The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV
RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
Sequence Info Allergen Name Length Opt Bits Score E Value
P19656-1 Zea m 14.0101 120 767 129.8 2e-32
P19656-2 Zea m 14.0102 128 755 127.9 7.9e-32
CAH69206 Tri tu 14.0101 115 517 90.8 1e-20
A0A059SSZ0 Pun g 1.0201 120 467 83.0 2.4e-18
A0A059STC4 Pun g 1.0101 120 446 79.8 2.3e-17
ADC80503 Pha v 3.0201 118 437 78.4 6e-17
AAA32970 Hor v 1 117 434 77.9 8.2e-17
Q9M5X8 Pru av 3 117 430 77.3 1.3e-16
Q9M5X7 Mal d 3 115 429 77.1 1.4e-16
CAA42832 Hor v 1 134 430 77.3 1.4e-16
Q8VX12 Fra a 3.0101 117 428 77.0 1.6e-16
AAL25839 Hev b 12 116 427 76.8 1.7e-16
Q4PLU0 Fra a 3.0201 117 424 76.3 2.4e-16
ABX56711 Ara h 9.0101 116 423 76.2 2.7e-16
A0AT29 Len c 3.0101 118 423 76.2 2.7e-16
A0A059ST23 Pun g 1.0301 120 423 76.2 2.7e-16
Q0Z8V0 Rub i 3.0101 117 422 76.0 3e-16
Q4PLT9 Fra a 3.0102 117 422 76.0 3e-16
Q9M5X6 Pyr c 3 115 420 75.7 3.6e-16
A0A161AT60 Pis s 3.0101 120 416 75.1 5.8e-16
Q4PLT6 Fra a 3.0202 117 415 74.9 6.4e-16
P85894 Mor n 3.0101 91 412 74.4 7e-16
CAB96876 Pru p 3 91 412 74.4 7e-16
P81651 Pru ar 3 91 410 74.1 8.6e-16
P81402 Pru p 3 91 410 74.1 8.6e-16
ABX75045 Ara h 9.0201 92 410 74.1 8.7e-16
P82534 Pru d 3 91 409 74.0 9.6e-16
ADC80502 Pha v 3.0101 115 408 73.8 1.3e-15
XP_019446786 Lup an 3.0101 116 394 71.7 6.1e-15
19846220 Tri a 14.0101 90 390 71.0 7.4e-15
ABY21307 Pla or 3.0101 118 390 71.0 9.5e-15
CAL07989 Pla a 3.0101 118 386 70.4 1.5e-14
W0U0V5 Can s 3.0101 91 382 69.8 1.8e-14
ACV04796 Api g 2 118 383 69.9 2e-14
AAK28533 Cor a 8 115 382 69.8 2.2e-14
P93224 Sola l 3.0101 114 376 68.8 4.2e-14
AAB42069 Lyc e 3 114 376 68.8 4.2e-14
ACN11576 Pru du 3.0101 123 375 68.7 5e-14
ANC85023 Art gm 3.0102 117 363 66.8 1.7e-13
ANC85021 Art ca 3.0101 117 362 66.7 1.9e-13
ANC85017 Art an 3.0101 117 362 66.7 1.9e-13
ANC85022 Art gm 3.0101 117 361 66.5 2.2e-13
A0A510A9S3 Ara h 17.0101 93 355 65.6 3.3e-13
ANC85018 Art an 3.0102 117 354 65.4 4.6e-13
QIN55516 Art ca 3.0102 117 352 65.1 5.7e-13
ANC85027 Art si 3.0102 116 350 64.8 7.1e-13
ACE07187 Art v 3.0202 116 350 64.8 7.1e-13
ANC85020 Art ar 3.0102 116 350 64.8 7.1e-13
NP_001316123 Sola l 7.0101 115 343 63.7 1.5e-12
ANC85025 Art la 3.0102 115 340 63.2 2.1e-12
ANC85026 Art si 3.0101 116 336 62.6 3.2e-12
EU564847 Art v 3.0301 117 336 62.6 3.2e-12
EU564845 Art v 3.0201 114 333 62.2 4.3e-12
ANC85019 Art ar 3.0101 116 333 62.2 4.4e-12
ANC85024 Art la 3.0101 116 333 62.2 4.4e-12
ABU95411 Sin a 3.0101 92 328 61.4 6.1e-12
O04403 Par j 2 133 288 55.2 6.5e-10
P82007 Hel a 3.0101 116 275 53.1 2.3e-09
P55958 Par j 2 133 271 52.5 4.1e-09
Q40905 Par j 1 138 235 46.9 2e-07
O04004 Amb a 6 118 232 46.4 2.4e-07
O04404 Par j 1 176 233 46.6 3.2e-07
P43217 Par j 1 139 226 45.5 5.5e-07
CAI94601 Par j 1.0103 139 222 44.9 8.4e-07
CAA54587 Par j 1.0101 133 204 42.1 5.6e-06
P80274 Vit v 1 37 132 30.7 0.004
P0C088 Art v 3.0101 37 131 30.6 0.0045
10998016 Cas s 8 36 124 29.5 0.0093
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 129.8 bits 767,  Expect = 2e-32
 Identities = 120/120 100%, Positives = 120/120 100%, Gaps = 0/120 0%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120
            RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
Sbjct  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120

