The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA02000 Ory s TAI 166 1184 170.0 3e-44
BAA01998 Ory s TAI 165 1112 160.4 2.4e-41
BAA07711 Ory s TAI 160 1101 158.9 6.5e-41
BAA07710 Ory s TAI 166 1100 158.8 7.3e-41
BAA01997 Ory s TAI 162 943 137.7 1.5e-34
BAA07713 Ory s TAI 160 897 131.5 1.1e-32
BAA01996 Ory s TAI 157 882 129.5 4.4e-32
BAA07712 Ory s TAI 157 836 123.3 3.1e-30
BAA07773 Ory s TAI 109 732 109.3 3.7e-26
BAA07772 Ory s TAI 111 707 105.9 3.9e-25
BAA07774 Ory s TAI 113 703 105.4 5.7e-25
AAB99797 Ory s TAI 157 639 96.9 2.8e-22
P16968 Hor v 1 146 523 81.4 1.3e-17
P16968 Hor v 15.0101 146 523 81.4 1.3e-17
BAA01999 Ory s TAI 95 478 75.2 6e-16
CBA13560 Tri a 15.0101 121 377 61.7 8.6e-12
P01083 Tri a TAI 123 375 61.5 1e-11
CAA08836 Hor v 1 152 373 61.3 1.5e-11
CAI84642 Tri a 28.0101 119 284 49.3 4.8e-08
P01085 Tri a TAI 124 284 49.3 4.9e-08
P01084 Tri a TAI 124 270 47.4 1.8e-07
CAA39099 Tri a TAI 145 185 36.0 0.00055
P01086 Hor v 1 144 184 35.9 0.0006
CAA46705 Hor v 1 148 184 35.9 0.00061
CAA35188 Hor v 1 144 183 35.8 0.00066
CBA13559 Tri a 29.0201 120 179 35.2 0.00083
CAZ76052 Tri a 29.0101 120 179 35.2 0.00083
CAA31794 Hor v 1 147 174 34.6 0.0015
CAA34709 Tri a TAI 143 169 33.9 0.0024
CAA35598 Tri a TAI 145 168 33.8 0.0027
CAA42453 Tri a TAI 143 158 32.4 0.0067
Q41540 Tri a 40.0101 143 158 32.4 0.0067
CAA49556 Hor v 1 149 156 32.2 0.0083
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 170.0 bits 1184,  Expect = 3e-44
 Identities = 166/166 100%, Positives = 166/166 100%, Gaps = 0/166 0%
Query  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 160.4 bits 1112,  Expect = 2e-41
 Identities = 158/165 95%, Positives = 160/165 96%, Gaps = 1/165 0%
Query  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCVG  +PG AVDEQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVGTRSPG-AVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 158.9 bits 1101,  Expect = 6e-41
 Identities = 154/156 98%, Positives = 154/156 98%, Gaps = 1/156 0%
Query  11   LLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 70
            LLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG
Sbjct  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
Query  71   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 130
            GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL
Sbjct  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
Query  131  ERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 166
            ERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  124  ERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 158.8 bits 1100,  Expect = 7e-41
 Identities = 155/166 93%, Positives = 156/166 93%, Gaps = 0/166 0%
Query  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCV    P    +EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 137.7 bits 943,  Expect = 2e-34
 Identities = 132/161 81%, Positives = 146/161 90%, Gaps = 6/161 3%
Query  1    MASNKVVFSALLLIIVSVLAAT-ATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL+++SVLAA  ATMADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +RQCVG GA   A DEQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMA
Sbjct  58   RRQCVGRGA--SAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMA 115
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            EVFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  116  EVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 131.5 bits 897,  Expect = 1e-32
 Identities = 127/154 82%, Positives = 138/154 89%, Gaps = 3/154 1%
Query  1    MASNKVVFSALLLIIVSVLAATATMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAATATMA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
Query  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            KRQCVG G    A  EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  61   KRQCVGRGTAAAA--EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 118
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  119  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 129.5 bits 882,  Expect = 4e-32
 Identities = 127/151 84%, Positives = 138/151 91%, Gaps = 6/151 3%
Query  1    MASNKVVFSALLLIIVSVLAATATMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAATATMA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALV 59
Query  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            KRQC G  A      EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCRGSAAAA----EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 115
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  116  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 123.3 bits 836,  Expect = 3e-30
 Identities = 120/157 76%, Positives = 135/157 85%, Gaps = 9/157 5%
