The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV
RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYS
RRMHASAD
Sequence Info Allergen Name Length Opt Bits Score E Value
P19656-2 Zea m 14.0102 128 822 137.4 1.2e-34
P19656-1 Zea m 14.0101 120 755 127.0 1.4e-31
CAH69206 Tri tu 14.0101 115 513 89.7 2.4e-20
A0A059SSZ0 Pun g 1.0201 120 462 81.8 5.9e-18
CAA42832 Hor v 1 134 443 78.9 5e-17
A0A059STC4 Pun g 1.0101 120 441 78.6 5.6e-17
ADC80503 Pha v 3.0201 118 434 77.5 1.2e-16
AAA32970 Hor v 1 117 430 76.9 1.8e-16
Q9M5X8 Pru av 3 117 426 76.2 2.7e-16
Q9M5X7 Mal d 3 115 425 76.1 3e-16
Q8VX12 Fra a 3.0101 117 425 76.1 3e-16
AAL25839 Hev b 12 116 423 75.8 3.7e-16
Q4PLU0 Fra a 3.0201 117 421 75.5 4.7e-16
ABX56711 Ara h 9.0101 116 420 75.3 5.2e-16
Q4PLT9 Fra a 3.0102 117 419 75.2 5.8e-16
A0AT29 Len c 3.0101 118 419 75.2 5.8e-16
A0A059ST23 Pun g 1.0301 120 419 75.2 5.9e-16
Q0Z8V0 Rub i 3.0101 117 418 75.0 6.4e-16
Q9M5X6 Pyr c 3 115 416 74.7 7.8e-16
Q4PLT6 Fra a 3.0202 117 412 74.1 1.2e-15
A0A161AT60 Pis s 3.0101 120 412 74.1 1.3e-15
P85894 Mor n 3.0101 91 408 73.4 1.5e-15
CAB96876 Pru p 3 91 408 73.4 1.5e-15
ABX75045 Ara h 9.0201 92 407 73.3 1.7e-15
P81651 Pru ar 3 91 406 73.1 1.8e-15
P81402 Pru p 3 91 406 73.1 1.8e-15
P82534 Pru d 3 91 405 73.0 2e-15
ADC80502 Pha v 3.0101 115 398 71.9 5.4e-15
XP_019446786 Lup an 3.0101 116 391 70.8 1.1e-14
19846220 Tri a 14.0101 90 385 69.9 1.7e-14
ABY21307 Pla or 3.0101 118 385 69.9 2.2e-14
CAL07989 Pla a 3.0101 118 381 69.3 3.4e-14
W0U0V5 Can s 3.0101 91 378 68.8 3.7e-14
AAK28533 Cor a 8 115 378 68.8 4.6e-14
P93224 Sola l 3.0101 114 372 67.9 8.6e-14
AAB42069 Lyc e 3 114 372 67.9 8.6e-14
ACN11576 Pru du 3.0101 123 372 67.9 9.3e-14
ACV04796 Api g 2 118 371 67.7 9.9e-14
ANC85023 Art gm 3.0102 117 358 65.7 4e-13
ANC85021 Art ca 3.0101 117 357 65.6 4.4e-13
ANC85017 Art an 3.0101 117 357 65.6 4.4e-13
ANC85022 Art gm 3.0101 117 356 65.4 4.9e-13
A0A510A9S3 Ara h 17.0101 93 352 64.8 6.1e-13
ANC85018 Art an 3.0102 117 349 64.4 1e-12
QIN55516 Art ca 3.0102 117 348 64.2 1.2e-12
ANC85027 Art si 3.0102 116 345 63.7 1.6e-12
ACE07187 Art v 3.0202 116 345 63.7 1.6e-12
ANC85020 Art ar 3.0102 116 345 63.7 1.6e-12
NP_001316123 Sola l 7.0101 115 342 63.3 2.2e-12
ANC85025 Art la 3.0102 115 335 62.2 4.6e-12
ANC85026 Art si 3.0101 116 331 61.6 7.1e-12
EU564847 Art v 3.0301 117 331 61.6 7.1e-12
EU564845 Art v 3.0201 114 328 61.1 9.6e-12
ANC85019 Art ar 3.0101 116 328 61.1 9.7e-12
ANC85024 Art la 3.0101 116 328 61.1 9.7e-12
ABU95411 Sin a 3.0101 92 324 60.5 1.2e-11
O04403 Par j 2 133 284 54.3 1.2e-09
P82007 Hel a 3.0101 116 272 52.5 3.9e-09
P55958 Par j 2 133 267 51.7 7.6e-09
Q40905 Par j 1 138 235 46.8 2.4e-07
O04004 Amb a 6 118 231 46.1 3.2e-07
O04404 Par j 1 176 233 46.5 3.8e-07
CAI94601 Par j 1.0103 139 222 44.8 9.7e-07
P43217 Par j 1 139 222 44.8 9.7e-07
CAA54587 Par j 1.0101 133 200 41.4 9.8e-06
P80274 Vit v 1 37 132 30.8 0.0043
P0C088 Art v 3.0101 37 131 30.6 0.0047
10998016 Cas s 8 36 124 29.5 0.0098
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 137.4 bits 822,  Expect = 1e-34
 Identities = 128/128 100%, Positives = 128/128 100%, Gaps = 0/128 0%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYS 120
            RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYS
Sbjct  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYS 120
Query  121  RRMHASAD 128
            RRMHASAD
Sbjct  121  RRMHASAD 128

