The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA07710 Ory s TAI 166 1184 179.2 5.2e-47
BAA02000 Ory s TAI 166 1100 167.2 2e-43
BAA01998 Ory s TAI 165 1084 165.0 9.9e-43
BAA07711 Ory s TAI 160 1025 156.5 3.2e-40
BAA01997 Ory s TAI 162 906 139.6 4e-35
BAA07713 Ory s TAI 160 871 134.7 1.3e-33
BAA01996 Ory s TAI 157 869 134.4 1.5e-33
BAA07712 Ory s TAI 157 810 126.0 5.1e-31
BAA07772 Ory s TAI 111 754 117.8 1e-28
BAA07773 Ory s TAI 109 720 113.0 2.8e-27
BAA07774 Ory s TAI 113 711 111.7 7e-27
AAB99797 Ory s TAI 157 635 101.1 1.6e-23
P16968 Hor v 1 146 499 81.7 9.8e-18
P16968 Hor v 15.0101 146 499 81.7 9.8e-18
BAA01999 Ory s TAI 95 441 73.3 2.2e-15
CAA08836 Hor v 1 152 372 63.7 2.7e-12
CBA13560 Tri a 15.0101 121 369 63.2 3.2e-12
P01083 Tri a TAI 123 367 62.9 3.9e-12
CAI84642 Tri a 28.0101 119 276 49.9 3e-08
P01085 Tri a TAI 124 276 50.0 3.1e-08
P01084 Tri a TAI 124 262 48.0 1.2e-07
P01086 Hor v 1 144 177 36.0 0.00058
CAA46705 Hor v 1 148 177 36.0 0.00059
CAA35188 Hor v 1 144 176 35.8 0.00064
CAA49556 Hor v 1 149 172 35.3 0.00097
CAA34709 Tri a TAI 143 169 34.8 0.0013
CAA39099 Tri a TAI 145 169 34.8 0.0013
CAZ76052 Tri a 29.0101 120 164 34.0 0.0019
CBA13559 Tri a 29.0201 120 163 33.9 0.002
CAA31794 Hor v 1 147 164 34.1 0.0021
CAA42453 Tri a TAI 143 159 33.4 0.0034
Q41540 Tri a 40.0101 143 159 33.4 0.0034
CAA35598 Tri a TAI 145 153 32.6 0.0062
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 179.2 bits 1184,  Expect = 5e-47
 Identities = 166/166 100%, Positives = 166/166 100%, Gaps = 0/166 0%
Query  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 167.2 bits 1100,  Expect = 2e-43
 Identities = 155/166 93%, Positives = 156/166 93%, Gaps = 0/166 0%
Query  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCV    P    +EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 165.0 bits 1084,  Expect = 1e-42
 Identities = 155/165 93%, Positives = 157/165 95%, Gaps = 1/165 0%
Query  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVVFSALLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
Sbjct  1    MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
Query  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCV T  P A  +EQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
Sbjct  61   RQCVGTRSPGAV-DEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 156.5 bits 1025,  Expect = 3e-40
 Identities = 145/156 92%, Positives = 146/156 93%, Gaps = 1/156 0%
Query  11   LLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVATAHPA 70
            LLLIIVSVLAAT  MADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCV    P 
Sbjct  4    LLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPG 63
Query  71   ARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 130
               +EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL
Sbjct  64   GAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDL 123
Query  131  ERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 166
            ERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  124  ERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 139.6 bits 906,  Expect = 4e-35
 Identities = 127/161 78%, Positives = 142/161 88%, Gaps = 6/161 3%
Query  1    MASNKVVFSALLLIIVSVLAAT-GPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +RQCV     AA  +EQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMA
Sbjct  58   RRQCVGRGASAA--DEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMA 115
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            EVFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  116  EVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 134.7 bits 871,  Expect = 1e-33
 Identities = 124/154 80%, Positives = 135/154 87%, Gaps = 3/154 1%
Query  1    MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+    CQPGMGYPMY LPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRALV 60
