The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS
PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP
GYCNLTTVHNTPYCLAMEESQWS
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA34709 Tri a TAI 143 1012 98.3 8.8e-23
CAA49556 Hor v 1 149 925 91.0 1.4e-20
Q41540 Tri a 40.0101 143 894 88.3 8.7e-20
CAA42453 Tri a TAI 143 894 88.3 8.7e-20
CAA49555 Hor v 1 145 512 56.1 4.2e-10
CAA39099 Tri a TAI 145 510 56.0 4.8e-10
CAA41956 Hor v 1 144 493 54.5 1.3e-09
CAA35598 Tri a TAI 145 482 53.6 2.4e-09
CAZ76052 Tri a 29.0101 120 422 48.4 7.8e-08
CBA13559 Tri a 29.0201 120 406 47.0 2e-07
CAA35188 Hor v 1 144 302 38.4 8.9e-05
P01086 Hor v 1 144 302 38.4 8.9e-05
CAA46705 Hor v 1 148 302 38.5 9e-05
CAA31794 Hor v 1 147 289 37.4 0.00019
CAA49557 Hor v 1 171 254 34.6 0.0015
CAA35597 Tri a 30.0101 168 244 33.7 0.0027
CAA35597 Tri a TAI 168 244 33.7 0.0027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 98.3 bits 1012,  Expect = 9e-23
 Identities = 143/143 100%, Positives = 143/143 100%, Gaps = 0/143 0%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
            MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS
Sbjct  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
Query  61   PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP 120
            PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP
Sbjct  61   PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP 120
Query  121  GYCNLTTVHNTPYCLAMEESQWS 143
            GYCNLTTVHNTPYCLAMEESQWS
Sbjct  121  GYCNLTTVHNTPYCLAMEESQWS 143

Sequence Alignment: 2. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 91.0 bits 925,  Expect = 1e-20
 Identities = 129/143 90%, Positives = 137/143 95%, Gaps = 0/143 0%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
            MASKS+C LLLAAVLVSIFAAVAA+G+EDCTPW +T ITPLPSCRDYVEQQACRIETPG 
Sbjct  1    MASKSSCDLLLAAVLVSIFAAVAAVGSEDCTPWTATPITPLPSCRDYVEQQACRIETPGP 60
Query  61   PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP 120
            PYLAKQQCCGELANIPQQCRCQALR+FMG KSRPDQSGLMELPGCPREVQMDFVRILVTP
Sbjct  61   PYLAKQQCCGELANIPQQCRCQALRFFMGRKSRPDQSGLMELPGCPREVQMDFVRILVTP 120
Query  121  GYCNLTTVHNTPYCLAMEESQWS 143
            G+CNLTTVHNTPYCLAM+E QW+
Sbjct  121  GFCNLTTVHNTPYCLAMDEWQWN 143

Sequence Alignment: 3. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 88.3 bits 894,  Expect = 9e-20
 Identities = 125/143 87%, Positives = 133/143 93%, Gaps = 0/143 0%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
            MASKSN  LL+ A+LV IFAAVAA+GNEDCTPW STLITPLPSCR+YVE+QACRIE PG 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGP 60
Query  61   PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP 120
            PYLAKQ+CC +LANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQM+FV ILVTP
Sbjct  61   PYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTP 120
Query  121  GYCNLTTVHNTPYCLAMEESQWS 143
            GYCNLTTVHNTPYCL MEESQWS
Sbjct  121  GYCNLTTVHNTPYCLGMEESQWS 143

Sequence Alignment: 4. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 88.3 bits 894,  Expect = 9e-20
 Identities = 125/143 87%, Positives = 133/143 93%, Gaps = 0/143 0%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
            MASKSN  LL+ A+LV IFAAVAA+GNEDCTPW STLITPLPSCR+YVE+QACRIE PG 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGP 60
Query  61   PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP 120
            PYLAKQ+CC +LANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQM+FV ILVTP
Sbjct  61   PYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTP 120
Query  121  GYCNLTTVHNTPYCLAMEESQWS 143
            GYCNLTTVHNTPYCL MEESQWS
Sbjct  121  GYCNLTTVHNTPYCLGMEESQWS 143

