The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC
QRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMR
EVMETARDLPNQCRLSPQRCEIRSARF
Sequence Info Allergen Name Length Opt Bits Score E Value
ACO56333 Cor a 14.0101 147 998 86.5 3.3e-19
AAM54365 Jug n 1 161 643 60.5 2.4e-11
AAB41308 Jug r 1 139 623 59.0 6e-11
AAO32314 Car i 1.0101 143 593 56.8 2.8e-10
CAA38363 Ber e 1 154 446 46.0 5.1e-07
AAA33010 Ber e 1 146 428 44.7 1.2e-06
P04403 Ber e 1 146 428 44.7 1.2e-06
Q39649 Cuc ma 5.0101 141 413 43.6 2.6e-06
AAL91665 Ana o 3 138 408 43.2 3.3e-06
AAK15088 Ses i 1 153 406 43.1 3.9e-06
DQ631675 Pis v 1.0101 149 385 41.5 1.1e-05
P01089 Ric c 1 258 335 38.2 0.0002
Q8LPD3 Lin u 1.01 168 289 34.6 0.0016
Q8LPD3 Lin u 1.01 168 289 34.6 0.0016
AAD42943 Ses i 2 148 267 32.9 0.0044
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 14.0101 Sequence ID: ACO56333

 Score = 86.5 bits 998,  Expect = 3e-19
 Identities = 147/147 100%, Positives = 147/147 100%, Gaps = 0/147 0%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC
Sbjct  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
Query  61   QRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMR 120
            QRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMR
Sbjct  61   QRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMR 120
Query  121  EVMETARDLPNQCRLSPQRCEIRSARF 147
            EVMETARDLPNQCRLSPQRCEIRSARF
Sbjct  121  EVMETARDLPNQCRLSPQRCEIRSARF 147

Sequence Alignment: 2. Allergen Name: Jug n 1 Sequence ID: AAM54365

 Score = 60.5 bits 643,  Expect = 2e-11
 Identities = 97/144 67%, Positives = 123/144 85%, Gaps = 5/144 3%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MARLATLAAL+ ALL+VA+AAAFRTTITT+++DEDI N + RRGE C+EQ QRQQNLN+C
Sbjct  16   MARLATLAALLVALLFVANAAAFRTTITTMEIDEDIDNPR-RRGEGCQEQIQRQQNLNHC 74
Query  61   QRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAV--MQQQGEMRGEE 118
            Q Y+RQQS+ G YD  NQ+Q+  + QCCQQL Q++E+C+CEGLRQAV   QQQ  +RGEE
Sbjct  75   QYYLRQQSRSGGYDEDNQRQH--FRQCCQQLSQIEEQCQCEGLRQAVRRQQQQQGLRGEE 132
Query  119  MREVMETARDLPNQCRLSPQRCEIRSARF 147
            M E++++ARDLP +C +S QRCEIR + F
Sbjct  133  MEEMVQSARDLPKECGISSQRCEIRRSWF 161

Sequence Alignment: 3. Allergen Name: Jug r 1 Sequence ID: AAB41308

 Score = 59.0 bits 623,  Expect = 6e-11
 Identities = 93/137 67%, Positives = 116/137 84%, Gaps = 5/137 3%
Query  8    AALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQ 67
            AAL+ ALL+VA+AAAFRTTITT+++DEDI N + RRGE CREQ QRQQNLN+CQ Y+RQQ
Sbjct  1    AALLVALLFVANAAAFRTTITTMEIDEDIDNPR-RRGEGCREQIQRQQNLNHCQYYLRQQ 59
Query  68   SQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAV--MQQQGEMRGEEMREVMET 125
            S+ G YD  NQ+Q+  + QCCQQL QMDE+C+CEGLRQ V   QQQ  +RGEEM E++++
Sbjct  60   SRSGGYDEDNQRQH--FRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQS 117
Query  126  ARDLPNQCRLSPQRCEIRSARF 147
            ARDLPN+C +S QRCEIR + F
Sbjct  118  ARDLPNECGISSQRCEIRRSWF 139

Sequence Alignment: 4. Allergen Name: Car i 1.0101 Sequence ID: AAO32314

 Score = 56.8 bits 593,  Expect = 3e-10
 Identities = 90/141 63%, Positives = 116/141 82%, Gaps = 5/141 3%
Query  4    LATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRY 63
            +A +AAL+ ALL+VA+AAAFRTTITT+++DEDI N + RRGESCREQ QRQQ LN+CQ Y
Sbjct  1    MARVAALLVALLFVANAAAFRTTITTMEIDEDIDNPR-RRGESCREQIQRQQYLNRCQDY 59
Query  64   MRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGE--MRGEEMRE 121
            +RQQ + G YD  NQ+Q+  + QCCQQL QM+E+C+CEGLRQAV QQQ E  +RGEEM E
Sbjct  60   LRQQCRSGGYDEDNQRQH--FRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGIRGEEMEE 117
Query  122  VMETARDLPNQCRLSPQRCEIRSARF 147
            +++ A DLP +C +S + CEIR + F
Sbjct  118  MVQCASDLPKECGISSRSCEIRRSWF 143

