+C  +K
Sbjct  61   ALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 37. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 74.7 bits 360,  Expect = 8e-16
 Identities = 52/105 49%, Positives = 73/105 69%, Gaps = 2/105 1%
Query  12   MVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVP-ANCCAGVKGLNDAAKTTPDR 69
            + +CMVV++S  E A+TC  V++ ++PC+ Y +     P A CC+GV+ LN+AAKTTPDR
Sbjct  14   LFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDR 73
Query  70   QTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            QTAC CLK   ++   +       LP KCGV+IPYK+S  TDC++VK
Sbjct  74   QTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 38. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 71.9 bits 346,  Expect = 4e-15
 Identities = 47/91 51%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            +TC  V++ ++PCL+YLK GG VP  CC  +K L+ AAKT  DRQ AC CLK++  + K 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            +  + A  LP KCGV+IPYK+S  TDC+ VK
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 39. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 72.1 bits 346,  Expect = 4e-15
 Identities = 49/105 46%, Positives = 69/105 65%, Gaps = 3/105 2%
Query  12   MVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGE--VPANCCAGVKGLNDAAKTTPD 68
            ++VCM V+S+ AEA +TC  VS+ ++ C+ Y +  G   VP  CC G++ LN AAKTTPD
Sbjct  13   VLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPD 72
Query  69   RQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            RQ AC CLK+   +   +        P KCGV+IPYK++  T+C+ VK
Sbjct  73   RQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 40. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 71.0 bits 341,  Expect = 7e-15
 Identities = 43/91 47%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+ A+TTPDRQ AC CLK    +   
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            +  + A  LP KCGV+IPYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 41. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 71.4 bits 342,  Expect = 7e-15
 Identities = 47/112 41%, Positives = 71/112 63%, Gaps = 3/112 2%
Query  5    MMKVFCVMVVCMVVSSSYAE--ALTCSDVSNKISPCLNYLKQ-GGEVPANCCAGVKGLND 61
            + K+ C +    +V++  A   A+TC  V++ ++PC+ Y +  GG VP  CC+G+K L+ 
Sbjct  6    LFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDG 65
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
             A+TTPDRQ  C CLK++  +   +       LP+KCGV IPYK+S  TDC +VK
Sbjct  66   MARTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 42. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 70.8 bits 340,  Expect = 8e-15
 Identities = 43/91 47%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+ A+TTPDR+TAC CLK    +   
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            +  + A  LP KCGV IPYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 43. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 71.0 bits 340,  Expect = 1e-14
 Identities = 48/113 42%, Positives = 70/113 61%, Gaps = 5/113 4%
Query  4    KMMKVFCVMVV--CMVVSSSYA-EALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLN 60
            +++K+ C++ V  CM V    A  A++C  V N ++PC+NY+  GG +  +CC GV+ L 
Sbjct  6    QLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLY 65
Query  61   DAAKTTPDRQTACTCLKNSFK--TNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
              A+TT DRQ+ C CLK +       +  +  A  LP KCGV IPYK+S  TDC  +K
Sbjct  66   SLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 44. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 70.1 bits 336,  Expect = 1e-14
 Identities = 43/91 47%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+ A+TTPDRQ AC CLK    +   
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            +  + A  LP KCGV IPYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 45. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 70.3 bits 336,  Expect = 2e-14
 Identities = 48/104 46%, Positives = 72/104 69%, Gaps = 2/104 1%
Query  11   VMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVP-ANCCAGVKGLNDAAKTTPDR 69
            V +V +  ++S A A++C  V++ I+PC++Y +  G  P A CC+GV+ LN+AA+TT DR
Sbjct  15   VALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
Query  70   QTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115
            + AC CLKN+      L +  A  +PSKCGV+IPY +S  TDC++V
Sbjct  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 46. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 69.4 bits 332,  Expect = 2e-14
 Identities = 42/91 46%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            +TC  VS+ ++PC+NY+K GG VP  CC G++ +N+ A+TT DR+ AC CLK    +   
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
            +  + A  LP KCGV +PYK+S  T+C  VK
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 47. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 69.5 bits 332,  Expect = 3e-14
 Identities = 50/112 44%, Positives = 66/112 58%, Gaps = 1/112 0%
Query  4    KMMKVFCVMVVCMVVSS-SYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDA 62
            K+     VM++ +V++  +  E LTC  V+ K+  CL YLK GG     CC GVKGLN  
Sbjct  5    KVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSL 64
Query  63   AKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115
            AKT  DR+ AC CLK    + K +    A  LP KCG+ IPY +S  TDC++V
Sbjct  65   AKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 48. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 69.4 bits 331,  Expect = 3e-14
 Identities = 47/103 45%, Positives = 71/103 68%, Gaps = 2/103 1%
Query  11   VMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVP-ANCCAGVKGLNDAAKTTPDR 69
            V +V +  ++S A A++C  V++ I+PC++Y +  G  P A CC+GV+ LN+AA+TT DR
Sbjct  15   VALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
Query  70   QTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNK 114
            + AC CLKN+      L +  A  +PSKCGV+IPY +S  TDC++
Sbjct  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118