Sequence Alignment: 2. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 127.9 bits 755,  Expect = 8e-32
 Identities = 118/118 100%, Positives = 118/118 100%, Gaps = 0/118 0%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR
Sbjct  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118

Sequence Alignment: 3. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 90.8 bits 517,  Expect = 1e-20
 Identities = 77/114 67%, Positives = 97/114 85%, Gaps = 5/114 4%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR+    VV  AVVA +LLA   +EAA+SCGQV+SA++PCISYARG G+ PSA CCSGV
Sbjct  1    MARSAVAQVVLVAVVAAMLLA--VTEAAVSCGQVSSALSPCISYARGNGASPSAACCSGV 58
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            RSL ++AR+TAD++AAC C+K+AAAG   LNAG AA IP+KCGVS+PY IS+S DCS++
Sbjct  59   RSLASSARSTADKQAACKCIKSAAAG---LNAGKAAGIPTKCGVSVPYAISSSVDCSKI 114

Sequence Alignment: 4. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 83.0 bits 467,  Expect = 2e-18
 Identities = 67/119 56%, Positives = 87/119 73%, Gaps = 0/119 0%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MA  + L  +  A+   +++AA+  E+A++CGQV S++ PCI YARG  + PSA CCSGV
Sbjct  1    MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGV 60
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            RSLNNAA+TT DR+ ACNCLK  A  ++G+N G   ++P KCGVSIPY IS STDCSRV
Sbjct  61   RSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRV 119

Sequence Alignment: 5. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 79.8 bits 446,  Expect = 2e-17
 Identities = 63/110 57%, Positives = 84/110 76%, Gaps = 1/110 0%
Query  10   VATAVVALVLLAAA-TSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAAR 68
            +A AV A+ L+AA   +EAA++CGQVAS++APCI YAR  G      CCSG+++L+  AR
Sbjct  9    LACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMAR 68
Query  69   TTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            TT DR+A C CLK+A+  +SG+N G  AS+P+KCGV+IPY IS STDC+RV
Sbjct  69   TTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARV 119

Sequence Alignment: 6. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 78.4 bits 437,  Expect = 6e-17
 Identities = 69/116 59%, Positives = 84/116 72%, Gaps = 3/116 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MA      VV  AV+ LV+L A T+ AAISCGQV S++A CI +    G  P A CCSGV
Sbjct  1    MATLNSACVV--AVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP-ASCCSGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            RSLN AA+TT DR+A CNCLK+AA  + G+NA NA  +P KCGVSIPY ISTST+C+ +
Sbjct  58   RSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATI 116

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 77.9 bits 434,  Expect = 8e-17
 Identities = 64/116 55%, Positives = 85/116 73%, Gaps = 3/116 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR Q L ++A A+V L+L AA  +  A++CGQV S + PC++Y +G G GPS  CC+GV
Sbjct  1    MARAQVL-LMAAALV-LMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPGPSGECCNGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R L+N A+++ DR+  CNCLK  A G+  LN  NAASIPSKC V++PYTIS   DCSR+
Sbjct  58   RDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 8. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 77.3 bits 430,  Expect = 1e-16
 Identities = 59/105 56%, Positives = 82/105 78%, Gaps = 1/105 0%
Query  14   VVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
            VVAL ++ +     A++CGQV+S +APCI+Y RG G+ P A CC+G+R++NN A+TTADR
Sbjct  12   VVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADR 70
Query  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            + ACNCLK  +A V G+NA NAA++P KCGV++PY IS ST+C+ V
Sbjct  71   QTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATV 116

Sequence Alignment: 9. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 77.1 bits 429,  Expect = 1e-16
 Identities = 61/110 55%, Positives = 82/110 74%, Gaps = 2/110 1%
Query  8    AVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAA 67
            AV   A+V  + +A + + A I+CGQV S++APCI Y R  G+ P A CC+G+R++N  A
Sbjct  5    AVTKLALVVALCMAVSVAHA-ITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLA 62
Query  68   RTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            RTTADR+ ACNCLKN A  +SG+N  NAA +P KCGV++PY ISTST+C+ V
Sbjct  63   RTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV 114

