The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS
AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA
KVLVTSGHCNVMTVHNAPYCLGLDI
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA35598 Tri a TAI 145 1005 119.1 4.8e-29
CAA39099 Tri a TAI 145 923 110.4 2e-26
CAA49555 Hor v 1 145 874 105.2 7.5e-25
CAZ76052 Tri a 29.0101 120 863 103.9 1.5e-24
CAA41956 Hor v 1 144 840 101.6 9.1e-24
CBA13559 Tri a 29.0201 120 791 96.2 3.1e-22
CAA49556 Hor v 1 149 508 66.3 3.9e-13
CAA34709 Tri a TAI 143 482 63.5 2.6e-12
CAA42453 Tri a TAI 143 453 60.4 2.2e-11
Q41540 Tri a 40.0101 143 453 60.4 2.2e-11
CAA35188 Hor v 1 144 306 44.8 1.1e-06
P01086 Hor v 1 144 306 44.8 1.1e-06
CAA46705 Hor v 1 148 306 44.8 1.2e-06
CAA31794 Hor v 1 147 289 43.0 4e-06
CAA49557 Hor v 1 171 185 32.0 0.0092
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 119.1 bits 1005,  Expect = 5e-29
 Identities = 145/145 100%, Positives = 145/145 100%, Gaps = 0/145 0%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS 60
            MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS
Sbjct  1    MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS 60
Query  61   AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA 120
            AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA
Sbjct  61   AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA 120
Query  121  KVLVTSGHCNVMTVHNAPYCLGLDI 145
            KVLVTSGHCNVMTVHNAPYCLGLDI
Sbjct  121  KVLVTSGHCNVMTVHNAPYCLGLDI 145

Sequence Alignment: 2. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 110.4 bits 923,  Expect = 2e-26
 Identities = 131/145 90%, Positives = 133/145 91%, Gaps = 0/145 0%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS 60
            MASKSSI+ LLLA VLVSVFAAA ATGPYCY GMGLP NPLEGCREYVAQQTCG+ I GS
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAAATGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGS 60
Query  61   AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA 120
             VSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGR SDPNS VLKDLPGCPREPQRDFA
Sbjct  61   PVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDFA 120
Query  121  KVLVTSGHCNVMTVHNAPYCLGLDI 145
            KVLVT GHCNVMTVHN PYCLGLDI
Sbjct  121  KVLVTPGHCNVMTVHNTPYCLGLDI 145

Sequence Alignment: 3. Allergen Name: Hor v 1 Sequence ID: CAA49555

 Score = 105.2 bits 874,  Expect = 7e-25
 Identities = 122/145 84%, Positives = 135/145 93%, Gaps = 0/145 0%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS 60
            MASKSSI+PLLLA VL SVFAAATATG YCYAGMGLP NPLEGCREYVAQQTCG++I+GS
Sbjct  1    MASKSSITPLLLAAVLASVFAAATATGQYCYAGMGLPSNPLEGCREYVAQQTCGVTIAGS 60
Query  61   AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA 120
             VS+EPG+TP+DRCC+EL +A QHCRCEAVRYFIGRRS P+ SVLKDLPGCP+EPQRDFA
Sbjct  61   PVSSEPGDTPKDRCCQELDEAPQHCRCEAVRYFIGRRSHPDWSVLKDLPGCPKEPQRDFA 120
Query  121  KVLVTSGHCNVMTVHNAPYCLGLDI 145
            KVLVT G+CNV+TVHNAPYCLGLDI
Sbjct  121  KVLVTPGQCNVLTVHNAPYCLGLDI 145

Sequence Alignment: 4. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 103.9 bits 863,  Expect = 2e-24
 Identities = 119/120 99%, Positives = 119/120 99%, Gaps = 0/120 0%
Query  26   TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 85
            TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC
Sbjct  1    TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 60
Query  86   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNVMTVHNAPYCLGLDI 145
            RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVT GHCNVMTVHNAPYCLGLDI
Sbjct  61   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNAPYCLGLDI 120

Sequence Alignment: 5. Allergen Name: Hor v 1 Sequence ID: CAA41956

 Score = 101.6 bits 840,  Expect = 9e-24
 Identities = 118/144 81%, Positives = 131/144 90%, Gaps = 1/144 0%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGS 60
            MASKSSI+PLLLA VL SVFAAA ATG YCYAGMGLP NPLEGCREYVAQQTCG++I+GS
Sbjct  1    MASKSSITPLLLAAVLASVFAAAAATGQYCYAGMGLPSNPLEGCREYVAQQTCGVTIAGS 60
Query  61   AVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFA 120
             VS+EPG+TP+DRCC+EL +A QHCRC  VRYFIGRRS P+  VLKDLPGCP+EPQRDFA
Sbjct  61   PVSSEPGDTPKDRCCQELDEAPQHCRCR-VRYFIGRRSHPDWRVLKDLPGCPKEPQRDFA 119
Query  121  KVLVTSGHCNVMTVHNAPYCLGLDI 145
            KVLVT G+CNV+TVHNAPYCLGLDI
Sbjct  120  KVLVTPGQCNVLTVHNAPYCLGLDI 144