Sequence Alignment: 5. Allergen Name: Ber e 1 Sequence ID: CAA38363

 Score = 46.0 bits 446,  Expect = 5e-07
 Identities = 66/142 46%, Positives = 100/142 70%, Gaps = 5/142 3%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MA+++ +AA + ALL++ +A AFRTT+TT   +E   N +GR  + CREQ +RQQ LN+C
Sbjct  1    MAKMSVVAAALLALLVLGQATAFRTTVTTTLEEEQEENPRGRSEQQCREQMERQQQLNHC 60
Query  61   QRYMRQQSQYGSYDGSNQQQQQE---LEQCCQQLRQMDERCRCEGLRQAVMQQQGEM--R 115
            + Y+RQQ +   Y      ++ E   L++CC+QL +MDE CRCEGLR  + +Q+ EM  +
Sbjct  61   RMYLRQQMEESPYQNPRPLRRGEEPHLDECCEQLERMDEMCRCEGLRMMLRRQREEMELQ 120
Query  116  GEEMREVMETARDLPNQCRLSPQRCEI 142
            GE+M+ +M  A +L ++C LSPQRC +
Sbjct  121  GEQMQRIMRKAENLLSRCNLSPQRCPM 147

Sequence Alignment: 6. Allergen Name: Ber e 1 Sequence ID: AAA33010

 Score = 44.7 bits 428,  Expect = 1e-06
 Identities = 67/135 49%, Positives = 95/135 70%, Gaps = 11/135 8%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MA+++  AA +  L+ + HA AFR T+TT  V+E+  NQ     E CREQ QRQQ L++C
Sbjct  1    MAKISVAAAALLVLMALGHATAFRATVTTTVVEEE--NQ-----EECREQMQRQQMLSHC 53
Query  61   QRYMRQQSQYGSYDGSNQQ-QQQELEQCCQQLRQMDERCRCEGLRQAVMQ-QQGEM--RG 116
            + YMRQQ +   Y    ++  +  + +CC+QL  MDE CRCEGLR  +M+ QQ EM  RG
Sbjct  54   RMYMRQQMEESPYQTMPRRGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRG 113
Query  117  EEMREVMETARDLPNQCRLSPQRCEI 142
            E+MR +M  A ++P++C LSP RC +
Sbjct  114  EQMRRMMRLAENIPSRCNLSPMRCPM 139

Sequence Alignment: 7. Allergen Name: Ber e 1 Sequence ID: P04403

 Score = 44.7 bits 428,  Expect = 1e-06
 Identities = 67/135 49%, Positives = 95/135 70%, Gaps = 11/135 8%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MA+++  AA +  L+ + HA AFR T+TT  V+E+  NQ     E CREQ QRQQ L++C
Sbjct  1    MAKISVAAAALLVLMALGHATAFRATVTTTVVEEE--NQ-----EECREQMQRQQMLSHC 53
Query  61   QRYMRQQSQYGSYDGSNQQ-QQQELEQCCQQLRQMDERCRCEGLRQAVMQ-QQGEM--RG 116
            + YMRQQ +   Y    ++  +  + +CC+QL  MDE CRCEGLR  +M+ QQ EM  RG
Sbjct  54   RMYMRQQMEESPYQTMPRRGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRG 113
Query  117  EEMREVMETARDLPNQCRLSPQRCEI 142
            E+MR +M  A ++P++C LSP RC +
Sbjct  114  EQMRRMMRLAENIPSRCNLSPMRCPM 139

Sequence Alignment: 8. Allergen Name: Cuc ma 5.0101 Sequence ID: Q39649

 Score = 43.6 bits 413,  Expect = 3e-06
 Identities = 62/136 45%, Positives = 100/136 73%, Gaps = 9/136 6%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MARL ++ ALFA  LLVA A A+RTTITTV+V+E   N+QGR  E CR+ + R++ L  C
Sbjct  1    MARLTSIIALFAVALLVADAYAYRTTITTVEVEE---NRQGRE-ERCRQMSAREE-LRSC 55
Query  61   QRYMRQQS----QYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRG 116
            ++Y+RQQS    Q    +   +++   +++CC++L+ +DE CRC+ L +   ++Q + RG
Sbjct  56   EQYLRQQSRDVLQMRGIENPWRREGGSFDECCRELKNVDEECRCDMLEEIAREEQRQARG 115
Query  117  EEMREVMETARDLPNQCRLSPQRCE 141
            +E R++++ AR+LP+ C + PQRC+
Sbjct  116  QEGRQMLQKARNLPSMCGIRPQRCD 140

