The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF
HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF
ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQLCNAKLTMSW
GNGAYRKSLQVQGVVIGQRDANSMSEQAQFAFVVSFVTQIMKIQSS
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A444XS96 Ara h 18.0101 226 1517 352.6 6.1e-99
CAA59468 Cat r 1.0101 172 1085 254.2 1.8e-69
Q8L5T1 Bet v 7 173 1075 252.0 9.1e-69
AVV30163 Ole e 15.0101 172 1072 251.3 1.4e-68
P21568 Sola l 5.0101 171 1056 247.6 1.8e-67
A1KXG2 Der f 29.0101 164 818 193.4 3.6e-51
ALM24136 Rhi o 2.0101 164 779 184.5 1.7e-48
AJ937743 Asp f 27.0101 163 764 181.1 1.8e-47
CAA09884 Mala s 6 162 721 171.3 1.6e-44
QAT18640 Der p 29.0101 247 723 171.5 2.1e-44
CAB44442 Asp f 11 178 619 148.0 1.8e-37
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 18.0101 Sequence ID: A0A444XS96

 Score = 352.6 bits 1517,  Expect = 6e-99
 Identities = 226/226 100%, Positives = 226/226 100%, Gaps = 0/226 0%
Query  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
            MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF
Sbjct  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQLCNAKLTMSW 180
            ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQLCNAKLTMSW
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQLCNAKLTMSW 180
Query  181  GNGAYRKSLQVQGVVIGQRDANSMSEQAQFAFVVSFVTQIMKIQSS 226
            GNGAYRKSLQVQGVVIGQRDANSMSEQAQFAFVVSFVTQIMKIQSS
Sbjct  181  GNGAYRKSLQVQGVVIGQRDANSMSEQAQFAFVVSFVTQIMKIQSS 226

Sequence Alignment: 2. Allergen Name: Cat r 1.0101 Sequence ID: CAA59468

 Score = 254.2 bits 1085,  Expect = 2e-69
 Identities = 156/171 91%, Positives = 163/171 95%, Gaps = 0/171 0%
Query  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
            M NPRVFFDM++GGQPAGRI+MELFADTTPRTAENFRALCTGEKG GRSGKPLHYK SSF
Sbjct  1    MPNPRVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFADENFIKKHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
            ICTAKTEWLDGKHVVFGQVVEG+DVV+ IEKVGSSSGRT+K VVV DCGQL
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQL 171

Sequence Alignment: 3. Allergen Name: Bet v 7 Sequence ID: Q8L5T1

 Score = 252.0 bits 1075,  Expect = 9e-69
 Identities = 154/170 90%, Positives = 162/170 95%, Gaps = 0/170 0%
Query  2    ANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFH 61
            +NP+VFFDM +GGQP GRI+MEL+ADTTPRTAENFRALCTGEKG GRSGKPLHYK SSFH
Sbjct  3    SNPKVFFDMEVGGQPVGRIVMELYADTTPRTAENFRALCTGEKGNGRSGKPLHYKKSSFH 62
Query  62   RVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFFI 121
            RVIP FMCQGGDFTAGNGTGGESIYG+KFADENFIKKHTGPGILSMANAG  TNGSQFFI
Sbjct  63   RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFI 122
Query  122  CTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
            CTAKTEWLDGKHVVFGQVVEGLD+V+ IEKVGSSSGRTSKPVVVADCGQL
Sbjct  123  CTAKTEWLDGKHVVFGQVVEGLDIVKAIEKVGSSSGRTSKPVVVADCGQL 172