Sequence Alignment: 2. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 127.0 bits 755,  Expect = 1e-31
 Identities = 118/118 100%, Positives = 118/118 100%, Gaps = 0/118 0%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV
Sbjct  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR
Sbjct  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118

Sequence Alignment: 3. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 89.7 bits 513,  Expect = 2e-20
 Identities = 77/113 68%, Positives = 96/113 84%, Gaps = 5/113 4%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR+    VV  AVVA +LLA   +EAA+SCGQV+SA++PCISYARG G+ PSA CCSGV
Sbjct  1    MARSAVAQVVLVAVVAAMLLA--VTEAAVSCGQVSSALSPCISYARGNGASPSAACCSGV 58
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            RSL ++AR+TAD++AAC C+K+AAA   GLNAG AA IP+KCGVS+PY IS+S DCS+
Sbjct  59   RSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKCGVSVPYAISSSVDCSK 113

Sequence Alignment: 4. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 81.8 bits 462,  Expect = 6e-18
 Identities = 66/118 55%, Positives = 86/118 72%, Gaps = 0/118 0%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MA  + L  +  A+   +++AA+  E+A++CGQV S++ PCI YARG  + PSA CCSGV
Sbjct  1    MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGV 60
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            RSLNNAA+TT DR+ ACNCLK  A  ++G+N G   ++P KCGVSIPY IS STDCSR
Sbjct  61   RSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSR 118

Sequence Alignment: 5. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 78.9 bits 443,  Expect = 5e-17
 Identities = 65/119 54%, Positives = 87/119 73%, Gaps = 3/119 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR Q L ++A A+V L+L AA  +  A++CGQV S + PC++Y +G G GPS  CC+GV
Sbjct  1    MARAQVL-LMAAALV-LMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPGPSGECCNGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYS 120
            R L+N A+++ DR+  CNCLK  A G+  LN  NAASIPSKC V++PYTIS   DCSR++
Sbjct  58   RDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRFT 117
Query  121  RR 122
             R
Sbjct  118  ER 119

Sequence Alignment: 6. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 78.6 bits 441,  Expect = 6e-17
 Identities = 62/109 56%, Positives = 83/109 76%, Gaps = 1/109 0%
Query  10   VATAVVALVLLAAA-TSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAAR 68
            +A AV A+ L+AA   +EAA++CGQVAS++APCI YAR  G      CCSG+++L+  AR
Sbjct  9    LACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMAR 68
Query  69   TTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            TT DR+A C CLK+A+  +SG+N G  AS+P+KCGV+IPY IS STDC+R
Sbjct  69   TTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCAR 118

Sequence Alignment: 7. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 77.5 bits 434,  Expect = 1e-16
 Identities = 69/114 60%, Positives = 83/114 72%, Gaps = 3/114 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MA      VV  AV+ LV+L A T+ AAISCGQV S++A CI +    G  P A CCSGV
Sbjct  1    MATLNSACVV--AVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP-ASCCSGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            RSLN AA+TT DR+A CNCLK+AA  + G+NA NA  +P KCGVSIPY ISTST+C+
Sbjct  58   RSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCA 114

Sequence Alignment: 8. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 76.9 bits 430,  Expect = 2e-16
 Identities = 64/115 55%, Positives = 84/115 73%, Gaps = 3/115 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR Q L ++A A+V L+L AA  +  A++CGQV S + PC++Y +G G GPS  CC+GV
Sbjct  1    MARAQVL-LMAAALV-LMLTAAPRAAVALNCGQVDSKMKPCLTYVQG-GPGPSGECCNGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R L+N A+++ DR+  CNCLK  A G+  LN  NAASIPSKC V++PYTIS   DCSR
Sbjct  58   RDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSR 115

Sequence Alignment: 9. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 76.2 bits 426,  Expect = 3e-16
 Identities = 58/103 56%, Positives = 81/103 78%, Gaps = 1/103 0%
Query  14   VVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
            VVAL ++ +     A++CGQV+S +APCI+Y RG G+ P A CC+G+R++NN A+TTADR
Sbjct  12   VVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADR 70
Query  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            + ACNCLK  +A V G+NA NAA++P KCGV++PY IS ST+C+
Sbjct  71   QTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCA 114