Sequence Alignment: 10. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 77.3 bits 430,  Expect = 1e-16
 Identities = 64/115 55%, Positives = 84/115 73%, Gaps = 3/115 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR Q L ++A A+V L+L AA  +  A++CGQV S + PC++Y +G G GPS  CC+GV
Sbjct  1    MARAQVL-LMAAALV-LMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPGPSGECCNGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R L+N A+++ DR+  CNCLK  A G+  LN  NAASIPSKC V++PYTIS   DCSR
Sbjct  58   RDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSR 115

Sequence Alignment: 11. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 77.0 bits 428,  Expect = 2e-16
 Identities = 62/106 58%, Positives = 83/106 78%, Gaps = 2/106 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS I+PC++Y +  G+ P+A CCSG+R+LN  A+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVPAA-CCSGIRNLNGMAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            DR+AACNCLK AA G+ GLN   AA +P KCGVS+PY IST+T+C+ V
Sbjct  69   DRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV 116

Sequence Alignment: 12. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 76.8 bits 427,  Expect = 2e-16
 Identities = 60/106 56%, Positives = 77/106 72%, Gaps = 0/106 0%
Query  14   VVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
            +V  +L+AA  +  AI+CGQV SA+ PC+SY +  G  P A CC+GVR++NNAA+TTADR
Sbjct  10   LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADR 69
Query  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R AC CLK+AA  V GLN    A +P KCGV+IPY IS ST+C+ V
Sbjct  70   RTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATV 115

Sequence Alignment: 13. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 76.3 bits 424,  Expect = 2e-16
 Identities = 61/106 57%, Positives = 84/106 79%, Gaps = 2/106 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS+I+PC++Y +  G+ P+A CC+G+RSLN+AA+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAA-CCNGIRSLNSAAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            DR+A CNCLK A+  + GLN   AA +P KCGVS+PY ISTST+C+ V
Sbjct  69   DRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAV 116

Sequence Alignment: 14. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 76.2 bits 423,  Expect = 3e-16
 Identities = 66/112 58%, Positives = 80/112 71%, Gaps = 3/112 2%
Query  7    LAVVATAVVALVLLA--AATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            +A +  A V LV +A   A    AISCGQV SA+APCI +   +G  P   CCSGVR L 
Sbjct  1    MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLT-KGGAPPPACCSGVRGLL 59
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
             A RTTADR+AACNCLK AA  + GLN GNAA++P +CGVSIPY ISTST+C+ +
Sbjct  60   GALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATI 114

Sequence Alignment: 15. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 76.2 bits 423,  Expect = 3e-16
 Identities = 63/116 54%, Positives = 83/116 71%, Gaps = 3/116 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR  +LA V   +  +V+  A  +E AISCG V S ++PC++Y  G G GPS  CC GV
Sbjct  1    MARGMKLACVVLVICMVVI--APMAEGAISCGAVTSDLSPCLTYLTG-GPGPSPQCCGGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            + L  AA TT DR+AACNCLK+AA  ++ LN  NAA++P KCGV+IPY IST+T+C+ V
Sbjct  58   KKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTV 116

Sequence Alignment: 16. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 76.2 bits 423,  Expect = 3e-16
 Identities = 62/118 52%, Positives = 85/118 72%, Gaps = 2/118 1%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGP-SAGCCSG 59
            MA +  L +    +V + + A+  +EA I+CGQV+S++A CI YARG G+GP    CC+G
Sbjct  1    MASSGFLRLAGFVLVCMAV-ASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNG 59
Query  60   VRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +RSLN+AA+TT DR+AAC CLK+ A+ +SG+N G  A  P KCGVSIPY I+ ST+C  V
Sbjct  60   IRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119

Sequence Alignment: 17. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 76.0 bits 422,  Expect = 3e-16
 Identities = 62/111 55%, Positives = 82/111 73%, Gaps = 2/111 1%
Query  8    AVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            AV+  A+VAL+ +  A   A AI+CGQV   +APC +Y +  G+ P+A CC+GVR+LN+ 
Sbjct  5    AVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVPAA-CCNGVRNLNSQ 63
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            A+TTADR+  CNCLKNAA  + GLN   AA +P KCGVS+PY ISTST+C+ V
Sbjct  64   AKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATV 116

Sequence Alignment: 18. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 76.0 bits 422,  Expect = 3e-16
 Identities = 61/106 57%, Positives = 81/106 76%, Gaps = 2/106 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS I+PC++Y +  G+ P A CCSG+R+LN  A+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP-APCCSGIRNLNGMAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            DR+A CNCLK AA G+ GLN   AA +P KCGVS+PY IST+T+C+ V
Sbjct  69   DRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV 116