Sequence Alignment: 4. Allergen Name: Ole e 15.0101 Sequence ID: AVV30163

 Score = 251.3 bits 1072,  Expect = 1e-68
 Identities = 152/171 88%, Positives = 163/171 95%, Gaps = 0/171 0%
Query  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
            MANP+VFFDMTIGGQP GRI+MELFAD  PRT+ENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPKVFFDMTIGGQPVGRIVMELFADVVPRTSENFRALCTGEKGVGKSGKPLHYKGSAF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENF+KKHTGPGILSMANAG  TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
            ICTAKTEWLDGKHVVFGQVVEG+ VV+ IE+VGS SG+T+KPVVVADCGQL
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGFYVVKAIEQVGSGSGKTAKPVVVADCGQL 171

Sequence Alignment: 5. Allergen Name: Sola l 5.0101 Sequence ID: P21568

 Score = 247.6 bits 1056,  Expect = 2e-67
 Identities = 147/171 85%, Positives = 162/171 94%, Gaps = 0/171 0%
Query  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
            MANP+VFFD+TIGG PAGR++MELFADTTP+TAENFRALCTGEKGVG+ GKPLHYKGS+F
Sbjct  1    MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF 60
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAG  TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFF 120
Query  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
            ICTAKTEWL+GKHVVFGQVVEG+DV+++ E VGSSSGR SKPVV+ADCGQL
Sbjct  121  ICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL 171

Sequence Alignment: 6. Allergen Name: Der f 29.0101 Sequence ID: A1KXG2

 Score = 193.4 bits 818,  Expect = 4e-51
 Identities = 118/164 71%, Positives = 137/164 83%, Gaps = 7/164 4%
Query  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
            MA PRVFFD+    QP GRI++EL +D  P+TAENFRALCTGEKG G       +K SSF
Sbjct  1    MALPRVFFDIAADNQPLGRIVIELRSDVVPKTAENFRALCTGEKGFG-------FKSSSF 53
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
            HR+IPNFM QGGDFT  NGTGG+SIYG+KFADENF  +HTGPGI+SMANAG NTNGSQFF
Sbjct  54   HRIIPNFMIQGGDFTNHNGTGGKSIYGNKFADENFTLQHTGPGIMSMANAGPNTNGSQFF 113
Query  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
            I T KT WLDGKHVVFG VVEG+D+V+++E  GS SG+ SK V +A+CGQL
Sbjct  114  ITTVKTTWLDGKHVVFGSVVEGMDIVKKVESYGSQSGKPSKKVTIANCGQL 164

Sequence Alignment: 7. Allergen Name: Rhi o 2.0101 Sequence ID: ALM24136

 Score = 184.5 bits 779,  Expect = 2e-48
 Identities = 114/164 69%, Positives = 132/164 80%, Gaps = 7/164 4%
Query  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
            M+NP+VFFD++   +P GRI+MEL AD  P+TAENFRALCTGEKG G       YKG SF
Sbjct  1    MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFG-------YKGCSF 53
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
            HRVIP FM QGGDFT  NGTGG+SIYG+KF DENF  KHTGPG LSMANAG NTNGSQFF
Sbjct  54   HRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPNTNGSQFF 113
Query  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
            I T K  WLDGKHVVFG+V EG+DVV+ IE +GS +G     +++ +CGQL
Sbjct  114  ITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIIDNCGQL 164

Sequence Alignment: 8. Allergen Name: Asp f 27.0101 Sequence ID: AJ937743

 Score = 181.1 bits 764,  Expect = 2e-47
 Identities = 110/160 68%, Positives = 129/160 80%, Gaps = 7/160 4%
Query  5    RVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFHRVI 64
            + FFD+TI GQPAGRI  +LF +  P+T ENFRALCTGEKG G       YKGSSFHR+I
Sbjct  4    KTFFDITIDGQPAGRITFKLFDEVVPKTVENFRALCTGEKGFG-------YKGSSFHRII 56
Query  65   PNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFFICTA 124
            P FM QGGDFT GNGTGG+SIYG +F DENF  KH  PG+LSMANAG+NTNGSQFFI T 
Sbjct  57   PQFMLQGGDFTKGNGTGGKSIYGDRFPDENFQLKHDKPGLLSMANAGKNTNGSQFFITTV 116
Query  125  KTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
             T WLDG HVVFG+V +G+D+V++IE  GS+SG   K + +ADCGQL
Sbjct  117  VTSWLDGAHVVFGEVEDGMDLVKKIESYGSASGTPKKKITIADCGQL 163