Sequence Alignment: 6. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 96.2 bits 791,  Expect = 3e-22
 Identities = 108/120 90%, Positives = 109/120 90%, Gaps = 0/120 0%
Query  26   TGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHC 85
            TGPYCY GMGLP NPLEGCREYVAQQTCG+ I GS VSTEPGNTPRDRCCKELYDASQHC
Sbjct  1    TGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHC 60
Query  86   RCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNVMTVHNAPYCLGLDI 145
             CEAVRYFIGR SDPNS VLKDLPGCPREPQRD AKVLVT GHCNVMTVHN PYCLGLDI
Sbjct  61   WCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNVMTVHNTPYCLGLDI 120

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 66.3 bits 508,  Expect = 4e-13
 Identities = 76/137 55%, Positives = 93/137 67%, Gaps = 8/137 5%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPY-CYAGMGLPINPLEGCREYVAQQTCGISISG 59
            MASKSS   LLLA VLVS+FAA  A G   C      PI PL  CR+YV QQ C I   G
Sbjct  1    MASKSS-CDLLLAAVLVSIFAAVAAVGSEDCTPWTATPITPLPSCRDYVEQQACRIETPG 59
Query  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDF 119
                  P    + +CC EL +  Q+CRC+A+R+F+GR+S P+ S L +LPGCPRE Q DF
Sbjct  60   ------PPYLAKQQCCGELANIPQQCRCQALRFFMGRKSRPDQSGLMELPGCPREVQMDF 113
Query  120  AKVLVTSGHCNVMTVHNAPYCLGLD 144
             ++LVT G CN+ TVHN PYCL +D
Sbjct  114  VRILVTPGFCNLTTVHNTPYCLAMD 138

Sequence Alignment: 8. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 63.5 bits 482,  Expect = 3e-12
 Identities = 74/137 54%, Positives = 93/137 67%, Gaps = 8/137 5%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPY-CYAGMGLPINPLEGCREYVAQQTCGISISG 59
            MASKS+   LLLA VLVS+FAA  A G   C   M   I PL  CR+YV QQ C I   G
Sbjct  1    MASKSN-CVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPG 59
Query  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDF 119
            S          + +CC EL +  Q+CRC+A+RYF+G +S P+ S L +LPGCPRE Q DF
Sbjct  60   SPY------LAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDF 113
Query  120  AKVLVTSGHCNVMTVHNAPYCLGLD 144
             ++LVT G+CN+ TVHN PYCL ++
Sbjct  114  VRILVTPGYCNLTTVHNTPYCLAME 138

Sequence Alignment: 9. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 60.4 bits 453,  Expect = 2e-11
 Identities = 67/137 48%, Positives = 91/137 66%, Gaps = 8/137 5%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPY-CYAGMGLPINPLEGCREYVAQQTCGISISG 59
            MASKS+ + LL+  +LV +FAA  A G   C       I PL  CR YV +Q C I + G
Sbjct  1    MASKSNYN-LLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPG 59
Query  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDF 119
                  P    +  CC++L +  Q+CRC+A+RYF+G +S P+ S L +LPGCPRE Q +F
Sbjct  60   ------PPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNF 113
Query  120  AKVLVTSGHCNVMTVHNAPYCLGLD 144
              +LVT G+CN+ TVHN PYCLG++
Sbjct  114  VPILVTPGYCNLTTVHNTPYCLGME 138

Sequence Alignment: 10. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 60.4 bits 453,  Expect = 2e-11
 Identities = 67/137 48%, Positives = 91/137 66%, Gaps = 8/137 5%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPY-CYAGMGLPINPLEGCREYVAQQTCGISISG 59
            MASKS+ + LL+  +LV +FAA  A G   C       I PL  CR YV +Q C I + G
Sbjct  1    MASKSNYN-LLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPG 59
Query  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDF 119
                  P    +  CC++L +  Q+CRC+A+RYF+G +S P+ S L +LPGCPRE Q +F
Sbjct  60   ------PPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNF 113
Query  120  AKVLVTSGHCNVMTVHNAPYCLGLD 144
              +LVT G+CN+ TVHN PYCLG++
Sbjct  114  VPILVTPGYCNLTTVHNTPYCLGME 138