Sequence Alignment: 5. Allergen Name: Hor v 1 Sequence ID: CAA49555

 Score = 56.1 bits 512,  Expect = 4e-10
 Identities = 76/137 55%, Positives = 95/137 69%, Gaps = 8/137 5%
Query  1    MASKSNCV-LLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPG 59
            MASKS+   LLLAAVL S+FAA  A G + C   M     PL  CR+YV QQ C +   G
Sbjct  1    MASKSSITPLLLAAVLASVFAAATATG-QYCYAGMGLPSNPLEGCREYVAQQTCGVTIAG 59
Query  60   SPYLA------KQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDF 113
            SP  +      K +CC EL   PQ+CRC+A+RYF+G +S PD S L +LPGCP+E Q DF
Sbjct  60   SPVSSEPGDTPKDRCCQELDEAPQHCRCEAVRYFIGRRSHPDWSVLKDLPGCPKEPQRDF 119
Query  114  VRILVTPGYCNLTTVHNTPYCLAME 138
             ++LVTPG CN+ TVHN PYCL ++
Sbjct  120  AKVLVTPGQCNVLTVHNAPYCLGLD 144

Sequence Alignment: 6. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 56.0 bits 510,  Expect = 5e-10
 Identities = 77/137 56%, Positives = 96/137 70%, Gaps = 8/137 5%
Query  1    MASKSNCV-LLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPG 59
            MASKS+   LLLAAVLVS+FAA AA G   C P M     PL  CR+YV QQ C +   G
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAAATG-PYCYPGMGLPSNPLEGCREYVAQQTCGVGIVG 59
Query  60   SPY------LAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDF 113
            SP         + +CC EL +  Q+CRC+A+RYF+G  S P+   L +LPGCPRE Q DF
Sbjct  60   SPVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDF 119
Query  114  VRILVTPGYCNLTTVHNTPYCLAME 138
             ++LVTPG+CN+ TVHNTPYCL ++
Sbjct  120  AKVLVTPGHCNVMTVHNTPYCLGLD 144

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: CAA41956

 Score = 54.5 bits 493,  Expect = 1e-09
 Identities = 75/136 55%, Positives = 94/136 69%, Gaps = 9/136 6%
Query  1    MASKSNCV-LLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPG 59
            MASKS+   LLLAAVL S+FAA AA G + C   M     PL  CR+YV QQ C +   G
Sbjct  1    MASKSSITPLLLAAVLASVFAAAAATG-QYCYAGMGLPSNPLEGCREYVAQQTCGVTIAG 59
Query  60   SPYLA------KQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDF 113
            SP  +      K +CC EL   PQ+CRC+ +RYF+G +S PD   L +LPGCP+E Q DF
Sbjct  60   SPVSSEPGDTPKDRCCQELDEAPQHCRCR-VRYFIGRRSHPDWRVLKDLPGCPKEPQRDF 118
Query  114  VRILVTPGYCNLTTVHNTPYCLAME 138
             ++LVTPG CN+ TVHN PYCL ++
Sbjct  119  AKVLVTPGQCNVLTVHNAPYCLGLD 143

Sequence Alignment: 8. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 53.6 bits 482,  Expect = 2e-09
 Identities = 74/137 54%, Positives = 93/137 67%, Gaps = 8/137 5%
Query  1    MASKSNCV-LLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPG 59
            MASKS+   LLLA VLVS+FAA  A G   C   M   I PL  CR+YV QQ C I   G
Sbjct  1    MASKSSISPLLLATVLVSVFAAATATG-PYCYAGMGLPINPLEGCREYVAQQTCGISISG 59
Query  60   SPY------LAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDF 113
            S          + +CC EL +  Q+CRC+A+RYF+G +S P+ S L +LPGCPRE Q DF
Sbjct  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDF 119
Query  114  VRILVTPGYCNLTTVHNTPYCLAME 138
             ++LVT G+CN+ TVHN PYCL ++
Sbjct  120  AKVLVTSGHCNVMTVHNAPYCLGLD 144