Sequence Alignment: 10. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 76.1 bits 425,  Expect = 3e-16
 Identities = 60/108 55%, Positives = 81/108 75%, Gaps = 2/108 1%
Query  8    AVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAA 67
            AV   A+V  + +A + + A I+CGQV S++APCI Y R  G+ P A CC+G+R++N  A
Sbjct  5    AVTKLALVVALCMAVSVAHA-ITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLA 62
Query  68   RTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            RTTADR+ ACNCLKN A  +SG+N  NAA +P KCGV++PY ISTST+C+
Sbjct  63   RTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCA 112

Sequence Alignment: 11. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 76.1 bits 425,  Expect = 3e-16
 Identities = 61/104 58%, Positives = 82/104 78%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS I+PC++Y +  G+ P+A CCSG+R+LN  A+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVPAA-CCSGIRNLNGMAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            DR+AACNCLK AA G+ GLN   AA +P KCGVS+PY IST+T+C+
Sbjct  69   DRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCA 114

Sequence Alignment: 12. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 75.8 bits 423,  Expect = 4e-16
 Identities = 59/104 56%, Positives = 76/104 73%, Gaps = 0/104 0%
Query  14   VVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
            +V  +L+AA  +  AI+CGQV SA+ PC+SY +  G  P A CC+GVR++NNAA+TTADR
Sbjct  10   LVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADR 69
Query  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            R AC CLK+AA  V GLN    A +P KCGV+IPY IS ST+C+
Sbjct  70   RTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCA 113

Sequence Alignment: 13. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 75.5 bits 421,  Expect = 5e-16
 Identities = 60/104 57%, Positives = 83/104 79%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS+I+PC++Y +  G+ P+A CC+G+RSLN+AA+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAA-CCNGIRSLNSAAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            DR+A CNCLK A+  + GLN   AA +P KCGVS+PY ISTST+C+
Sbjct  69   DRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCA 114

Sequence Alignment: 14. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 75.3 bits 420,  Expect = 5e-16
 Identities = 66/110 60%, Positives = 79/110 71%, Gaps = 3/110 2%
Query  7    LAVVATAVVALVLLA--AATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            +A +  A V LV +A   A    AISCGQV SA+APCI +   +G  P   CCSGVR L 
Sbjct  1    MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLT-KGGAPPPACCSGVRGLL 59
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
             A RTTADR+AACNCLK AA  + GLN GNAA++P +CGVSIPY ISTST+C+
Sbjct  60   GALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCA 112

Sequence Alignment: 15. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 75.2 bits 419,  Expect = 6e-16
 Identities = 60/104 57%, Positives = 80/104 76%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS I+PC++Y +  G+ P A CCSG+R+LN  A+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVP-APCCSGIRNLNGMAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            DR+A CNCLK AA G+ GLN   AA +P KCGVS+PY IST+T+C+
Sbjct  69   DRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCA 114

Sequence Alignment: 16. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 75.2 bits 419,  Expect = 6e-16
 Identities = 62/114 54%, Positives = 82/114 71%, Gaps = 3/114 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
            MAR  +LA V   +  +V+  A  +E AISCG V S ++PC++Y  G G GPS  CC GV
Sbjct  1    MARGMKLACVVLVICMVVI--APMAEGAISCGAVTSDLSPCLTYLTG-GPGPSPQCCGGV 57
Query  61   RSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            + L  AA TT DR+AACNCLK+AA  ++ LN  NAA++P KCGV+IPY IST+T+C+
Sbjct  58   KKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCN 114

Sequence Alignment: 17. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 75.2 bits 419,  Expect = 6e-16
 Identities = 61/115 53%, Positives = 84/115 73%, Gaps = 2/115 1%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGP-SAGCCSG 59
            MA +  L +    +V + + A+  +EA I+CGQV+S++A CI YARG G+GP    CC+G
Sbjct  1    MASSGFLRLAGFVLVCMAV-ASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNG 59
Query  60   VRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDC 116
            +RSLN+AA+TT DR+AAC CLK+ A+ +SG+N G  A  P KCGVSIPY I+ ST+C
Sbjct  60   IRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNC 116

Sequence Alignment: 18. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 75.0 bits 418,  Expect = 6e-16
 Identities = 61/109 55%, Positives = 81/109 74%, Gaps = 2/109 1%
Query  8    AVVATAVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            AV+  A+VAL+ +  A   A AI+CGQV   +APC +Y +  G+ P+A CC+GVR+LN+ 
Sbjct  5    AVMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVPAA-CCNGVRNLNSQ 63
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            A+TTADR+  CNCLKNAA  + GLN   AA +P KCGVS+PY ISTST+C+
Sbjct  64   AKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCA 114

Sequence Alignment: 19. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 74.7 bits 416,  Expect = 8e-16
 Identities = 58/108 53%, Positives = 83/108 76%, Gaps = 2/108 1%
Query  8    AVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAA 67
            AV+  A+V  + +A + + A I+C QV++ +APCI+Y R  G+ P A CC+G++++N  A
Sbjct  5    AVIKLALVVALCMAVSVAHA-ITCSQVSANLAPCINYVRSGGAVPPA-CCNGIKTINGLA 62
Query  68   RTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            +TT DR+AACNCLKN A  VSG+N GNA S+P KCGV++PY ISTST+C+
Sbjct  63   KTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCA 112