Sequence Alignment: 19. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 75.7 bits 420,  Expect = 4e-16
 Identities = 59/110 53%, Positives = 84/110 76%, Gaps = 2/110 1%
Query  8    AVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAA 67
            AV+  A+V  + +A + + A I+C QV++ +APCI+Y R  G+ P A CC+G++++N  A
Sbjct  5    AVIKLALVVALCMAVSVAHA-ITCSQVSANLAPCINYVRSGGAVPPA-CCNGIKTINGLA 62
Query  68   RTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +TT DR+AACNCLKN A  VSG+N GNA S+P KCGV++PY ISTST+C+ V
Sbjct  63   KTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATV 114

Sequence Alignment: 20. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 75.1 bits 416,  Expect = 6e-16
 Identities = 62/117 52%, Positives = 85/117 72%, Gaps = 3/117 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARG-QGSGPSAGCCSG 59
            MAR+ +LA VA  +  +V+  A  +EAA+SCG V++ +APC++Y +    + P   CC+G
Sbjct  1    MARSMKLACVALVICMVVI--APMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAG 58
Query  60   VRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            V+ L  AA TT DR+AACNCLK+AA  +  LN  NAA++P KCGVSIPY ISTST+C+ V
Sbjct  59   VKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTV 118

Sequence Alignment: 21. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 74.9 bits 415,  Expect = 6e-16
 Identities = 59/106 55%, Positives = 83/106 78%, Gaps = 2/106 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS+I+PC++Y +  G+ P+A CC+G+RSLN+AA+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAA-CCNGIRSLNSAAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            DR+  CNCLK A+  + GLN   AA +P KCGV++PY ISTST+C+ V
Sbjct  69   DRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV 116

Sequence Alignment: 22. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 74.4 bits 412,  Expect = 7e-16
 Identities = 59/90 65%, Positives = 71/90 78%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S++APCI+Y R  G  P A CC+GVRSLNNAA+TTADR+AACNCLK+A   + 
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVP-ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIK 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            GLN   AA +P KCGVS+PY IS STDC  V
Sbjct  60   GLNLNLAAGLPGKCGVSVPYKISPSTDCKSV 90

Sequence Alignment: 23. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 74.4 bits 412,  Expect = 7e-16
 Identities = 57/90 63%, Positives = 73/90 81%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S++APCI Y RG G+ P A CC+G+R++NN ARTT DR+AACNCLK  +A V 
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            G+N  NAA++P KCGVSIPY IS ST+C+ V
Sbjct  60   GVNPNNAAALPGKCGVSIPYKISASTNCATV 90

Sequence Alignment: 24. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 74.1 bits 410,  Expect = 9e-16
 Identities = 55/90 61%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S++APCI Y RG G+ P A CC+G+R++NN ARTT DRR ACNCLK  +  +S
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSIS 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            G+N  NAA++P KCGV+IPY IS ST+C+ V
Sbjct  60   GVNPNNAAALPGKCGVNIPYKISASTNCATV 90

Sequence Alignment: 25. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 74.1 bits 410,  Expect = 9e-16
 Identities = 57/90 63%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+SA+APCI Y RG G+ P A CC+G+R++NN ARTT DR+AACNCLK  +A V 
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            G+N  NAA++P KCGV IPY IS ST+C+ V
Sbjct  60   GVNPNNAAALPGKCGVHIPYKISASTNCATV 90

Sequence Alignment: 26. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 74.1 bits 410,  Expect = 9e-16
 Identities = 58/90 64%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            +SCGQV SA+APCI++   +G  PS  CCSGVR L  AA+TTADR+AACNCLK AA  + 
Sbjct  1    LSCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            GLN GNAA++P +CGVSIPY ISTST+C+ +
Sbjct  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATI 90

Sequence Alignment: 27. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 74.0 bits 409,  Expect = 1e-15
 Identities = 54/90 60%, Positives = 73/90 81%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S +APCI+Y +G G+ P A CC+G+R++NN ARTTADRRAACNCLK  +  + 
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIP 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            G+N  NAA++P KCGV++PY IS ST+C+ V
Sbjct  60   GVNPNNAAALPGKCGVNVPYKISASTNCATV 90