Sequence Alignment: 9. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 48.4 bits 422,  Expect = 8e-08
 Identities = 57/109 52%, Positives = 74/109 67%, Gaps = 6/109 5%
Query  30   CTPWMSTLITPLPSCRDYVEQQACRIETPGSPY------LAKQQCCGELANIPQQCRCQA 83
            C   M   I PL  CR+YV QQ C I   GS          + +CC EL +  Q+CRC+A
Sbjct  5    CYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEA 64
Query  84   LRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAME 138
            +RYF+G +S P+ S L +LPGCPRE Q DF ++LVTPG+CN+ TVHN PYCL ++
Sbjct  65   VRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLD 119

Sequence Alignment: 10. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 47.0 bits 406,  Expect = 2e-07
 Identities = 55/109 50%, Positives = 72/109 66%, Gaps = 6/109 5%
Query  30   CTPWMSTLITPLPSCRDYVEQQACRIETPGSPY------LAKQQCCGELANIPQQCRCQA 83
            C P M     PL  CR+YV QQ C +   GSP         + +CC EL +  Q+C C+A
Sbjct  5    CYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHCWCEA 64
Query  84   LRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAME 138
            +RYF+G  S P+   L +LPGCPRE Q D  ++LVTPG+CN+ TVHNTPYCL ++
Sbjct  65   VRYFIGRTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNVMTVHNTPYCLGLD 119

Sequence Alignment: 11. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 38.4 bits 302,  Expect = 9e-05
 Identities = 54/129 41%, Positives = 74/129 57%, Gaps = 13/129 10%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
            MA K   +LL AAV+++I+ A A    + C P  +    PL +CR YV  Q C       
Sbjct  1    MAFKYQ-LLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICH----QG 55
Query  61   PYL----AKQQCCGELANIPQQCRCQALRYFMGP----KSRPDQSGLMELPGCPREVQMD 112
            P L     K++CC EL+ IP  CRC+ALR  M      +   + + + + P CPRE Q  
Sbjct  56   PRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTS 115
Query  113  FVRILVTPGYCNLTTVHNTPYC 134
            +   LVTP  CNL T+H + YC
Sbjct  116  YAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 12. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 38.4 bits 302,  Expect = 9e-05
 Identities = 54/129 41%, Positives = 74/129 57%, Gaps = 13/129 10%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
            MA K   +LL AAV+++I+ A A    + C P  +    PL +CR YV  Q C       
Sbjct  1    MAFKYQ-LLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICH----QG 55
Query  61   PYL----AKQQCCGELANIPQQCRCQALRYFMGP----KSRPDQSGLMELPGCPREVQMD 112
            P L     K++CC EL+ IP  CRC+ALR  M      +   + + + + P CPRE Q  
Sbjct  56   PRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTS 115
Query  113  FVRILVTPGYCNLTTVHNTPYC 134
            +   LVTP  CNL T+H + YC
Sbjct  116  YAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 38.5 bits 302,  Expect = 9e-05
 Identities = 54/129 41%, Positives = 74/129 57%, Gaps = 13/129 10%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS 60
            MA K   +LL AAV+++I+ A A    + C P  +    PL +CR YV  Q C       
Sbjct  1    MAFKYQ-LLLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICH----QG 55
Query  61   PYL----AKQQCCGELANIPQQCRCQALRYFMGP----KSRPDQSGLMELPGCPREVQMD 112
            P L     K++CC EL+ IP  CRC+ALR  M      +   + + + + P CPRE Q  
Sbjct  56   PRLLTSDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRERQTS 115
Query  113  FVRILVTPGYCNLTTVHNTPYC 134
            +   LVTP  CNL T+H + YC
Sbjct  116  YAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 14. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 37.4 bits 289,  Expect = 0.0002
 Identities = 51/128 39%, Positives = 73/128 57%, Gaps = 8/128 6%
Query  1    MASKSNCVLLLAAVLVSIFAAVAAIGN---EDCTPWMSTLITPLPSCRDYVEQQACRIET 57
            MAS     +L  AVL+S++A  AA      ++C   +     PL +C  YV ++ C    
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLESVKDECQLGVDFPHNPLATCHTYVIKRVCG-RG 59
Query  58   PGSPYLAKQQCCGELANIPQQCRCQALRYFMG----PKSRPDQSGLMELPGCPREVQMDF 113
            P  P L K++CC ELA +P +CRC+ALR +M     P+ R  +  L +   CPRE Q  F
Sbjct  60   PSRPMLVKERCCRELAAVPDHCRCEALRILMDGVRTPEGRVVEGRLGDRRDCPREEQRAF 119
Query  114  VRILVTPGYCNLTTVH 129
               LVT   CNL++V+
Sbjct  120  AATLVTAAECNLSSVQ 135