Sequence Alignment: 20. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 74.1 bits 412,  Expect = 1e-15
 Identities = 58/104 55%, Positives = 82/104 78%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTA 71
            ++VAL+ +  A   A AI+CGQVAS+I+PC++Y +  G+ P+A CC+G+RSLN+AA+TTA
Sbjct  10   SLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAA-CCNGIRSLNSAAKTTA 68
Query  72   DRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            DR+  CNCLK A+  + GLN   AA +P KCGV++PY ISTST+C+
Sbjct  69   DRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCA 114

Sequence Alignment: 21. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 74.1 bits 412,  Expect = 1e-15
 Identities = 61/115 53%, Positives = 84/115 73%, Gaps = 3/115 2%
Query  1    MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARG-QGSGPSAGCCSG 59
            MAR+ +LA VA  +  +V+  A  +EAA+SCG V++ +APC++Y +    + P   CC+G
Sbjct  1    MARSMKLACVALVICMVVI--APMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAG 58
Query  60   VRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            V+ L  AA TT DR+AACNCLK+AA  +  LN  NAA++P KCGVSIPY ISTST+C+
Sbjct  59   VKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCN 116

Sequence Alignment: 22. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 73.4 bits 408,  Expect = 1e-15
 Identities = 58/87 66%, Positives = 70/87 80%, Gaps = 1/87 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S++APCI+Y R  G  P A CC+GVRSLNNAA+TTADR+AACNCLK+A   + 
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVP-ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIK 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDC 116
            GLN   AA +P KCGVS+PY IS STDC
Sbjct  60   GLNLNLAAGLPGKCGVSVPYKISPSTDC 87

Sequence Alignment: 23. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 73.4 bits 408,  Expect = 1e-15
 Identities = 56/88 63%, Positives = 72/88 81%, Gaps = 1/88 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S++APCI Y RG G+ P A CC+G+R++NN ARTT DR+AACNCLK  +A V 
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            G+N  NAA++P KCGVSIPY IS ST+C+
Sbjct  60   GVNPNNAAALPGKCGVSIPYKISASTNCA 88

Sequence Alignment: 24. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 73.3 bits 407,  Expect = 2e-15
 Identities = 58/88 65%, Positives = 71/88 80%, Gaps = 1/88 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            +SCGQV SA+APCI++   +G  PS  CCSGVR L  AA+TTADR+AACNCLK AA  + 
Sbjct  1    LSCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            GLN GNAA++P +CGVSIPY ISTST+C+
Sbjct  60   GLNQGNAAALPGRCGVSIPYKISTSTNCA 88

Sequence Alignment: 25. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 73.1 bits 406,  Expect = 2e-15
 Identities = 54/88 61%, Positives = 71/88 80%, Gaps = 1/88 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S++APCI Y RG G+ P A CC+G+R++NN ARTT DRR ACNCLK  +  +S
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSIS 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            G+N  NAA++P KCGV+IPY IS ST+C+
Sbjct  60   GVNPNNAAALPGKCGVNIPYKISASTNCA 88

Sequence Alignment: 26. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 73.1 bits 406,  Expect = 2e-15
 Identities = 56/88 63%, Positives = 71/88 80%, Gaps = 1/88 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+SA+APCI Y RG G+ P A CC+G+R++NN ARTT DR+AACNCLK  +A V 
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            G+N  NAA++P KCGV IPY IS ST+C+
Sbjct  60   GVNPNNAAALPGKCGVHIPYKISASTNCA 88

Sequence Alignment: 27. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 73.0 bits 405,  Expect = 2e-15
 Identities = 53/88 60%, Positives = 72/88 81%, Gaps = 1/88 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQV+S +APCI+Y +G G+ P A CC+G+R++NN ARTTADRRAACNCLK  +  + 
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIP 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            G+N  NAA++P KCGV++PY IS ST+C+
Sbjct  60   GVNPNNAAALPGKCGVNVPYKISASTNCA 88

Sequence Alignment: 28. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 71.9 bits 398,  Expect = 5e-15
 Identities = 55/106 51%, Positives = 76/106 71%, Gaps = 1/106 0%
Query  11   ATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTT 70
            A  VV  +++  A +   ++CGQV S + PC+++ +  G  P AGCC+GVR++ N+AR+T
Sbjct  7    ACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-AGCCNGVRNIMNSARST 65
Query  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            ADRR  CNCLK AA  V GLN  NA ++P KCGV+IPY ISTST+C+
Sbjct  66   ADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCA 112

Sequence Alignment: 29. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 70.8 bits 391,  Expect = 1e-14
 Identities = 56/107 52%, Positives = 78/107 72%, Gaps = 1/107 0%
Query  10   VATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART 69
            +A AV+  +++ +A    AI+CGQV + +A C++Y R  G+ P A CC+G++++ N A+T
Sbjct  7    LACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVP-APCCNGIKNILNLAKT 65
Query  70   TADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            T DRR ACNCLK AAA   GLN  NA S+P KCGV+IPY ISTST+C+
Sbjct  66   TPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCA 113

