The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAPKASSLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTK
NCDNQCIQWETARHGACHKRGGKWMCFCYFDRC
Sequence Info Allergen Name Length Opt Bits Score E Value
QUJ17885 Api g 7.0101 93 672 169.4 1.4e-44
Q7M1F3 Aes h 1.0101 50 284 75.8 1.1e-16
A0A0X9C7K4 Par h 1.0101 156 290 77.2 1.4e-16
AHF71026 Art t 1.0101 108 269 72.2 3.1e-15
AHF71023 Art c 1.0101 108 269 72.2 3.1e-15
AHF71024 Art f 1.0101 108 269 72.2 3.1e-15
AHF71021 Art ab 1.0101 108 269 72.2 3.1e-15
ANC85006 Art an 1.0102 132 269 72.1 3.8e-15
ANC85016 Art si 1.0102 132 269 72.1 3.8e-15
ANC85010 Art ca 1.0101 132 269 72.1 3.8e-15
ANC85015 Art si 1.0101 132 269 72.1 3.8e-15
CBK52317 Amb a 4.0101 164 267 71.6 6.8e-15
AHF71025 Art l 1.0101 108 256 69.0 2.7e-14
ANC85014 Art la 1.0102 132 256 69.0 3.4e-14
AF493943 Art v 1.0101 132 256 69.0 3.4e-14
ANC85013 Art la 1.0101 132 256 69.0 3.4e-14
ANC85009 Art ar 1.0102 132 256 69.0 3.4e-14
ANC85011 Art gm 1.0101 132 256 69.0 3.4e-14
ANC85008 Art ar 1.0101 132 256 69.0 3.4e-14
XP_015936675 Ara h 12 71 110 33.8 0.0007
C0HJZ1 Ara h 13.0102 72 101 31.7 0.0032
B3EWP4 Ara h 13.0101 79 97 30.7 0.0069
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Api g 7.0101 Sequence ID: QUJ17885

 Score = 169.4 bits 672,  Expect = 1e-44
 Identities = 93/93 100%, Positives = 93/93 100%, Gaps = 0/93 0%
Query  1    MAPKASSLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTK 60
            MAPKASSLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTK
Sbjct  1    MAPKASSLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTK 60
Query  61   NCDNQCIQWETARHGACHKRGGKWMCFCYFDRC 93
            NCDNQCIQWETARHGACHKRGGKWMCFCYFDRC
Sbjct  61   NCDNQCIQWETARHGACHKRGGKWMCFCYFDRC 93

Sequence Alignment: 2. Allergen Name: Aes h 1.0101 Sequence ID: Q7M1F3

 Score = 75.8 bits 284,  Expect = 1e-16
 Identities = 34/49 69%, Positives = 38/49 77%, Gaps = 2/49 4%
Query  44   LC-EKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKRGGKWMCFCYFDRC 93
            LC E+PSQTW+G CGNT +CD QC  WE A HGACHKR   W CFCYF+ C
Sbjct  1    LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFN-C 50

Sequence Alignment: 3. Allergen Name: Par h 1.0101 Sequence ID: A0A0X9C7K4

 Score = 77.2 bits 290,  Expect = 1e-16
 Identities = 39/74 52%, Positives = 56/74 75%, Gaps = 9/74 12%
Query  11   SAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQCIQWE 70
            S  +L+FL+    V +++ A  +  G+V      CEKPS+TW G C +T+ CD +C++WE
Sbjct  5    STSYLVFLLLVLVVAISEIA--SVNGKV------CEKPSKTWFGNCKDTEKCDKRCMEWE 56
Query  71   TARHGACHKRGGKWMCFCYFDRC 93
             A+HGACH+R  K+MCFCYFD C
Sbjct  57   GAKHGACHQRESKYMCFCYFD-C 78

Sequence Alignment: 4. Allergen Name: Art t 1.0101 Sequence ID: AHF71026

 Score = 72.2 bits 269,  Expect = 3e-15
 Identities = 35/48 72%, Positives = 40/48 83%, Gaps = 3/48 6%
Query  44   LCEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC 93
            LCEK S+TW+GKC N K CD +CI+WE A+HGACHKR  GK  CFCYFD C
Sbjct  5    LCEKTSKTWSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-C 53