Sequence Alignment: 28. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 73.8 bits 408,  Expect = 1e-15
 Identities = 56/109 51%, Positives = 78/109 71%, Gaps = 1/109 0%
Query  11   ATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTT 70
            A  VV  +++  A +   ++CGQV S + PC+++ +  G  P AGCC+GVR++ N+AR+T
Sbjct  7    ACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-AGCCNGVRNIMNSARST 65
Query  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120
            ADRR  CNCLK AA  V GLN  NA ++P KCGV+IPY ISTST+C+ +N
Sbjct  66   ADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN 115

Sequence Alignment: 29. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 71.7 bits 394,  Expect = 6e-15
 Identities = 56/109 51%, Positives = 79/109 72%, Gaps = 1/109 0%
Query  10   VATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART 69
            +A AV+  +++ +A    AI+CGQV + +A C++Y R  G+ P A CC+G++++ N A+T
Sbjct  7    LACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP-APCCNGIKNILNLAKT 65
Query  70   TADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            T DRR ACNCLK AAA   GLN  NA S+P KCGV+IPY ISTST+C+ +
Sbjct  66   TPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASI 115

Sequence Alignment: 30. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 71.0 bits 390,  Expect = 7e-15
 Identities = 53/90 58%, Positives = 68/90 75%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I CG+V S + PC+SY +G G GPS  CC GV++L+N AR+ +DR++ACNCLK  A G+ 
Sbjct  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
             LN  NA SIP KCGV++PYTIS + DCSRV
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 31. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 71.0 bits 390,  Expect = 1e-14
 Identities = 55/113 48%, Positives = 82/113 72%, Gaps = 1/113 0%
Query  6    QLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
            ++A +A  ++A ++  A  +EAAI+CG V + + PC++Y R  G+   A CC+GV++LNN
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA-CCNGVKALNN 63
Query  66   AARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
             A+TT DR+AAC CLK A+  +SG+  GNAAS+  KCGV++PY IS + DCS+V
Sbjct  64   DAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117

Sequence Alignment: 32. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 70.4 bits 386,  Expect = 1e-14
 Identities = 54/113 47%, Positives = 82/113 72%, Gaps = 1/113 0%
Query  6    QLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
            ++A +A  ++A ++  A  +EAAI+CG V + + PC+++ R  G+   A CC+GV++LNN
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPA-CCNGVKALNN 63
Query  66   AARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
             A+TT DR+AAC CLK A+  +SG+  GNAAS+  KCGV++PY IS + DCS+V
Sbjct  64   DAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV 117

Sequence Alignment: 33. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 69.8 bits 382,  Expect = 2e-14
 Identities = 53/90 58%, Positives = 71/90 78%, Gaps = 1/90 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQVAS++APC+SY +  G+ P  GCC+ ++SL+ AA+T ADR+AAC CLK+AA+ + 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            G+N   A+ +P KCGVSIPY IS STDCS V
Sbjct  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSV 90

Sequence Alignment: 34. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 69.9 bits 383,  Expect = 2e-14
 Identities = 54/110 49%, Positives = 72/110 65%, Gaps = 4/110 3%
Query  10   VATAVVALVLLAAATSEAAI---SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            VA AV  ++++      A +   +CGQV   +  C+ Y +G G  PS  CC GV+ LN+ 
Sbjct  6    VAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKG-GGYPSPACCGGVKGLNSL 64
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120
            A+T ADR+ AC CLK  A  V G+N G A+++P KCG+ IPY IS STDCSRVN
Sbjct  65   AKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRVN 118

Sequence Alignment: 35. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 69.8 bits 382,  Expect = 2e-14
 Identities = 51/106 48%, Positives = 78/106 73%, Gaps = 1/106 0%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            AV+  +++AA  + A+++C Q+   + PC+ Y +  G  P + CC GVR++N+A+RTT+D
Sbjct  9    AVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS-CCKGVRAVNDASRTTSD 67
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R++ACNCLK+ A G++GLN   AA +P KCGV+IPY IS ST+C+ V
Sbjct  68   RQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114

Sequence Alignment: 36. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 68.8 bits 376,  Expect = 4e-14
 Identities = 51/103 49%, Positives = 69/103 66%, Gaps = 2/103 1%
Query  15   VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRR 74
            V + ++  A    ++SCG+V S +APC+ Y  G+G  P  GCC GV+ L  AA+T  DR+
Sbjct  11   VVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRK 68
Query  75   AACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
             AC CLK+AA  + G++ G AA +P  CGV+IPY IS STDCS V
Sbjct  69   TACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113

Sequence Alignment: 37. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 68.8 bits 376,  Expect = 4e-14
 Identities = 51/103 49%, Positives = 69/103 66%, Gaps = 2/103 1%
Query  15   VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRR 74
            V + ++  A    ++SCG+V S +APC+ Y  G+G  P  GCC GV+ L  AA+T  DR+
Sbjct  11   VVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRK 68
Query  75   AACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
             AC CLK+AA  + G++ G AA +P  CGV+IPY IS STDCS V
Sbjct  69   TACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113