Query  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVV  ALL+++VSVLAAT TMADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VK
Sbjct  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
Query  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCV   APG  +DEQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMAE
Sbjct  61   RQCV---APG-TLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAE 116
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VF GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  117  VFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 109.3 bits 732,  Expect = 4e-26
 Identities = 101/108 93%, Positives = 102/108 94%, Gaps = 1/108 0%
Query  58   VVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 117
            VVKRQCV     GGA DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
Sbjct  2    VVKRQCVATRRTGGA-DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
Query  118  MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            MAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 105.9 bits 707,  Expect = 4e-25
 Identities = 97/111 87%, Positives = 97/111 87%, Gaps = 0/111 0%
Query  56   RAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 115
            R  VKRQCV    P     EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  116  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 105.4 bits 703,  Expect = 6e-25
 Identities = 96/107 89%, Positives = 98/107 91%, Gaps = 0/107 0%
Query  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +RQCVG         +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 96.9 bits 639,  Expect = 3e-22
 Identities = 99/151 65%, Positives = 111/151 73%, Gaps = 6/151 3%
Query  1    MASNKVVFSALLLIIVSVLAATATMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAATATMA+ HH+DQVVY+ G  CQPGMGYPMY L R   V 
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
Query  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +   +G   P       +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   EAPLLGRARPR---RRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMS 116
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156
            EVF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  117  EVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 81.4 bits 523,  Expect = 1e-17
 Identities = 77/135 57%, Positives = 94/135 69%, Gaps = 9/135 6%
Query  24   TMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCR 83
            ++A  +   V  S GE C PGMGYP+Y +PRCRA+VK QC G     G V E +++DCCR
Sbjct  3    SVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCR 57
Query  84   QLAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFC 141
            Q+AA+ D WC C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA C
Sbjct  58   QIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVC 117
Query  142  NVDIPN--GTGGVCYWLGYPRTPR 163
            N  IPN  GT GVCYWL Y + PR
Sbjct  118  NQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 81.4 bits 523,  Expect = 1e-17
 Identities = 77/135 57%, Positives = 94/135 69%, Gaps = 9/135 6%
Query  24   TMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCR 83
            ++A  +   V  S GE C PGMGYP+Y +PRCRA+VK QC G     G V E +++DCCR
Sbjct  3    SVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCR 57
Query  84   QLAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFC 141
            Q+AA+ D WC C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA C
Sbjct  58   QIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVC 117
Query  142  NVDIPN--GTGGVCYWLGYPRTPR 163
            N  IPN  GT GVCYWL Y + PR
Sbjct  118  NQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 75.2 bits 478,  Expect = 6e-16
 Identities = 70/94 74%, Positives = 82/94 87%, Gaps = 6/94 6%
Query  1    MASNKVVFSALLLIIVSVLAAT-ATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL+++SVLAA  ATMADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALN 99
            +RQCVG GA   A DEQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  58   RRQCVGRGA--SAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 16. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 61.7 bits 377,  Expect = 9e-12
 Identities = 57/110 51%, Positives = 76/110 69%, Gaps = 12/110 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C P  GY + +L  CRA+VK QCVG   P     E + +DCC+QLA V++ WCRC  L+ 
Sbjct  7    CDPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADVNNEWCRCEDLSS 61
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCYWLG 157
            M+  +Y+ELGA + G    EV+PGCR+  ++  AAS+P    V IPN +G   GVCYW  
Sbjct  62   MLRSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAA 117
Query  158  YP 159
            YP
Sbjct  118  YP 119