Sequence Alignment: 9. Allergen Name: Mala s 6 Sequence ID: CAA09884

 Score = 171.3 bits 721,  Expect = 2e-44
 Identities = 110/162 67%, Positives = 128/162 79%, Gaps = 10/162 6%
Query  1    MANPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF 60
            M+N  VFFD+T  G P G I  +LF D  P+TA NFRALCTGEKG G       Y GS F
Sbjct  1    MSN--VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG-------YAGSHF 51
Query  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFF 120
            HRVIP+FM QGGDFTAGNGTGG+SIYG+KFADENF  KH  PG+LSMANAG NTNGSQFF
Sbjct  52   HRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFF 111
Query  121  ICTAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQLC 172
            I T  T WLDGKHVVFG+V++G++VV+ IE  GS SG+    + +A CG +C
Sbjct  112  ITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCG-VC 162

Sequence Alignment: 10. Allergen Name: Der p 29.0101 Sequence ID: QAT18640

 Score = 171.5 bits 723,  Expect = 2e-44
 Identities = 104/162 64%, Positives = 129/162 79%, Gaps = 7/162 4%
Query  3    NPRVFFDMTIGGQPAGRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFHR 62
            NP+VFFD+ +  Q  GRI++ L  D  P+T ENFR LCT EKG G       ++GS FHR
Sbjct  85   NPQVFFDIRVDNQYCGRIVILLRKDVVPKTTENFRCLCTHEKGFG-------FRGSIFHR 137
Query  63   VIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNGSQFFIC 122
            +IP FM QGGDFT  NGTGG+SIYG KF DENF  KHTG G LSMAN+G NTNGSQFFI 
Sbjct  138  IIPGFMIQGGDFTNHNGTGGKSIYGRKFEDENFQLKHTGAGTLSMANSGPNTNGSQFFIT 197
Query  123  TAKTEWLDGKHVVFGQVVEGLDVVREIEKVGSSSGRTSKPVVVADCGQL 171
             ++TEWLDGKHVVFGQV++G+D+VR+IE+ GS SG+ +K V +A+CG++
Sbjct  198  ASRTEWLDGKHVVFGQVMQGMDIVRKIEECGSKSGKPNKRVKIANCGEF 246

Sequence Alignment: 11. Allergen Name: Asp f 11 Sequence ID: CAB44442

 Score = 148.0 bits 619,  Expect = 2e-37
 Identities = 103/162 63%, Positives = 122/162 75%, Gaps = 18/162 11%
Query  2    ANPRVFFDMT---IGGQPA--GRIIMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYK 56
            A  +VFFD+    +G      GRI+  LF    P+TA+NFR LC    G G       Y+
Sbjct  7    AMSQVFFDVEYAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEG-------YR 59
Query  57   GSSFHRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGQNTNG 116
             S+FHR+IPNFM QGGDFT GNGTGG SIYG KFADENF +KH   GILSMANAG NTNG
Sbjct  60   ESTFHRIIPNFMIQGGDFTRGNGTGGRSIYGDKFADENFSRKHDKKGILSMANAGPNTNG 119
Query  117  SQFFICTAKTEWLDGKHVVFGQVVE--GLDVVREIEKVGSSSGRT---SKPVVVADCGQL 171
            SQFFI TA T WLDGKHVVFG+V +     VV+EIE +GSSSG     ++P +V +CG+L
Sbjct  120  SQFFITTAVTSWLDGKHVVFGEVADEKSYSVVKEIEALGSSSGSVRSNTRPKIV-NCGEL 178

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.