Sequence Alignment: 38. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 68.7 bits 375,  Expect = 5e-14
 Identities = 61/117 52%, Positives = 80/117 68%, Gaps = 7/117 5%
Query  1    MARTQQLA--VVATAVVALVLLAAATSEAAISCGQVASAIAPCISY-ARGQGSGPSAGCC 57
            MA + QL   V   AV+  + +    + AA+SCGQV + + PCI+Y A G    PS  CC
Sbjct  1    MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPS--CC 58
Query  58   SGVRSLNNAARTTADRRAACNCLKNAAAGV--SGLNAGNAASIPSKCGVSIPYTISTSTD 115
            +GVRSL + A+TTADR++ CNCLK A  G+  +  NAG AA +P KCGV+IPY IS STD
Sbjct  59   TGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTD 118
Query  116  CSRV 119
            C  +
Sbjct  119  CKTI 122

Sequence Alignment: 39. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 66.8 bits 363,  Expect = 2e-13
 Identities = 52/113 46%, Positives = 79/113 69%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I+PC+S+ +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKISPCLSFLKQGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +AA+TT DR+ ACNCLK +      L + NA  +PSKCGV+IPY IS  TDC++V
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 40. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 66.7 bits 362,  Expect = 2e-13
 Identities = 53/113 46%, Positives = 78/113 69%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I PC S+ + QG   SA CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +AA+TT DR+AACNCLK        + + NA  +PSKCGV+IPY IS  TDC++V
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 41. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 66.7 bits 362,  Expect = 2e-13
 Identities = 53/113 46%, Positives = 78/113 69%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I PC S+ + QG   SA CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +AA+TT DR+AACNCLK        + + NA  +PSKCGV+IPY IS  TDC++V
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 42. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 66.5 bits 361,  Expect = 2e-13
 Identities = 52/113 46%, Positives = 79/113 69%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I+PC S+ +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKISPCTSFLKQGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +AA+TT DR+ ACNCLK +      + + NAA +PSKCGV+IPY IS  TDC++V
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 43. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 65.6 bits 355,  Expect = 3e-13
 Identities = 53/89 59%, Positives = 68/89 76%, Gaps = 6/89 6%
Query  28   AISCGQVASAIAPCISYARGQG--SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA 85
            AI C  V  +IAPC  Y +  G  SGP   CCSG++++N  A+TT+DR+A CNCLK+AAA
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAA 57
Query  86   GV-SGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
             + S +N  NAAS+P KCGVSIPY ISTS +CS +
Sbjct  58   SLGSQINPNNAASLPGKCGVSIPYKISTSINCSSI 92

Sequence Alignment: 44. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 65.4 bits 354,  Expect = 5e-13
 Identities = 52/113 46%, Positives = 75/113 66%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+  ++ +EAA++C  V   I+PC S+    G  P   CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-TSSYAEAALTCNDVTKKISPCTSFLEKGGEVP-VDCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +AA+TT DR+AACNCLK +    + +   NAA +PSKCGV+IPY IS  TDC++V
Sbjct  62   DAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 45. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 65.1 bits 352,  Expect = 6e-13
 Identities = 51/113 45%, Positives = 75/113 66%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    +V +V+L++  +EAA++C  V++ I PC+S+ +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCVMIVCMVVLSSY-AEAALTCSDVSNKITPCLSFLKQGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +AA+T  DR+ ACNCLK        L + NA  +PSKCGV+IPY IS  TDC+ V
Sbjct  62   DAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTV 116

Sequence Alignment: 46. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 64.8 bits 350,  Expect = 7e-13
 Identities = 51/105 48%, Positives = 76/105 72%, Gaps = 2/105 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++L+++ +EA ++C  V++ I PC++Y +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R+ ACNCLK +      L +  AAS+PSKCGV+IPY IS  TDC++V
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 47. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 64.8 bits 350,  Expect = 7e-13
 Identities = 51/105 48%, Positives = 76/105 72%, Gaps = 2/105 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++L+++ +EA ++C  V++ I PC++Y +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R+ ACNCLK +      L +  AAS+PSKCGV+IPY IS  TDC++V
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 48. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 64.8 bits 350,  Expect = 7e-13
 Identities = 51/105 48%, Positives = 76/105 72%, Gaps = 2/105 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++L+++ +EA ++C  V++ I PC++Y +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R+ ACNCLK +      L +  AAS+PSKCGV+IPY IS  TDC++V
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 49. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 63.7 bits 343,  Expect = 1e-12
 Identities = 50/109 45%, Positives = 71/109 65%, Gaps = 5/109 4%
Query  11   ATAVVALVLLA----AATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            A A++ LV+LA    A  +  AI+CGQV + +APC+ +   QG  P A CCSGVR+LN  
Sbjct  3    AIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLT-QGGEPGAACCSGVRTLNGN 61
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120
             +++ DRR ACNC+K AA     L    A S+PSKCG+S+   IS + +C  ++
Sbjct  62   TQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTIS 115