Sequence Alignment: 30. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 69.9 bits 385,  Expect = 2e-14
 Identities = 52/89 58%, Positives = 67/89 75%, Gaps = 1/89 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I CG+V S + PC+SY +G G GPS  CC GV++L+N AR+ +DR++ACNCLK  A G+ 
Sbjct  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
             LN  NA SIP KCGV++PYTIS + DCSR
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSR 89

Sequence Alignment: 31. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 69.9 bits 385,  Expect = 2e-14
 Identities = 54/112 48%, Positives = 81/112 72%, Gaps = 1/112 0%
Query  6    QLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
            ++A +A  ++A ++  A  +EAAI+CG V + + PC++Y R  G+   A CC+GV++LNN
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPA-CCNGVKALNN 63
Query  66   AARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
             A+TT DR+AAC CLK A+  +SG+  GNAAS+  KCGV++PY IS + DCS+
Sbjct  64   DAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSK 116

Sequence Alignment: 32. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 69.3 bits 381,  Expect = 3e-14
 Identities = 53/112 47%, Positives = 81/112 72%, Gaps = 1/112 0%
Query  6    QLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
            ++A +A  ++A ++  A  +EAAI+CG V + + PC+++ R  G+   A CC+GV++LNN
Sbjct  5    RVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPA-CCNGVKALNN 63
Query  66   AARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
             A+TT DR+AAC CLK A+  +SG+  GNAAS+  KCGV++PY IS + DCS+
Sbjct  64   DAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSK 116

Sequence Alignment: 33. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 68.8 bits 378,  Expect = 4e-14
 Identities = 52/88 59%, Positives = 70/88 79%, Gaps = 1/88 1%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
            I+CGQVAS++APC+SY +  G+ P  GCC+ ++SL+ AA+T ADR+AAC CLK+AA+ + 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
Query  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            G+N   A+ +P KCGVSIPY IS STDCS
Sbjct  60   GVNFNLASGLPGKCGVSIPYKISPSTDCS 88

Sequence Alignment: 34. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 68.8 bits 378,  Expect = 5e-14
 Identities = 50/104 48%, Positives = 77/104 74%, Gaps = 1/104 0%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            AV+  +++AA  + A+++C Q+   + PC+ Y +  G  P + CC GVR++N+A+RTT+D
Sbjct  9    AVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS-CCKGVRAVNDASRTTSD 67
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            R++ACNCLK+ A G++GLN   AA +P KCGV+IPY IS ST+C+
Sbjct  68   RQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCN 112

Sequence Alignment: 35. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 67.9 bits 372,  Expect = 9e-14
 Identities = 50/101 49%, Positives = 68/101 67%, Gaps = 2/101 1%
Query  15   VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRR 74
            V + ++  A    ++SCG+V S +APC+ Y  G+  GP  GCC GV+ L  AA+T  DR+
Sbjct  11   VVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRK 68
Query  75   AACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
             AC CLK+AA  + G++ G AA +P  CGV+IPY IS STDCS
Sbjct  69   TACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCS 111

Sequence Alignment: 36. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 67.9 bits 372,  Expect = 9e-14
 Identities = 50/101 49%, Positives = 68/101 67%, Gaps = 2/101 1%
Query  15   VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRR 74
            V + ++  A    ++SCG+V S +APC+ Y  G+  GP  GCC GV+ L  AA+T  DR+
Sbjct  11   VVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGR--GPLGGCCGGVKGLLGAAKTPEDRK 68
Query  75   AACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
             AC CLK+AA  + G++ G AA +P  CGV+IPY IS STDCS
Sbjct  69   TACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCS 111

Sequence Alignment: 37. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 67.9 bits 372,  Expect = 9e-14
 Identities = 61/114 53%, Positives = 79/114 69%, Gaps = 7/114 6%
Query  1    MARTQQLA--VVATAVVALVLLAAATSEAAISCGQVASAIAPCISY-ARGQGSGPSAGCC 57
            MA + QL   V   AV+  + +    + AA+SCGQV + + PCI+Y A G    PS  CC
Sbjct  1    MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPS--CC 58
Query  58   SGVRSLNNAARTTADRRAACNCLKNAAAGV--SGLNAGNAASIPSKCGVSIPYTISTSTD 115
            +GVRSL + A+TTADR++ CNCLK A  G+  +  NAG AA +P KCGV+IPY IS STD
Sbjct  59   TGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTD 118
Query  116  C 116
            C
Sbjct  119  C 119