Sequence Alignment: 5. Allergen Name: Art c 1.0101 Sequence ID: AHF71023

 Score = 72.2 bits 269,  Expect = 3e-15
 Identities = 35/48 72%, Positives = 40/48 83%, Gaps = 3/48 6%
Query  44   LCEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC 93
            LCEK S+TW+GKC N K CD +CI+WE A+HGACHKR  GK  CFCYFD C
Sbjct  5    LCEKTSKTWSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-C 53

Sequence Alignment: 6. Allergen Name: Art f 1.0101 Sequence ID: AHF71024

 Score = 72.2 bits 269,  Expect = 3e-15
 Identities = 35/48 72%, Positives = 40/48 83%, Gaps = 3/48 6%
Query  44   LCEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC 93
            LCEK S+TW+GKC N K CD +CI+WE A+HGACHKR  GK  CFCYFD C
Sbjct  5    LCEKTSKTWSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-C 53

Sequence Alignment: 7. Allergen Name: Art ab 1.0101 Sequence ID: AHF71021

 Score = 72.2 bits 269,  Expect = 3e-15
 Identities = 35/48 72%, Positives = 40/48 83%, Gaps = 3/48 6%
Query  44   LCEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC 93
            LCEK S+TW+GKC N K CD +CI+WE A+HGACHKR  GK  CFCYFD C
Sbjct  5    LCEKTSKTWSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-C 53

Sequence Alignment: 8. Allergen Name: Art an 1.0102 Sequence ID: ANC85006

 Score = 72.1 bits 269,  Expect = 4e-15
 Identities = 42/72 58%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+TW+GKC N K CD +C
Sbjct  5    SYVFCAVLLIFVLA---IGEIEAAGSK----------LCEKTSKTWSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 9. Allergen Name: Art si 1.0102 Sequence ID: ANC85016

 Score = 72.1 bits 269,  Expect = 4e-15
 Identities = 42/72 58%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+TW+GKC N K CD +C
Sbjct  5    SYVFCAVLLIFVLA---IGEIEAAGSK----------LCEKTSKTWSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 10. Allergen Name: Art ca 1.0101 Sequence ID: ANC85010

 Score = 72.1 bits 269,  Expect = 4e-15
 Identities = 42/72 58%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+TW+GKC N K CD +C
Sbjct  5    SYVFCAVLLIFILA---IGEIEAAGSK----------LCEKTSKTWSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 11. Allergen Name: Art si 1.0101 Sequence ID: ANC85015

 Score = 72.1 bits 269,  Expect = 4e-15
 Identities = 42/72 58%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+TW+GKC N K CD +C
Sbjct  5    SYVFCAVLLIFILA---IGEIEAAGSK----------LCEKTSKTWSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 12. Allergen Name: Amb a 4.0101 Sequence ID: CBK52317

 Score = 71.6 bits 267,  Expect = 7e-15
 Identities = 34/49 69%, Positives = 38/49 77%, Gaps = 3/49 6%
Query  44   LCEKPSQTWTGKCG--NTKNCDNQCIQWETARHGACHKRGGKWMCFCYFDRC 93
            LCEKPS TW+GKC    T  CD +CI+WE A+HGACHKR  K  CFCYFD C
Sbjct  22   LCEKPSVTWSGKCKVKQTDKCDKRCIEWEGAKHGACHKRDSKATCFCYFD-C 72

Sequence Alignment: 13. Allergen Name: Art l 1.0101 Sequence ID: AHF71025

 Score = 69.0 bits 256,  Expect = 3e-14
 Identities = 34/48 70%, Positives = 40/48 83%, Gaps = 3/48 6%
Query  44   LCEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC 93
            LCEK S+T++GKC N K CD +CI+WE A+HGACHKR  GK  CFCYFD C
Sbjct  5    LCEKTSKTYSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-C 53

Sequence Alignment: 14. Allergen Name: Art la 1.0102 Sequence ID: ANC85014

 Score = 69.0 bits 256,  Expect = 3e-14
 Identities = 41/72 56%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+T++GKC N K CD +C
Sbjct  5    SYVFCAVLLIFILA---IGEIEAAGSK----------LCEKTSKTYSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 15. Allergen Name: Art v 1.0101 Sequence ID: AF493943