Sequence Alignment: 50. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 63.2 bits 340,  Expect = 2e-12
 Identities = 48/113 42%, Positives = 76/113 67%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+  ++ +EAA++C  V++ I+PC+SY +  G  P A CC+GV+ LN
Sbjct  2    KMMKVFCVMVVCMVV-KSSYAEAALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLN 59
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +A +TT DR+ ACNCLK +      L +  A  +PSKCG+++PY +S  TDC++V
Sbjct  60   DATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 114

Sequence Alignment: 51. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 62.6 bits 336,  Expect = 3e-12
 Identities = 48/104 46%, Positives = 72/104 69%, Gaps = 2/104 1%
Query  15   VALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
            V +V +  ++S A A++C  V++ I+PC++Y +  G  P A CC+GV+ LN+AA+TT DR
Sbjct  11   VMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVP-ANCCAGVKGLNDAAKTTPDR 69
Query  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            + AC CLKN+      L +  A  +PSKCGV+IPY +S  TDC++V
Sbjct  70   QTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115

Sequence Alignment: 52. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 62.6 bits 336,  Expect = 3e-12
 Identities = 47/113 41%, Positives = 76/113 67%, Gaps = 2/113 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ + + +E+A++C  V++ I+PC+SY +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCIMVVCMVV-STSYAESALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            +A +TT DR+ ACNCLK +      L +  A  +PSKCG+++PY +S  TDC++V
Sbjct  62   DATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116

Sequence Alignment: 53. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 62.2 bits 333,  Expect = 4e-12
 Identities = 49/105 46%, Positives = 74/105 70%, Gaps = 2/105 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++++++ +EA + C  V++ I+ C+SY +  G  P A CC+GV+ LN+AA+TT D
Sbjct  9    AMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 66
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R+ ACNCLK        + +  AAS+PSKCGV+IPY IS  TDC++V
Sbjct  67   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV 113

Sequence Alignment: 54. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 62.2 bits 333,  Expect = 4e-12
 Identities = 49/105 46%, Positives = 74/105 70%, Gaps = 2/105 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++++++ +EA + C  V++ I+ C+SY +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R+ ACNCLK        + +  AAS+PSKCGV+IPY IS  TDC++V
Sbjct  69   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 55. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 62.2 bits 333,  Expect = 4e-12
 Identities = 49/105 46%, Positives = 74/105 70%, Gaps = 2/105 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++++++ +EA + C  V++ I+ C+SY +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            R+ ACNCLK        + +  AAS+PSKCGV+IPY IS  TDC++V
Sbjct  69   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 56. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 61.4 bits 328,  Expect = 6e-12
 Identities = 49/91 53%, Positives = 59/91 64%, Gaps = 1/91 1%
Query  28   AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV 87
            A+SCG V S +A CI Y       P  GCC+GV +LNN ARTT DR+ AC CL  AA   
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPK-GCCTGVTNLNNMARTTPDRQQACRCLVGAANSF 59
Query  88   SGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
              LNA  AA++P  CGV+IPY IS ST+C+ V
Sbjct  60   PSLNAARAAALPKACGVNIPYKISKSTNCNSV 91

Sequence Alignment: 57. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 55.2 bits 288,  Expect = 6e-10
 Identities = 41/112 36%, Positives = 65/112 58%, Gaps = 5/112 4%
Query  7    LAVVATAVV--ALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            L V+A A+   +   LA+A +     CG+V   I PC+ + +G+   PS  CCSG + L+
Sbjct  9    LVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLS 68
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS--IPYTISTSTDCSRV 119
               +TT  +R AC C+  A  G+SG+     A +P KCG++  +P  I+   DCS++
Sbjct  69   EEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKI 124