Sequence Alignment: 38. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 67.7 bits 371,  Expect = 1e-13
 Identities = 52/108 48%, Positives = 70/108 64%, Gaps = 4/108 3%
Query  10   VATAVVALVLLAAATSEAAI---SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            VA AV  ++++      A +   +CGQV   +  C+ Y +G G  PS  CC GV+ LN+ 
Sbjct  6    VAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKG-GGYPSPACCGGVKGLNSL 64
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            A+T ADR+ AC CLK  A  V G+N G A+++P KCG+ IPY IS STDCSR
Sbjct  65   AKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSR 116

Sequence Alignment: 39. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 65.7 bits 358,  Expect = 4e-13
 Identities = 51/112 45%, Positives = 78/112 69%, Gaps = 2/112 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I+PC+S+ +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKISPCLSFLKQGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            +AA+TT DR+ ACNCLK +      L + NA  +PSKCGV+IPY IS  TDC++
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNK 115

Sequence Alignment: 40. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 65.6 bits 357,  Expect = 4e-13
 Identities = 52/112 46%, Positives = 77/112 68%, Gaps = 2/112 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I PC S+ + QG   SA CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            +AA+TT DR+AACNCLK        + + NA  +PSKCGV+IPY IS  TDC++
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNK 115

Sequence Alignment: 41. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 65.6 bits 357,  Expect = 4e-13
 Identities = 52/112 46%, Positives = 77/112 68%, Gaps = 2/112 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I PC S+ + QG   SA CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKILPCTSFLK-QGGEVSADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            +AA+TT DR+AACNCLK        + + NA  +PSKCGV+IPY IS  TDC++
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNK 115

Sequence Alignment: 42. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 65.4 bits 356,  Expect = 5e-13
 Identities = 51/112 45%, Positives = 78/112 69%, Gaps = 2/112 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ +++ +EAA++C  V++ I+PC S+ +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-SSSYAEAALTCSDVSNKISPCTSFLKQGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            +AA+TT DR+ ACNCLK +      + + NAA +PSKCGV+IPY IS  TDC++
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNK 115

Sequence Alignment: 43. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 64.8 bits 352,  Expect = 6e-13
 Identities = 53/87 60%, Positives = 67/87 77%, Gaps = 6/87 6%
Query  28   AISCGQVASAIAPCISYARGQG--SGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA 85
            AI C  V  +IAPC  Y +  G  SGP   CCSG++++N  A+TT+DR+A CNCLK+AAA
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAA 57
Query  86   GV-SGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
             + S +N  NAAS+P KCGVSIPY ISTS +CS
Sbjct  58   SLGSQINPNNAASLPGKCGVSIPYKISTSINCS 90

Sequence Alignment: 44. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 64.4 bits 349,  Expect = 1e-12
 Identities = 51/112 45%, Positives = 74/112 66%, Gaps = 2/112 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+  ++ +EAA++C  V   I+PC S+    G  P   CC+GV+ LN
Sbjct  4    KMMKVFCVMVVCMVV-TSSYAEAALTCNDVTKKISPCTSFLEKGGEVP-VDCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            +AA+TT DR+AACNCLK +    + +   NAA +PSKCGV+IPY IS  TDC++
Sbjct  62   DAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNK 115

Sequence Alignment: 45. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 64.2 bits 348,  Expect = 1e-12
 Identities = 50/111 45%, Positives = 74/111 66%, Gaps = 2/111 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    +V +V+L++  +EAA++C  V++ I PC+S+ +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCVMIVCMVVLSSY-AEAALTCSDVSNKITPCLSFLKQGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            +AA+T  DR+ ACNCLK        L + NA  +PSKCGV+IPY IS  TDC+
Sbjct  62   DAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCN 114

Sequence Alignment: 46. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 63.7 bits 345,  Expect = 2e-12
 Identities = 50/104 48%, Positives = 75/104 72%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++L+++ +EA ++C  V++ I PC++Y +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R+ ACNCLK +      L +  AAS+PSKCGV+IPY IS  TDC++
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNK 114

Sequence Alignment: 47. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 63.7 bits 345,  Expect = 2e-12
 Identities = 50/104 48%, Positives = 75/104 72%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++L+++ +EA ++C  V++ I PC++Y +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R+ ACNCLK +      L +  AAS+PSKCGV+IPY IS  TDC++
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNK 114

Sequence Alignment: 48. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 63.7 bits 345,  Expect = 2e-12
 Identities = 50/104 48%, Positives = 75/104 72%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++L+++ +EA ++C  V++ I PC++Y +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R+ ACNCLK +      L +  AAS+PSKCGV+IPY IS  TDC++
Sbjct  69   RQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNK 114

Sequence Alignment: 49. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 63.3 bits 342,  Expect = 2e-12
 Identities = 51/109 46%, Positives = 70/109 64%, Gaps = 5/109 4%
Query  11   ATAVVALVLLA----AATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            A A++ LV+LA    A  +  AI+CGQV + +APC+ +   QG  P A CCSGVR+LN  
Sbjct  3    AIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLT-QGGEPGAACCSGVRTLNGN 61
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYS 120
             +++ DRR ACNC+K AA     L    A S+PSKCG+S+   IS + +C   S
Sbjct  62   TQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTIS 115