Sequence Alignment: 9. Allergen Name: Ana o 3 Sequence ID: AAL91665

 Score = 43.2 bits 408,  Expect = 3e-06
 Identities = 65/134 48%, Positives = 99/134 73%, Gaps = 14/134 10%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MA++  L + FA LLLVA+A+ +R     V+V+ED     GR  +SC+ Q + QQ +  C
Sbjct  1    MAKFLLLLSAFAVLLLVANASIYRAI---VEVEED----SGRE-QSCQRQFEEQQRFRNC 52
Query  61   QRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAV--MQQQGEMRGEE 118
            QRY++Q+ Q G   G   Q+Q+ L +CCQ+L+++D RCRC+ L Q V  +QQQ +++GEE
Sbjct  53   QRYVKQEVQRG---GRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEE 109
Query  119  MREVMETARDLPNQCRLSP-QRCEIRSA 145
            +RE+ ETA +LP  C +SP Q C+ +S+
Sbjct  110  VRELYETASELPRICSISPSQGCQFQSS 137

Sequence Alignment: 10. Allergen Name: Ses i 1 Sequence ID: AAK15088

 Score = 43.1 bits 406,  Expect = 4e-06
 Identities = 67/136 49%, Positives = 93/136 68%, Gaps = 15/136 11%
Query  3    RLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQR 62
            +LA  A L+ A++ +A A  + TT+TT  +D D  NQQ    + CR+Q Q +Q +  CQR
Sbjct  4    KLALAAVLLVAMVALASATTYTTTVTTTAID-DEANQQS---QQCRQQLQGRQ-FRSCQR 58
Query  63   YMRQ-QSQYGSYDG-------SNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEM 114
            Y+ Q +S YG  +         NQQ +Q L  CCQQLR +DERCRCE +RQAV QQQ E 
Sbjct  59   YLSQGRSPYGGEEDEVLEMSTGNQQSEQSLRDCCQQLRNVDERCRCEAIRQAVRQQQQEG 118
Query  115  RGEE--MREVMETARDLPNQCRLSPQRCEIR 143
              +E   ++V + ARDLP +C + PQ+C+ R
Sbjct  119  GYQEGQSQQVYQRARDLPRRCNMRPQQCQFR 149

Sequence Alignment: 11. Allergen Name: Pis v 1.0101 Sequence ID: DQ631675

 Score = 41.5 bits 385,  Expect = 1e-05
 Identities = 60/136 44%, Positives = 98/136 72%, Gaps = 16/136 11%
Query  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
            MA+L  L + FA L+L A+A+ +R T+       ++  +    G+SC++Q + QQ + +C
Sbjct  1    MAKLVLLLSAFAFLILAANASIYRATV-------EVEGENLSSGQSCQKQFEEQQKFKHC 53
Query  61   QRYMRQQSQYGSYDGSN-----QQQQQELEQCCQQLRQMDERCRCEGLRQAV--MQQQGE 113
            Q Y++Q+ Q  S DG +      Q+QQ ++QCCQ+L+++D++CRC+ L Q V   QQQG+
Sbjct  54   QMYVQQEVQK-SQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQ 112
Query  114  MRGEEMREVMETARDLPNQCRLSP-QRCEIRS 144
             RGE+++E+ ETA +LP  C +SP Q C+  S
Sbjct  113  FRGEKLQELYETASELPRMCNISPSQGCQFSS 144