Sequence Alignment: 49. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 67.4 bits 321,  Expect = 9e-14
 Identities = 42/92 45%, Positives = 60/92 65%, Gaps = 1/92 1%
Query  25   ALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKT-N 83
            A+ CS V+  I+PC+ YLK GG V   CC+G++ +N  AKTT DRQ  C CLK++  +  
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  84   KDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
              +  + A  LP KCGV+IPYK+S   +C+ +K
Sbjct  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 50. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 66.8 bits 318,  Expect = 1e-13
 Identities = 44/90 48%, Positives = 62/90 68%, Gaps = 2/90 2%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNK 84
            L+C  V++ ++PC+ +L +GG VP+  CC+GV+GL  AAKTT DRQ AC CLK +  +  
Sbjct  1    LSCGQVNSALAPCITFLTKGG-VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
Query  85   DLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
             L    A  LP +CGV+IPYK+S  T+C  +K
Sbjct  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 51. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 66.8 bits 318,  Expect = 1e-13
 Identities = 42/92 45%, Positives = 57/92 61%, Gaps = 0/92 0%
Query  25   ALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNK 84
            AL+C  V++ ++ C+ YL Q   +P  CC GV  LN+ A+TTPDRQ AC CL  +  +  
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  85   DLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
             L +  A  LP  CGV IPYK+S  T+CN V+
Sbjct  61   SLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 52. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 64.6 bits 305,  Expect = 8e-13
 Identities = 44/114 38%, Positives = 70/114 61%, Gaps = 3/114 2%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKG 58
            MA   + +    +V M+ ++  A  AL C  V +K+ PCL Y+ QGG  P+  CC GV+ 
Sbjct  1    MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYV-QGGPGPSGECCNGVRD 59
Query  59   LNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115
            L++ A+++ DRQT C CLK   +   +L  + A  +PSKC V +PY +S + DC+++
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 53. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 64.4 bits 304,  Expect = 9e-13
 Identities = 41/105 39%, Positives = 72/105 68%, Gaps = 5/105 4%
Query  8    VFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVP-ANCCAGVKGLNDAAKTT 66
            V+  +V  M+++ + A A++C  VS+ +SPC++Y +  G  P A CC+GV+ L  +A++T
Sbjct  10   VLVAVVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARST 68
Query  67   PDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116
             D+Q AC C+K++      L +  A  +P+KCGV++PY +S   DC+K++
Sbjct  69   ADKQAACKCIKSA---AAGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 54. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 64.2 bits 303,  Expect = 1e-12
 Identities = 41/113 36%, Positives = 70/113 61%, Gaps = 1/113 0%
Query  3    MKMMKVFCVMVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            MK + ++ ++V+ +   +  A  A+TC  V   ++PC+ +L QGGE  A CC+GV+ LN 
Sbjct  1    MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNG 60
Query  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115
              +++ DR+TAC C+K +     +LK D A  LPSKCG+++   +S   +C+ +
Sbjct  61   NTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 55. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 64.0 bits 301,  Expect = 1e-12
 Identities = 44/113 38%, Positives = 69/113 61%, Gaps = 3/113 2%
Query  1    MAMKMMKVFCVMVVCMVVSSSYAE-ALTCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKG 58
            MA   + +    +V M+ ++  A  AL C  V +K+ PCL Y+ QGG  P+  CC GV+ 
Sbjct  1    MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYV-QGGPGPSGECCNGVRD 59
Query  59   LNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNK 114
            L++ A+++ DRQT C CLK   +   +L  + A  +PSKC V +PY +S + DC++
Sbjct  60   LHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSR 115

Sequence Alignment: 56. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 62.1 bits 292,  Expect = 4e-12
 Identities = 39/89 43%, Positives = 58/89 65%, Gaps = 2/89 2%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNK 84
            + C  V + + PCL+Y+ QGG  P+  CC GVK L++ A++  DRQ+AC CLK   +   
Sbjct  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
Query  85   DLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115
            +L  D A  +P KCGV +PY +S+  DC++V
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 59.5 bits 277,  Expect = 3e-11
 Identities = 40/104 38%, Positives = 63/104 60%, Gaps = 5/104 4%
Query  11   VMVVCMVVSSSY----AEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTT 66
            V ++ M+V +      + A+TC+DV+  ++PCL YL+ GG+    CCAG K L  A +T 
Sbjct  8    VAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQ 67
Query  67   PDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115
             DR+TAC C K +    K ++ D A  LP KCG++    ++   +CN +
Sbjct  68   ADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 53.9 bits 251,  Expect = 4e-10
 Identities = 35/37 94%, Positives = 37/37 100%, Gaps = 0/37 0%
Query  25   ALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
            ALTCSDVSNKISPCL+YLKQGGEVPA+CCAGVKGLND
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND 37