Sequence Alignment: 17. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 61.5 bits 375,  Expect = 1e-11
 Identities = 56/110 50%, Positives = 76/110 69%, Gaps = 14/110 12%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C P  GY + +L  CRA+VK QCVG   P     E + +DCC+QLA +++ WCRC  L+ 
Sbjct  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSS 61
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--W 155
            M+  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W
Sbjct  62   MLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117
Query  156  LGYP 159
              YP
Sbjct  118  AAYP 121

Sequence Alignment: 18. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 61.3 bits 373,  Expect = 1e-11
 Identities = 60/137 43%, Positives = 87/137 63%, Gaps = 17/137 12%
Query  5    KVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCV 64
            K ++  LLL ++ V   T   +D+    +       C P MG+ +  L RCRA+VK +CV
Sbjct  7    KSMLLVLLLCMLMVTPMTGARSDNSGPWMW------CDPEMGHKVSPLTRCRALVKLECV 60
Query  65   GHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPG 124
            G+  P     E + +DCC+++A + + WCRC  L  M+  +Y  LG   VG    EVFPG
Sbjct  61   GNRVP-----EDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VGGGPEEVFPG 112
Query  125  CRRGDLERAAASLPAFCNVDIPN---GTGGVCYW 155
            C++  ++   A +PA+CNV IPN   GT GVCYW
Sbjct  113  CQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 19. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 49.3 bits 284,  Expect = 5e-08
 Identities = 45/106 42%, Positives = 66/106 62%, Gaps = 11/106 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C PG  + + +LP CR +++ QC G   P     E + +DCC+QLA + + WCRC AL  
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS 54
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153
            M+  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  55   MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 49.3 bits 284,  Expect = 5e-08
 Identities = 45/106 42%, Positives = 66/106 62%, Gaps = 11/106 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C PG  + + +LP CR +++ QC G   P     E + +DCC+QLA + + WCRC AL  
Sbjct  6    CYPGQAFQVPALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS 59
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153
            M+  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  60   MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 47.4 bits 270,  Expect = 2e-07
 Identities = 44/106 41%, Positives = 65/106 61%, Gaps = 11/106 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C PG  + + +LP CR ++K QC G   P     E + +DCC+QLA + + W RC AL  
Sbjct  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYS 59
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153
            M+  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  60   MLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 36.0 bits 185,  Expect = 0.0006
 Identities = 50/123 40%, Positives = 66/123 53%, Gaps = 28/123 22%
Query  1    MASNKVVFSALLL-IIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MAS   +   LL  ++VSV+AA A            + G  C PGMG P   L  CR  V
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAA------------ATGPYCYPGMGLPSNPLEGCREYV 48
Query  60   KRQCVGHGAPGGAVDEQL----RQDCCRQLAAVDDSW-CRCSALNHMVGGIYRELGATDV 114
             +Q  G G  G  V  +     R  CC++L   D S  CRC A+ + +G   R    +D 
Sbjct  49   AQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG---R---TSDP 100
Query  115  GHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
               + + +PGC R      A  L  P  CNV
Sbjct  101  NSGVLKDLPGCPREPQRDFAKVLVTPGHCNV 131

Sequence Alignment: 23. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 35.9 bits 184,  Expect = 0.0006
 Identities = 45/128 35%, Positives = 71/128 55%, Gaps = 21/128 16%
Query  14   IIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAV 73
            +++++L ATAT           S+G+ C PG   P   L  CR  V  Q + H  P   +
Sbjct  13   VMLAILVATAT-----------SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPR-LL 59
Query  74   DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERA 133
               +++ CC +L+A+  ++CRC AL  ++ G+    GA + G    +  P C R      
Sbjct  60   TSDMKRRCCDELSAIP-AYCRCEALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSY 116
Query  134  AASL--PAFCNVDIPNGTGGVCYWL--GY 158
            AA+L  P  CN+   +G+   C  L  GY
Sbjct  117  AANLVTPQECNLGTIHGSA-YCPELQPGY 144