 Score = 69.0 bits 256,  Expect = 3e-14
 Identities = 42/72 58%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F+VA   +G  + A +           LCEK S+T++GKC N K CD +C
Sbjct  5    SYVFCAVLLIFIVA---IGEMEAAGSK----------LCEKTSKTYSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 16. Allergen Name: Art la 1.0101 Sequence ID: ANC85013

 Score = 69.0 bits 256,  Expect = 3e-14
 Identities = 41/72 56%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+T++GKC N K CD +C
Sbjct  5    SYVFCAVLLIFILA---IGEIEAAGSK----------LCEKTSKTYSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 17. Allergen Name: Art ar 1.0102 Sequence ID: ANC85009

 Score = 69.0 bits 256,  Expect = 3e-14
 Identities = 41/72 56%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+T++GKC N K CD +C
Sbjct  5    SYVFCAVLLIFILA---IGEIEAAGSK----------LCEKTSKTYSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 18. Allergen Name: Art gm 1.0101 Sequence ID: ANC85011

 Score = 69.0 bits 256,  Expect = 3e-14
 Identities = 42/72 58%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+FL+A   +G  + A +           LCEK S+T++GKC N K CD +C
Sbjct  5    SYVFCAVLLIFLLA---IGEIEAAGSK----------LCEKTSKTYSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 19. Allergen Name: Art ar 1.0101 Sequence ID: ANC85008

 Score = 69.0 bits 256,  Expect = 3e-14
 Identities = 41/72 56%, Positives = 56/72 77%, Gaps = 16/72 22%
Query  7    SLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQC 66
            S  + A++L+F++A   +G  + A +           LCEK S+T++GKC N K CD +C
Sbjct  5    SYVFCAVLLIFILA---IGEIEAAGSK----------LCEKTSKTYSGKCDN-KKCDKKC 50
Query  67   IQWETARHGACHKR-GGKWMCFCYFDRC 93
            I+WE A+HGACHKR  GK  CFCYFD C
Sbjct  51   IEWEKAQHGACHKREAGKESCFCYFD-C 77

Sequence Alignment: 20. Allergen Name: Ara h 12 Sequence ID: XP_015936675

 Score = 33.8 bits 110,  Expect = 0.0007
 Identities = 21/51 41%, Positives = 27/51 52%, Gaps = 6/51 11%
Query  33   ATEGEVVYPEA-LCEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKRGGKWMCFC 88
            A EG VV  EA LC   + T+ G C    +CD++C   E    G C K      C+C
Sbjct  16   AQEG-VVKTEAKLCNHLADTYRGPCFTNASCDDHCKNKEHFVSGTCMKMA----CWC 67

Sequence Alignment: 21. Allergen Name: Ara h 13.0102 Sequence ID: C0HJZ1

 Score = 31.7 bits 101,  Expect = 0.003
 Identities = 24/59 40%, Positives = 32/59 54%, Gaps = 17/59 28%
Query  13   IFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQTWTGKCGNTKNCDNQCIQWETA 72
            IF+L L  +   GV        EG+V      C   S  + G C  TKNCD++C   E  
Sbjct  10   IFFLVLFLAQEYGV--------EGKV------CLNLSDKFKGPCLGTKNCDHHCRDIEHL 55
Query  73   RHGACHKRGGKWMCFC 88
              G C      + C+C
Sbjct  56   LSGVCRD---DFRCWC 68

Sequence Alignment: 22. Allergen Name: Ara h 13.0101 Sequence ID: B3EWP4

 Score = 30.7 bits 97,  Expect = 0.007
 Identities = 14/41 34%, Positives = 20/41 48%, Gaps = 3/41 7%
Query  45   CEKPSQTWTGKCGNTKNCDNQCIQWETARHGACHKRGGKWMCFC 88
            C   S  + G C  +KNCD++C   E    G C      + C+C
Sbjct  35   CLNLSDKFKGPCLGSKNCDHHCRDIEHLLSGVCRD---DFRCWC 75

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.