Query  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            KRQCV     AA   EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  61   KRQCVGRGTAAA--AEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 118
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  119  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 134.4 bits 869,  Expect = 2e-33
 Identities = 125/151 82%, Positives = 137/151 90%, Gaps = 6/151 3%
Query  1    MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+   RCQPGMGYPMYSLPRCRA+V
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPMYSLPRCRALV 59
Query  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            KRQC  +A  A    EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCRGSAAAA----EQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 115
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  116  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 126.0 bits 810,  Expect = 5e-31
 Identities = 117/157 74%, Positives = 132/157 84%, Gaps = 9/157 5%
Query  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MASNKVV  ALL+++VSVLAAT  MADHH++QVVY+ G+ CQPG+GYP Y LPRCRA VK
Sbjct  1    MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFVK 60
Query  61   RQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 120
            RQCVA   P    +EQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHPMAE
Sbjct  61   RQCVA---PGTL-DEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAE 116
Query  121  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            VF GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  117  VFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 117.8 bits 754,  Expect = 1e-28
 Identities = 103/111 92%, Positives = 103/111 92%, Gaps = 0/111 0%
Query  56   RAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 115
            R  VKRQCVAT HPAA G EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  116  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 113.0 bits 720,  Expect = 3e-27
 Identities = 99/108 91%, Positives = 101/108 93%, Gaps = 1/108 0%
Query  58   VVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 117
            VVKRQCVAT       +EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP
Sbjct  2    VVKRQCVATRRTGG-ADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 60
Query  118  MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            MAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   MAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 111.7 bits 711,  Expect = 7e-27
 Identities = 96/107 89%, Positives = 98/107 91%, Gaps = 0/107 0%
Query  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +RQCV       R  +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 101.1 bits 635,  Expect = 2e-23
 Identities = 98/151 64%, Positives = 110/151 72%, Gaps = 6/151 3%
Query  1    MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL +VSVLAAT  MA+ HH+DQVVY+ G  CQPGMGYPMY L R   V 
Sbjct  1    MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGVG 59
Query  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +   +  A P  R    +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   EAPLLGRARPRRRA---VPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMS 116
Query  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 156
            EVF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  117  EVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 81.7 bits 499,  Expect = 1e-17
 Identities = 73/126 57%, Positives = 88/126 69%, Gaps = 9/126 7%
Query  33   VVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSW 92
            V  S GE C PGMGYP+Y +PRCRA+VK QC        +  E +++DCCRQ+AA+ D W
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEW 66
Query  93   CRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPN--G 148
            C C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA CN  IPN  G
Sbjct  67   CICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG 126
Query  149  TGGVCYWLGYPRTPR 163
            T GVCYWL Y + PR
Sbjct  127  TDGVCYWLSYYQPPR 141