Sequence Alignment: 24. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 35.9 bits 184,  Expect = 0.0006
 Identities = 45/128 35%, Positives = 71/128 55%, Gaps = 21/128 16%
Query  14   IIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAV 73
            +++++L ATAT           S+G+ C PG   P   L  CR  V  Q + H  P   +
Sbjct  13   VMLAILVATAT-----------SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPR-LL 59
Query  74   DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERA 133
               +++ CC +L+A+  ++CRC AL  ++ G+    GA + G    +  P C R      
Sbjct  60   TSDMKRRCCDELSAIP-AYCRCEALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSY 116
Query  134  AASL--PAFCNVDIPNGTGGVCYWL--GY 158
            AA+L  P  CN+   +G+   C  L  GY
Sbjct  117  AANLVTPQECNLGTIHGSA-YCPELQPGY 144

Sequence Alignment: 25. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 35.8 bits 183,  Expect = 0.0007
 Identities = 41/120 34%, Positives = 67/120 55%, Gaps = 18/120 15%
Query  14   IIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAV 73
            +++++L ATAT           S+G+ C PG   P   L  CR  V  Q + H  P   +
Sbjct  13   VMLAILVATAT-----------SFGDSCAPGDALPHNPLRACRTYVVSQ-ICHQGPR-LL 59
Query  74   DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERA 133
               +++ CC +L+A+  ++CRC AL  ++ G+    GA + G    +  P C R      
Sbjct  60   TSDMKRRCCDELSAIP-AYCRCEALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSY 116
Query  134  AASL--PAFCNVDIPNGT 149
            AA+L  P  CN+   +G+
Sbjct  117  AANLVTPQECNLGTIHGS 134

Sequence Alignment: 26. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 35.2 bits 179,  Expect = 0.0008
 Identities = 37/98 37%, Positives = 49/98 50%, Gaps = 15/98 15%
Query  38   GERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQL----RQDCCRQLAAVDDSW- 92
            G  C PGMG P   L  CR  V +Q  G G  G  V  +     R  CC++L   D S  
Sbjct  2    GPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKEL--YDASQH 59
Query  93   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
            C C A+ + +G        +D    + + +PGC R     +A  L  P  CNV
Sbjct  60   CWCEAVRYFIG------RTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNV 106

Sequence Alignment: 27. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 35.2 bits 179,  Expect = 0.0008
 Identities = 38/98 38%, Positives = 50/98 51%, Gaps = 15/98 15%
Query  38   GERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQL----RQDCCRQLAAVDDSW- 92
            G  C  GMG P+  L  CR  V +Q  G    G AV  +     R  CC++L   D S  
Sbjct  2    GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQH 59
Query  93   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
            CRC A+ + +G   R    +D    + + +PGC R      A  L  P  CNV
Sbjct  60   CRCEAVRYFIG---RR---SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNV 106

Sequence Alignment: 28. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 34.6 bits 174,  Expect = 0.002
 Identities = 49/135 36%, Positives = 71/135 52%, Gaps = 18/135 13%
Query  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA-VV 59
            MAS+   F     +++SVLA  A   +  KD+        CQ G+ +P   L  C   V+
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLESVKDE--------CQLGVDFPHNPLATCHTYVI 52
Query  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            KR C G G P   +   +++ CCR+LAAV D  CRC AL  ++ G+    G    G  + 
Sbjct  53   KRVC-GRG-PSRPM--LVKERCCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGR-LG 106
Query  120  EVFPGCRRGDLERAAASL--PAFCNVDIPNGTG 150
            +    C R +    AA+L   A CN+      G
Sbjct  107  DRRD-CPREEQRAFAATLVTAAECNLSSVQAPG 138

Sequence Alignment: 29. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 33.9 bits 169,  Expect = 0.002
 Identities = 45/128 35%, Positives = 65/128 50%, Gaps = 24/128 18%
Query  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MAS       L  ++VS++AA A + +           E C P M   +  LP CR  V+
Sbjct  1    MASKSNCVLLLAAVLVSIFAAVAAIGN-----------EDCTPWMSTLITPLPSCRDYVE 49
Query  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            +Q      PG       +Q CC +LA +    CRC AL + +G   R     D    M  
Sbjct  50   QQACRIETPGSPY--LAKQQCCGELANIPQQ-CRCQALRYFMGPKSRP----DQSGLME- 101
Query  121  VFPGCRRG---DLERAAASLPAFCNVDIPNGT 149
             +PGC R    D+ R   + P +CN+   + T
Sbjct  102  -LPGCPREVQMDFVRILVT-PGYCNLTTVHNT 131