Sequence Alignment: 50. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 62.2 bits 335,  Expect = 5e-12
 Identities = 47/112 41%, Positives = 75/112 66%, Gaps = 2/112 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+  ++ +EAA++C  V++ I+PC+SY +  G  P A CC+GV+ LN
Sbjct  2    KMMKVFCVMVVCMVV-KSSYAEAALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLN 59
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            +A +TT DR+ ACNCLK +      L +  A  +PSKCG+++PY +S  TDC++
Sbjct  60   DATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNK 113

Sequence Alignment: 51. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 61.6 bits 331,  Expect = 7e-12
 Identities = 47/103 45%, Positives = 71/103 68%, Gaps = 2/103 1%
Query  15   VALVLLAAATSEA-AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADR 73
            V +V +  ++S A A++C  V++ I+PC++Y +  G  P A CC+GV+ LN+AA+TT DR
Sbjct  11   VMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVP-ANCCAGVKGLNDAAKTTPDR 69
Query  74   RAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            + AC CLKN+      L +  A  +PSKCGV+IPY +S  TDC++
Sbjct  70   QTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNK 114

Sequence Alignment: 52. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 61.6 bits 331,  Expect = 7e-12
 Identities = 46/112 41%, Positives = 75/112 66%, Gaps = 2/112 1%
Query  5    QQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            + + V    VV +V+ + + +E+A++C  V++ I+PC+SY +  G  P A CC+GV+ LN
Sbjct  4    KMMKVFCIMVVCMVV-STSYAESALTCSDVSTKISPCLSYLKKGGEVP-ADCCTGVKGLN 61
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            +A +TT DR+ ACNCLK +      L +  A  +PSKCG+++PY +S  TDC++
Sbjct  62   DATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNK 115

Sequence Alignment: 53. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 61.1 bits 328,  Expect = 1e-11
 Identities = 48/104 46%, Positives = 73/104 70%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++++++ +EA + C  V++ I+ C+SY +  G  P A CC+GV+ LN+AA+TT D
Sbjct  9    AMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 66
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R+ ACNCLK        + +  AAS+PSKCGV+IPY IS  TDC++
Sbjct  67   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNK 112

Sequence Alignment: 54. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 61.1 bits 328,  Expect = 1e-11
 Identities = 48/104 46%, Positives = 73/104 70%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++++++ +EA + C  V++ I+ C+SY +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R+ ACNCLK        + +  AAS+PSKCGV+IPY IS  TDC++
Sbjct  69   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNK 114

Sequence Alignment: 55. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 61.1 bits 328,  Expect = 1e-11
 Identities = 48/104 46%, Positives = 73/104 70%, Gaps = 2/104 1%
Query  13   AVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAD 72
            A+V  ++++++ +EA + C  V++ I+ C+SY +  G  P A CC+GV+ LN+AA+TT D
Sbjct  11   AMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEVP-ADCCTGVKGLNDAAKTTPD 68
Query  73   RRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR 118
            R+ ACNCLK        + +  AAS+PSKCGV+IPY IS  TDC++
Sbjct  69   RQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNK 114

Sequence Alignment: 56. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 60.5 bits 324,  Expect = 1e-11
 Identities = 48/89 53%, Positives = 58/89 65%, Gaps = 1/89 1%
Query  28   AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV 87
            A+SCG V S +A CI Y       P  GCC+GV +LNN ARTT DR+ AC CL  AA   
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPK-GCCTGVTNLNNMARTTPDRQQACRCLVGAANSF 59
Query  88   SGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
              LNA  AA++P  CGV+IPY IS ST+C+
Sbjct  60   PSLNAARAAALPKACGVNIPYKISKSTNCN 89

Sequence Alignment: 57. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 54.3 bits 284,  Expect = 1e-09
 Identities = 41/111 36%, Positives = 64/111 57%, Gaps = 5/111 4%
Query  7    LAVVATAVV--ALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLN 64
            L V+A A+   +   LA+A +     CG+V   I PC+ + +G+   PS  CCSG + L+
Sbjct  9    LVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLS 68
Query  65   NAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS--IPYTISTSTDCSR 118
               +TT  +R AC C+  A  G+SG+     A +P KCG++  +P  I+   DCS+
Sbjct  69   EEVKTTEQKREACKCIVAATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSK 123

Sequence Alignment: 58. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 52.5 bits 272,  Expect = 4e-09
 Identities = 39/106 36%, Positives = 61/106 57%, Gaps = 4/106 3%
Query  10   VATAVVALVLLAA--ATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAA 67
            +  A++A++++A        AI+C  V   + PC+ Y R  G  P+  CC+G + L  A 
Sbjct  6    MGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRS-GGKPTPACCAGAKKLLGAT 64
Query  68   RTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117
            RT ADRR AC C K AA  +  +    A+S+P KCG+S    I+ + +C+
Sbjct  65   RTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCN 113