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 48.5 bits 216,  Expect = 6e-08
 Identities = 30/88 34%, Positives = 55/88 62%, Gaps = 4/88 4%
Query  28   CSDVSNKISPCLNYLKQGGEVPA-NCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDL 86
            C  V + I PCL ++K   + P+ +CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
Query  87   KSDYAVPLPSKCGVT--IPYKLSMETDCNKVK 116
            K++    +P KCG+T  +P  ++ + DC+K++
Sbjct  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 60. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 46.7 bits 206,  Expect = 2e-07
 Identities = 29/88 32%, Positives = 53/88 60%, Gaps = 4/88 4%
Query  28   CSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDL 86
            C  V   I PCL+++K   + P+  CC+G K L++  KTT  ++ AC C+  + K    +
Sbjct  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
Query  87   KSDYAVPLPSKCGV--TIPYKLSMETDCNKVK 116
            K++    +P KC +  T+P  ++ + DC+K++
Sbjct  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 61. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 44.9 bits 197,  Expect = 7e-07
 Identities = 40/104 38%, Positives = 59/104 56%, Gaps = 10/104 9%
Query  8    VFCVMVVCMVVS---SSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAK 64
            ++ V V  ++VS   + +A + TC  V N ++PC  +L  G E    CC GV  LN++ K
Sbjct  7    LWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLT-GQEPSKACCTGVNNLNNSRK 65
Query  65   TTPDRQTACTCLKNSFKT-NKDLKSDYAVPLPS-KCGVTIPYK-LSMETDCNKV 115
            T  DR   C C+K   K+   D K    +PL S KCGV   +  +    DC+K+
Sbjct  66   TKADRVAVCNCIKELTKSIAYDPKR---MPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 44.9 bits 196,  Expect = 8e-07
 Identities = 28/85 32%, Positives = 45/85 52%, Gaps = 5/85 5%
Query  27   TCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            TC  V   + PCL +++   + P+  CC+G K L+   KT P R  AC C++ + KT  D
Sbjct  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
Query  86   LKSDYAVPLPSKCGVT---IPYKLSMETDC 112
            +       +P  CG+    +P  + +  DC
Sbjct  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127

Sequence Alignment: 63. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 44.7 bits 195,  Expect = 9e-07
 Identities = 28/88 31%, Positives = 46/88 52%, Gaps = 5/88 5%
Query  27   TCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            TC  +   + PCL +++   + P+  CC+G K L+   KT P R  AC C++ + KT  D
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  86   LKSDYAVPLPSKCGVT---IPYKLSMETDCNKV 115
            +       +P  CG+    +P  + +  DC  V
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 64. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 44.0 bits 191,  Expect = 2e-06
 Identities = 27/85 31%, Positives = 45/85 52%, Gaps = 5/85 5%
Query  27   TCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            TC  +   + PCL +++   + P+  CC+G K L+   KT P R  AC C++ + KT  D
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  86   LKSDYAVPLPSKCGVT---IPYKLSMETDC 112
            +       +P  CG+    +P  + +  DC
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 42.1 bits 181,  Expect = 5e-06
 Identities = 26/78 33%, Positives = 42/78 53%, Gaps = 5/78 6%
Query  37   PCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLP 95
            PCL +++   + P+  CC+G K L+   KT P R  AC C++ + KT  D+       +P
Sbjct  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
Query  96   SKCGVT---IPYKLSMETDCNKV 115
              CG+    +P  + +  DC  V
Sbjct  67   KHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 66. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 42.3 bits 181,  Expect = 6e-06
 Identities = 27/85 31%, Positives = 44/85 51%, Gaps = 5/85 5%
Query  27   TCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
            TC  V   + PCL +++   + P+  CC+G K L+   KT   R  AC C++ + KT  D
Sbjct  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
Query  86   LKSDYAVPLPSKCGVT---IPYKLSMETDC 112
            +       +P  CG+    +P  + +  DC
Sbjct  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128

Sequence Alignment: 67. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 30.8 bits 124,  Expect = 0.004
 Identities = 17/33 51%, Positives = 21/33 63%, Gaps = 2/33 6%
Query  25   ALTCSDVSNKISPCLNYLKQGG--EVPANCCAGVK 57
            ++TC+ VS  + PCL YLK  G    P  CC GVK
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

Sequence Alignment: 68. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 29.5 bits 117,  Expect = 0.009
 Identities = 14/28 50%, Positives = 23/28 82%, Gaps = 1/28 3%
Query  26   LTCSDVSNKISPCLNYLKQGGEVPA-NCC 53
            +TC  V++ +SPC++YL++ G VPA +CC
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCC 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.