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 81.7 bits 499,  Expect = 1e-17
 Identities = 73/126 57%, Positives = 88/126 69%, Gaps = 9/126 7%
Query  33   VVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSW 92
            V  S GE C PGMGYP+Y +PRCRA+VK QC        +  E +++DCCRQ+AA+ D W
Sbjct  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEW 66
Query  93   CRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPN--G 148
            C C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA CN  IPN  G
Sbjct  67   CICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG 126
Query  149  TGGVCYWLGYPRTPR 163
            T GVCYWL Y + PR
Sbjct  127  TDGVCYWLSYYQPPR 141

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 73.3 bits 441,  Expect = 2e-15
 Identities = 65/94 69%, Positives = 78/94 82%, Gaps = 6/94 6%
Query  1    MASNKVVFSALLLIIVSVLAAT-GPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
Query  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN 99
            +RQCV     AA  +EQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  58   RRQCVGRGASAA--DEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 16. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 63.7 bits 372,  Expect = 3e-12
 Identities = 60/136 44%, Positives = 85/136 62%, Gaps = 14/136 10%
Query  9    SALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVATAH 68
            S LL++++ +L  T PM     D     +   C P MG+ +  L RCRA+VK +CV    
Sbjct  8    SMLLVLLLCMLMVT-PMTGARSDNSGPWM--WCDPEMGHKVSPLTRCRALVKLECVGNRV 64
Query  69   PAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRG 128
            P     E + +DCC+++A + + WCRC  L  M+  +Y  LG   VG    EVFPGC++ 
Sbjct  65   P-----EDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VGGGPEEVFPGCQKD 116
Query  129  DLERAAASLPAFCNVDIPN---GTGGVCYW 155
             ++   A +PA+CNV IPN   GT GVCYW
Sbjct  117  VMKLLVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 17. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 63.2 bits 369,  Expect = 3e-12
 Identities = 56/110 50%, Positives = 76/110 69%, Gaps = 12/110 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C P  GY + +L  CRA+VK QCV +  P     E + +DCC+QLA V++ WCRC  L+ 
Sbjct  7    CDPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADVNNEWCRCEDLSS 61
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCYWLG 157
            M+  +Y+ELGA + G    EV+PGCR+  ++  AAS+P    V IPN +G   GVCYW  
Sbjct  62   MLRSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAA 117
Query  158  YP 159
            YP
Sbjct  118  YP 119

Sequence Alignment: 18. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 62.9 bits 367,  Expect = 4e-12
 Identities = 55/110 50%, Positives = 76/110 69%, Gaps = 14/110 12%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C P  GY + +L  CRA+VK QCV +  P     E + +DCC+QLA +++ WCRC  L+ 
Sbjct  7    CNPATGYKVSALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSS 61
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--W 155
            M+  +Y+ELG  + G    EV+PGCR+  ++  AAS+P  C V IPN +G   GVCY  W
Sbjct  62   MLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDW 117
Query  156  LGYP 159
              YP
Sbjct  118  AAYP 121

Sequence Alignment: 19. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 49.9 bits 276,  Expect = 3e-08
 Identities = 44/106 41%, Positives = 66/106 62%, Gaps = 11/106 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C PG  + + +LP CR +++ QC  +  P     E + +DCC+QLA + + WCRC AL  
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS 54
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153
            M+  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  55   MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 50.0 bits 276,  Expect = 3e-08
 Identities = 44/106 41%, Positives = 66/106 62%, Gaps = 11/106 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C PG  + + +LP CR +++ QC  +  P     E + +DCC+QLA + + WCRC AL  
Sbjct  6    CYPGQAFQVPALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS 59
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153
            M+  +Y+E GA + G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  60   MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 48.0 bits 262,  Expect = 1e-07
 Identities = 43/106 40%, Positives = 65/106 61%, Gaps = 11/106 10%
Query  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH 100
            C PG  + + +LP CR ++K QC  +  P     E + +DCC+QLA + + W RC AL  
Sbjct  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYS 59
Query  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153
            M+  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  60   MLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 36.0 bits 177,  Expect = 0.0006
 Identities = 41/115 35%, Positives = 61/115 53%, Gaps = 14/115 12%
Query  36   SLGERCQPGMGYPMYSLPRCRA-VVKRQCVATAHPAARG-NEQLRQDCCRQLAAVDDSWC 93
            S+G+ C PG   P   L  CR  VV + C    H   R     +++ CC +L+A+  ++C
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQIC----HQGPRLLTSDMKRRCCDELSAIP-AYC 78
Query  94   RCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGTGG 151
            RC AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+  
Sbjct  79   RCEALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA- 135
Query  152  VCYWL--GY 158
             C  L  GY
Sbjct  136  YCPELQPGY 144

Sequence Alignment: 23. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 36.0 bits 177,  Expect = 0.0006
 Identities = 41/115 35%, Positives = 61/115 53%, Gaps = 14/115 12%
Query  36   SLGERCQPGMGYPMYSLPRCRA-VVKRQCVATAHPAARG-NEQLRQDCCRQLAAVDDSWC 93
            S+G+ C PG   P   L  CR  VV + C    H   R     +++ CC +L+A+  ++C
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQIC----HQGPRLLTSDMKRRCCDELSAIP-AYC 78
Query  94   RCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGTGG 151
            RC AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+  
Sbjct  79   RCEALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGSA- 135
Query  152  VCYWL--GY 158
             C  L  GY
Sbjct  136  YCPELQPGY 144