Sequence Alignment: 11. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 44.8 bits 306,  Expect = 1e-06
 Identities = 55/132 41%, Positives = 75/132 56%, Gaps = 13/132 9%
Query  1    MASKSSISPLLLATVLVSVFAA-ATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISG 59
            MA K  +  LL A V+++++ A AT+ G  C  G  LP NPL  CR YV  Q C     G
Sbjct  1    MAFKYQL--LLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICH---QG 55
Query  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYF----IGRRSDPNSSVLKDLPGCPREP 115
              + T   +  + RCC EL     +CRCEA+R      +  +     + +KD P CPRE 
Sbjct  56   PRLLT---SDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRER 112
Query  116  QRDFAKVLVTSGHCNVMTVHNAPYC 140
            Q  +A  LVT   CN+ T+H + YC
Sbjct  113  QTSYAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 12. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 44.8 bits 306,  Expect = 1e-06
 Identities = 55/132 41%, Positives = 75/132 56%, Gaps = 13/132 9%
Query  1    MASKSSISPLLLATVLVSVFAA-ATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISG 59
            MA K  +  LL A V+++++ A AT+ G  C  G  LP NPL  CR YV  Q C     G
Sbjct  1    MAFKYQL--LLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICH---QG 55
Query  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYF----IGRRSDPNSSVLKDLPGCPREP 115
              + T   +  + RCC EL     +CRCEA+R      +  +     + +KD P CPRE 
Sbjct  56   PRLLT---SDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRER 112
Query  116  QRDFAKVLVTSGHCNVMTVHNAPYC 140
            Q  +A  LVT   CN+ T+H + YC
Sbjct  113  QTSYAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 44.8 bits 306,  Expect = 1e-06
 Identities = 55/132 41%, Positives = 75/132 56%, Gaps = 13/132 9%
Query  1    MASKSSISPLLLATVLVSVFAA-ATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISG 59
            MA K  +  LL A V+++++ A AT+ G  C  G  LP NPL  CR YV  Q C     G
Sbjct  1    MAFKYQL--LLSAAVMLAILVATATSFGDSCAPGDALPHNPLRACRTYVVSQICH---QG 55
Query  60   SAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYF----IGRRSDPNSSVLKDLPGCPREP 115
              + T   +  + RCC EL     +CRCEA+R      +  +     + +KD P CPRE 
Sbjct  56   PRLLT---SDMKRRCCDELSAIPAYCRCEALRIIMQGVVTWQGAFEGAYFKDSPNCPRER 112
Query  116  QRDFAKVLVTSGHCNVMTVHNAPYC 140
            Q  +A  LVT   CN+ T+H + YC
Sbjct  113  QTSYAANLVTPQECNLGTIHGSAYC 137

Sequence Alignment: 14. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 43.0 bits 289,  Expect = 4e-06
 Identities = 54/121 44%, Positives = 72/121 59%, Gaps = 16/121 13%
Query  10   LLLATVLVSVFAAATAT----GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTE 65
            +L   VL+SV+A A AT       C  G+ +P NPL  C  YV ++ CG    G    + 
Sbjct  9    VLSGAVLLSVLAVAAATLESVKDECQLGVDFPHNPLATCHTYVIKRVCG---RGP---SR 62
Query  66   PGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSV----LKDLPGCPREPQRDFAK 121
            P    ++RCC+EL     HCRCEA+R ++     P   V    L D   CPRE QR FA 
Sbjct  63   P-MLVKERCCRELAAVPDHCRCEALRILMDGVRTPEGRVVEGRLGDRRDCPREEQRAFAA 121
Query  122  VLVTSGHCNVMTVHNAP 138
             LVT+  CN+ +V+ AP
Sbjct  122  TLVTAAECNLSSVQ-AP 137

Sequence Alignment: 15. Allergen Name: Hor v 1 Sequence ID: CAA49557

 Score = 32.0 bits 185,  Expect = 0.009
 Identities = 78/140 55%, Positives = 98/140 70%, Gaps = 22/140 15%
Query  1    MASKSSISPLLLATVLVSVFAAATATGPY--CYAGMGLPINPLEGCREYVAQQTCGISIS 58
            MA KSS S LLLATV+VSVFAAA A      C  G+ +P N L  CR+YV QQTC +   
Sbjct  1    MACKSSRSLLLLATVMVSVFAAAAAAAAATDCSPGVAFPTNLLGHCRDYVLQQTCAVFTP 60
Query  59   GSAV-----STE---PGNT--PRDRCCKELYDASQHCRCEAVRYFIG-----RRSDPNS- 102
            GS +     S E   PG     +  CC+EL +  Q+CRCEA+RYF+      +  DP++ 
Sbjct  61   GSKLPEWMTSAELNYPGQPYLAKLYCCQELAEIPQQCRCEALRYFMALPVPSQPVDPSTG 120
Query  103  ----SVLKDLPGCPREPQRDFAKVLVTSGHCNVMTVHNAPYC 140
                S L DLPGCPRE QRDF ++LV  G+CN+ T+HN  YC
Sbjct  121  NVGQSGLMDLPGCPREMQRDFVRLLVAPGQCNLATIHNVRYC 162

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.