Sequence Alignment: 30. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 33.8 bits 168,  Expect = 0.003
 Identities = 53/121 43%, Positives = 68/121 56%, Gaps = 32/121 26%
Query  1    MASNKVVFSALLL--IIVSVLAA-TATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA 57
            MAS K   S LLL  ++VSV+AA TAT             G  C  GMG P+  L  CR 
Sbjct  1    MAS-KSSISPLLLATVLVSVFAAATAT-------------GPYCYAGMGLPINPLEGCRE 46
Query  58   VVKRQCVGHGAPGGAVDEQL----RQDCCRQLAAVDDSW-CRCSALNHMVGGIYRELGAT 112
             V +Q  G    G AV  +     R  CC++L   D S  CRC A+ + +G   R    +
Sbjct  47   YVAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG---RR---S 98
Query  113  DVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
            D    + + +PGC R      A  L     CNV
Sbjct  99   DPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNV 131

Sequence Alignment: 31. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 32.4 bits 158,  Expect = 0.007
 Identities = 44/125 35%, Positives = 65/125 52%, Gaps = 30/125 24%
Query  1    MASNK---VVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA 57
            MAS     ++F+ALL+ I + +AA                 E C P     +  LP CR 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVGN--------------EDCTPWTSTLITPLPSCRN 46
Query  58   VVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 117
             V+ Q      PG       +Q+CC QLA +    CRC AL + +G   R     D    
Sbjct  47   YVEEQACRIEMPGPPY--LAKQECCEQLANIPQQ-CRCQALRYFMGPKSRP----DQSGL 99
Query  118  MAEVFPGCRRGDLERAAASL---PAFCNVDIPNGT 149
            M   +PGC R +++     +   P +CN+   + T
Sbjct  100  ME--LPGCPR-EVQMNFVPILVTPGYCNLTTVHNT 131

Sequence Alignment: 32. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 32.4 bits 158,  Expect = 0.007
 Identities = 44/125 35%, Positives = 65/125 52%, Gaps = 30/125 24%
Query  1    MASNK---VVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA 57
            MAS     ++F+ALL+ I + +AA                 E C P     +  LP CR 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVGN--------------EDCTPWTSTLITPLPSCRN 46
Query  58   VVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 117
             V+ Q      PG       +Q+CC QLA +    CRC AL + +G   R     D    
Sbjct  47   YVEEQACRIEMPGPPY--LAKQECCEQLANIPQQ-CRCQALRYFMGPKSRP----DQSGL 99
Query  118  MAEVFPGCRRGDLERAAASL---PAFCNVDIPNGT 149
            M   +PGC R +++     +   P +CN+   + T
Sbjct  100  ME--LPGCPR-EVQMNFVPILVTPGYCNLTTVHNT 131

Sequence Alignment: 33. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 32.2 bits 156,  Expect = 0.008
 Identities = 46/128 35%, Positives = 65/128 50%, Gaps = 24/128 18%
Query  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MAS       L  ++VS++AA A +             E C P    P+  LP CR  V+
Sbjct  1    MASKSSCDLLLAAVLVSIFAAVAAVGS-----------EDCTPWTATPITPLPSCRDYVE 49
Query  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            +Q      PG       +Q CC +LA +    CRC AL   +G   R+      G  + E
Sbjct  50   QQACRIETPGPPY--LAKQQCCGELANIPQQ-CRCQALRFFMG---RKSRPDQSG--LME 101
Query  121  VFPGCRRG---DLERAAASLPAFCNVDIPNGT 149
            + PGC R    D+ R   + P FCN+   + T
Sbjct  102  L-PGCPREVQMDFVRILVT-PGFCNLTTVHNT 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.