Sequence Alignment: 58. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 53.1 bits 275,  Expect = 2e-09
 Identities = 39/108 36%, Positives = 62/108 57%, Gaps = 4/108 3%
Query  10   VATAVVALVLLAA--ATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAA 67
            +  A++A++++A        AI+C  V   + PC+ Y R  G  P+  CC+G + L  A 
Sbjct  6    MGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGK-PTPACCAGAKKLLGAT 64
Query  68   RTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119
            RT ADRR AC C K AA  +  +    A+S+P KCG+S    I+ + +C+ +
Sbjct  65   RTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 52.5 bits 271,  Expect = 4e-09
 Identities = 40/116 34%, Positives = 64/116 55%, Gaps = 8/116 6%
Query  3    RTQQLAVVATAVVALVLLAAATSEAAIS-----CGQVASAIAPCISYARGQGSGPSAGCC 57
            RT  +A +     AL   ++A    A +     CG+V   I PC+ + +G+   PS  CC
Sbjct  2    RTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECC 61
Query  58   SGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV--SIPYTISTSTD 115
            SG + L+   +TT  +R AC C+  A  G+SG+     A +P KC +  ++P  I+   D
Sbjct  62   SGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFD 120
Query  116  CSRV 119
            CS++
Sbjct  121  CSKI 124

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 46.9 bits 235,  Expect = 2e-07
 Identities = 40/107 37%, Positives = 63/107 58%, Gaps = 18/107 16%
Query  9    VVATAVVALVLLAAA----TSEAAI----------SCGQVASAIAPCISYARGQGSGPSA 54
            V A + VALV++ AA    TS A++          +CG V  A+ PC+ + +G+   PS 
Sbjct  4    VSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSK 63
Query  55   GCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTIS 111
            GCCSG + L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I 
Sbjct  64   GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PID 122
Query  112  TSTDC 116
             + DC
Sbjct  123  VNMDC 127

Sequence Alignment: 61. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 46.4 bits 232,  Expect = 2e-07
 Identities = 37/108 34%, Positives = 62/108 57%, Gaps = 6/108 5%
Query  9    VVATAVVALVLLAAATSEAAIS--CGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            ++ +  V L+L++   +  A S  C  V + +APC  +  GQ   PS  CC+GV +LNN+
Sbjct  6    ILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQE--PSKACCTGVNNLNNS 63
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPY-TISTSTDCSRV 119
             +T ADR A CNC+K     ++  +      + +KCGV   +  +  + DCS++
Sbjct  64   RKTKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 46.6 bits 233,  Expect = 3e-07
 Identities = 36/109 33%, Positives = 57/109 52%, Gaps = 9/109 8%
Query  7    LAVVATAVVALVLLAAATSEAAI-----SCGQVASAIAPCISYARGQGSGPSAGCCSGVR 61
            L V+  A +A   LA+    A       +CG V  A+ PC+ + +G+   PS GCCSG +
Sbjct  12   LVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAK 71
Query  62   SLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTISTSTDC 116
             L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I  + DC
Sbjct  72   RLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128

Sequence Alignment: 63. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 45.5 bits 226,  Expect = 5e-07
 Identities = 29/89 32%, Positives = 48/89 53%, Gaps = 4/89 4%
Query  30   SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 89
            +CG +  A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S 
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  90   LNAGNAASIPSKCGV---SIPYTISTSTDCSRV 119
            ++    + +P  CG+    +P  I  + DC  V
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 64. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 44.9 bits 222,  Expect = 8e-07
 Identities = 28/86 32%, Positives = 47/86 54%, Gaps = 4/86 4%
Query  30   SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 89
            +CG +  A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S 
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  90   LNAGNAASIPSKCGV---SIPYTISTSTDC 116
            ++    + +P  CG+    +P  I  + DC
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 42.1 bits 204,  Expect = 6e-06
 Identities = 27/82 32%, Positives = 44/82 53%, Gaps = 4/82 4%
Query  37   AIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA 96
            A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S ++    +
Sbjct  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
Query  97   SIPSKCGV---SIPYTISTSTDCSRV 119
             +P  CG+    +P  I  + DC  V
Sbjct  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 66. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 30.7 bits 132,  Expect = 0.004
 Identities = 15/29 51%, Positives = 22/29 75%, Gaps = 0/29 0%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCC 57
            ++CGQVASA++PCI Y +  G+ P+  CC
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCC 30

Sequence Alignment: 67. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 30.6 bits 131,  Expect = 0.005
 Identities = 17/37 45%, Positives = 27/37 72%, Gaps = 1/37 2%
Query  28   AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
            A++C  V++ I+PC+SY +  G  P A CC+GV+ LN+
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVP-ADCCAGVKGLND 37

Sequence Alignment: 68. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 29.5 bits 124,  Expect = 0.009
 Identities = 14/34 41%, Positives = 23/34 67%, Gaps = 1/34 2%
Query  28   AISCGQVASAIAPCISYARGQGSGPSAG-CCSGVR 61
            +I+C QV+ ++ PC++Y +  G  P  G CC GV+
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.