Sequence Alignment: 15. Allergen Name: Hor v 1 Sequence ID: CAA49557

 Score = 34.6 bits 254,  Expect = 0.002
 Identities = 90/142 63%, Positives = 106/142 74%, Gaps = 28/142 19%
Query  1    MASKSN-CVLLLAAVLVSIFAAVAAIGNE-DCTPWMSTLITPLPSCRDYVEQQACRIETP 58
            MA KS+  +LLLA V+VS+FAA AA     DC+P ++     L  CRDYV QQ C + TP
Sbjct  1    MACKSSRSLLLLATVMVSVFAAAAAAAAATDCSPGVAFPTNLLGHCRDYVLQQTCAVFTP 60
Query  59   GS----------------PYLAKQQCCGELANIPQQCRCQALRYFMG-P-KSRP------ 94
            GS                PYLAK  CC ELA IPQQCRC+ALRYFM  P  S+P      
Sbjct  61   GSKLPEWMTSAELNYPGQPYLAKLYCCQELAEIPQQCRCEALRYFMALPVPSQPVDPSTG 120
Query  95   --DQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAMEESQW 142
               QSGLM+LPGCPRE+Q DFVR+LV PG CNL T+HN  YC A+E+  W
Sbjct  121  NVGQSGLMDLPGCPREMQRDFVRLLVAPGQCNLATIHNVRYCPAVEQPLW 170

Sequence Alignment: 16. Allergen Name: Tri a 30.0101 Sequence ID: CAA35597

 Score = 33.7 bits 244,  Expect = 0.003
 Identities = 86/140 61%, Positives = 107/140 76%, Gaps = 29/140 20%
Query  1    MASKSNC-VLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQAC------ 53
            MA KS+C +LLLAAVL+S++AA +A G+  C P ++     LP CRDYV QQ C      
Sbjct  1    MACKSSCSLLLLAAVLLSVLAAASASGS--CVPGVAFRTNLLPHCRDYVLQQTCGTFTPG 58
Query  54   ----------RIETPGSPYLAKQQCCGELANIPQQCRCQALRYFMG-P-KSRP------- 94
                       I +PG PYLAK  CC ELA I QQCRC+ALRYF+  P  S+P       
Sbjct  59   SKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGN 118
Query  95   -DQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAMEESQW 142
              +SGL++LPGCPRE+Q DFVR+LV PG CNL T+HN  YC A+E+  W
Sbjct  119  VGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLW 167

Sequence Alignment: 17. Allergen Name: Tri a TAI Sequence ID: CAA35597

 Score = 33.7 bits 244,  Expect = 0.003
 Identities = 86/140 61%, Positives = 107/140 76%, Gaps = 29/140 20%
Query  1    MASKSNC-VLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQAC------ 53
            MA KS+C +LLLAAVL+S++AA +A G+  C P ++     LP CRDYV QQ C      
Sbjct  1    MACKSSCSLLLLAAVLLSVLAAASASGS--CVPGVAFRTNLLPHCRDYVLQQTCGTFTPG 58
Query  54   ----------RIETPGSPYLAKQQCCGELANIPQQCRCQALRYFMG-P-KSRP------- 94
                       I +PG PYLAK  CC ELA I QQCRC+ALRYF+  P  S+P       
Sbjct  59   SKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGN 118
Query  95   -DQSGLMELPGCPREVQMDFVRILVTPGYCNLTTVHNTPYCLAMEESQW 142
              +SGL++LPGCPRE+Q DFVR+LV PG CNL T+HN  YC A+E+  W
Sbjct  119  VGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLW 167

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.