Sequence Alignment: 12. Allergen Name: Ric c 1 Sequence ID: P01089

 Score = 38.2 bits 335,  Expect = 0.0002
 Identities = 57/141 40%, Positives = 96/141 68%, Gaps = 18/141 12%
Query  1    MARLATLAALFAALL-LVAHAA-AFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLN 58
            MA+L    AL + LL ++A+A+ A+RTTITT+++DE    ++G   + CR++ QR+ +L+
Sbjct  1    MAKLIPTIALVSVLLFIIANASFAYRTTITTIEIDESKGEREGSSSQQCRQEVQRK-DLS 59
Query  59   QCQRYMRQQSQYGSY---------DGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQ 109
             C+RY+RQ S   S          D + QQ+ Q+L+QCC Q++Q+ + C+CE ++     
Sbjct  60   SCERYLRQSSSRRSPGEEVLRMPGDENQQQESQQLQQCCNQVKQVRDECQCEAIKYIAED 119
Query  110  Q--QGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSAR 146
            Q  QG++ GEE   V + A ++ + C +   RC +R  R
Sbjct  120  QIQQGQLHGEESERVAQRAGEIVSSCGV---RC-MRQTR 154
 Score = 38.2 bits 335,  Expect = 0.0002
 Identities = 50/96 52%, Positives = 68/96 70%, Gaps = 10/96 10%
Query  38   NQQGRRGESCREQAQRQQNLNQCQRYMRQQ-SQYGSYDGSNQQQQQELEQCCQQLRQMDE 96
            +QQG     CR Q Q QQNL QCQ Y++QQ S  G     NQ++   L  CC +L+QM  
Sbjct  158  SQQG-----CRGQIQEQQNLRQCQEYIKQQVSGQGPRRSDNQERS--LRGCCDHLKQMQS 210
Query  97   RCRCEGLRQAVMQQQ--GEMRGEEMREVMETARDLPNQCRLSPQRC 140
            +CRCEGLRQA+ QQQ  G+++G+++ E   TA +LP+ C +SP  C
Sbjct  211  QCRCEGLRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGVSPTEC 256

Sequence Alignment: 13. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 34.6 bits 289,  Expect = 0.002
 Identities = 60/139 43%, Positives = 92/139 66%, Gaps = 25/139 17%
Query  1    MARLATLAALFAALL-LVAHAAAFRTTITTVDVDEDIVNQ----QGRRGES--CREQAQR 53
            MA+L +LAA+  A+L L+   A+ RTT+    +DED  NQ    QG +G+   C +Q Q 
Sbjct  1    MAKLMSLAAVATAFLFLIVVDASVRTTVI---IDED-TNQGRGGQGGQGQQQQCEKQIQE 56
Query  54   QQNLNQCQRYMRQQSQYG--SY---DG-SNQQQQQELEQCCQQLRQMDERCRCEGLRQAV 107
            Q  L  CQ+++ ++ Q G  SY    G    QQ Q ++ CC  L+Q+   C C GL +A+
Sbjct  57   QDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECTCRGLERAI 116
Query  108  ------MQQQGEMRGEE--MREVMETARDLPNQCRLSPQRCEIR 143
                  +QQQG+ +  E  +++  + ARDLP QC   P RC+++
Sbjct  117  GQMRQDIQQQGQQQEVERWVQQAKQVARDLPGQCGTQPSRCQLQ 160

Sequence Alignment: 14. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 34.6 bits 289,  Expect = 0.002
 Identities = 60/139 43%, Positives = 92/139 66%, Gaps = 25/139 17%
Query  1    MARLATLAALFAALL-LVAHAAAFRTTITTVDVDEDIVNQ----QGRRGES--CREQAQR 53
            MA+L +LAA+  A+L L+   A+ RTT+    +DED  NQ    QG +G+   C +Q Q 
Sbjct  1    MAKLMSLAAVATAFLFLIVVDASVRTTVI---IDED-TNQGRGGQGGQGQQQQCEKQIQE 56
Query  54   QQNLNQCQRYMRQQSQYG--SY---DG-SNQQQQQELEQCCQQLRQMDERCRCEGLRQAV 107
            Q  L  CQ+++ ++ Q G  SY    G    QQ Q ++ CC  L+Q+   C C GL +A+
Sbjct  57   QDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECTCRGLERAI 116
Query  108  ------MQQQGEMRGEE--MREVMETARDLPNQCRLSPQRCEIR 143
                  +QQQG+ +  E  +++  + ARDLP QC   P RC+++
Sbjct  117  GQMRQDIQQQGQQQEVERWVQQAKQVARDLPGQCGTQPSRCQLQ 160

Sequence Alignment: 15. Allergen Name: Ses i 2 Sequence ID: AAD42943

 Score = 32.9 bits 267,  Expect = 0.004
 Identities = 55/134 41%, Positives = 82/134 61%, Gaps = 19/134 14%
Query  1    MARLA-TLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQ 59
            MAR+   LA LFAA L+   A+A +T +TT   +E    ++ +RG  C E   RQ  + +
Sbjct  1    MARFTIVLAVLFAAALV--SASAHKTVVTTSVAEEG--EEENQRG--C-EWESRQCQMRH 53
Query  60   CQRYMRQQSQYGSYDGS-------NQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQG 112
            C ++MR  S  G Y+ S       NQ Q + + +CC +LR +   CRCE LR  + Q Q 
Sbjct  54   CMQWMR--SMRGQYEESFLRSAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQ 111
Query  113  EMRGE-EMREVMETARDLPNQCRLS-PQRCEIR 143
            E   E EM+++ +  + LP  C +S P  C +R
Sbjct  112  EYGMEQEMQQMQQMMQYLPRMCGMSYPTECRMR 144

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.