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 51.7 bits 267,  Expect = 8e-09
 Identities = 40/115 34%, Positives = 63/115 54%, Gaps = 8/115 6%
Query  3    RTQQLAVVATAVVALVLLAAATSEAAIS-----CGQVASAIAPCISYARGQGSGPSAGCC 57
            RT  +A +     AL   ++A    A +     CG+V   I PC+ + +G+   PS  CC
Sbjct  2    RTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECC 61
Query  58   SGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV--SIPYTISTSTD 115
            SG + L+   +TT  +R AC C+  A  G+SG+     A +P KC +  ++P  I+   D
Sbjct  62   SGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLP-PITADFD 120
Query  116  CSR 118
            CS+
Sbjct  121  CSK 123

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 46.8 bits 235,  Expect = 2e-07
 Identities = 40/107 37%, Positives = 63/107 58%, Gaps = 18/107 16%
Query  9    VVATAVVALVLLAAA----TSEAAI----------SCGQVASAIAPCISYARGQGSGPSA 54
            V A + VALV++ AA    TS A++          +CG V  A+ PC+ + +G+   PS 
Sbjct  4    VSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPCLPFVQGKEKEPSK 63
Query  55   GCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTIS 111
            GCCSG + L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I 
Sbjct  64   GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PID 122
Query  112  TSTDC 116
             + DC
Sbjct  123  VNMDC 127

Sequence Alignment: 61. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 46.1 bits 231,  Expect = 3e-07
 Identities = 37/107 34%, Positives = 61/107 57%, Gaps = 6/107 5%
Query  9    VVATAVVALVLLAAATSEAAIS--CGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA 66
            ++ +  V L+L++   +  A S  C  V + +APC  +  GQ   PS  CC+GV +LNN+
Sbjct  6    ILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQE--PSKACCTGVNNLNNS 63
Query  67   ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPY-TISTSTDCSR 118
             +T ADR A CNC+K     ++  +      + +KCGV   +  +  + DCS+
Sbjct  64   RKTKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKCGVKPDFPAVDKNLDCSK 115

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 46.5 bits 233,  Expect = 4e-07
 Identities = 36/109 33%, Positives = 57/109 52%, Gaps = 9/109 8%
Query  7    LAVVATAVVALVLLAAATSEAAI-----SCGQVASAIAPCISYARGQGSGPSAGCCSGVR 61
            L V+  A +A   LA+    A       +CG V  A+ PC+ + +G+   PS GCCSG +
Sbjct  12   LVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMPCLPFVQGKEKEPSKGCCSGAK 71
Query  62   SLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV---SIPYTISTSTDC 116
             L+   +T   R  AC C++ A    S ++    + +P  CG+    +P  I  + DC
Sbjct  72   RLDGETKTGLQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128

Sequence Alignment: 63. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 44.8 bits 222,  Expect = 1e-06
 Identities = 28/86 32%, Positives = 47/86 54%, Gaps = 4/86 4%
Query  30   SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 89
            +CG +  A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S 
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  90   LNAGNAASIPSKCGV---SIPYTISTSTDC 116
            ++    + +P  CG+    +P  I  + DC
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91

Sequence Alignment: 64. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 44.8 bits 222,  Expect = 1e-06
 Identities = 28/86 32%, Positives = 47/86 54%, Gaps = 4/86 4%
Query  30   SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 89
            +CG +  A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S 
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  90   LNAGNAASIPSKCGV---SIPYTISTSTDC 116
            ++    + +P  CG+    +P  I  + DC
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 41.4 bits 200,  Expect = 1e-05
 Identities = 26/79 32%, Positives = 43/79 54%, Gaps = 4/79 5%
Query  37   AIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA 96
            A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S ++    +
Sbjct  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
Query  97   SIPSKCGV---SIPYTISTSTDC 116
             +P  CG+    +P  I  + DC
Sbjct  64   EVPKHCGIVDSKLP-PIDVNMDC 85

Sequence Alignment: 66. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 30.8 bits 132,  Expect = 0.004
 Identities = 15/29 51%, Positives = 22/29 75%, Gaps = 0/29 0%
Query  29   ISCGQVASAIAPCISYARGQGSGPSAGCC 57
            ++CGQVASA++PCI Y +  G+ P+  CC
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCC 30

Sequence Alignment: 67. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 30.6 bits 131,  Expect = 0.005
 Identities = 17/37 45%, Positives = 27/37 72%, Gaps = 1/37 2%
Query  28   AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNN 65
            A++C  V++ I+PC+SY +  G  P A CC+GV+ LN+
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVP-ADCCAGVKGLND 37

Sequence Alignment: 68. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 29.5 bits 124,  Expect = 0.01
 Identities = 14/34 41%, Positives = 23/34 67%, Gaps = 1/34 2%
Query  28   AISCGQVASAIAPCISYARGQGSGPSAG-CCSGVR 61
            +I+C QV+ ++ PC++Y +  G  P  G CC GV+
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.