Sequence Alignment: 24. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 35.8 bits 176,  Expect = 0.0006
 Identities = 37/107 34%, Positives = 57/107 53%, Gaps = 11/107 10%
Query  36   SLGERCQPGMGYPMYSLPRCRA-VVKRQCVATAHPAARG-NEQLRQDCCRQLAAVDDSWC 93
            S+G+ C PG   P   L  CR  VV + C    H   R     +++ CC +L+A+  ++C
Sbjct  24   SFGDSCAPGDALPHNPLRACRTYVVSQIC----HQGPRLLTSDMKRRCCDELSAIP-AYC 78
Query  94   RCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGT 149
            RC AL  ++ G+    GA + G    +  P C R      AA+L  P  CN+   +G+
Sbjct  79   RCEALRIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTIHGS 134

Sequence Alignment: 25. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 35.3 bits 172,  Expect = 0.001
 Identities = 46/127 36%, Positives = 65/127 51%, Gaps = 26/127 20%
Query  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MAS       L  ++VS++AA   +             E C P    P+  LP CR  V+
Sbjct  1    MASKSSCDLLLAAVLVSIFAAVAAVG-----------SEDCTPWTATPITPLPSCRDYVE 49
Query  61   RQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +Q      P   G   L +Q CC +LA +    CRC AL   +G   R+      G  + 
Sbjct  50   QQACRIETP---GPPYLAKQQCCGELANIPQQ-CRCQALRFFMG---RKSRPDQSG--LM 100
Query  120  EVFPGCRRG---DLERAAASLPAFCNVDIPNGT 149
            E+ PGC R    D+ R   + P FCN+   + T
Sbjct  101  EL-PGCPREVQMDFVRILVT-PGFCNLTTVHNT 131

Sequence Alignment: 26. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 34.8 bits 169,  Expect = 0.001
 Identities = 45/127 35%, Positives = 66/127 51%, Gaps = 26/127 20%
Query  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK 60
            MAS       L  ++VS++AA   + +           E C P M   +  LP CR  V+
Sbjct  1    MASKSNCVLLLAAVLVSIFAAVAAIGN-----------EDCTPWMSTLITPLPSCRDYVE 49
Query  61   RQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
            +Q      P   G+  L +Q CC +LA +    CRC AL + +G   R     D    M 
Sbjct  50   QQACRIETP---GSPYLAKQQCCGELANIPQQ-CRCQALRYFMGPKSR----PDQSGLME 101
Query  120  EVFPGCRRG---DLERAAASLPAFCNVDIPNGT 149
              +PGC R    D+ R   + P +CN+   + T
Sbjct  102  --LPGCPREVQMDFVRILVT-PGYCNLTTVHNT 131

Sequence Alignment: 27. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 34.8 bits 169,  Expect = 0.001
 Identities = 49/122 40%, Positives = 65/122 53%, Gaps = 30/122 24%
Query  1    MASNKVVFSALLL-IIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
            MAS   +   LL  ++VSV+AA              + G  C PGMG P   L  CR  V
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAA------------ATGPYCYPGMGLPSNPLEGCREYV 48
Query  60   KRQ-C----VATAHPAARGNEQLRQDCCRQLAAVDDSW-CRCSALNHMVGGIYRELGATD 113
             +Q C    V +      GN   R  CC++L   D S  CRC A+ + +G   R    +D
Sbjct  49   AQQTCGVGIVGSPVSTEPGNTP-RDRCCKEL--YDASQHCRCEAVRYFIG---R---TSD 99
Query  114  VGHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
                + + +PGC R      A  L  P  CNV
Sbjct  100  PNSGVLKDLPGCPREPQRDFAKVLVTPGHCNV 131

Sequence Alignment: 28. Allergen Name: Tri a 29.0101 Sequence ID: CAZ76052

 Score = 34.0 bits 164,  Expect = 0.002
 Identities = 37/98 37%, Positives = 50/98 51%, Gaps = 15/98 15%
Query  38   GERCQPGMGYPMYSLPRCRAVVKRQ-CVATAHPAARGNEQL---RQDCCRQLAAVDDSW- 92
            G  C  GMG P+  L  CR  V +Q C  +   +A   E     R  CC++L   D S  
Sbjct  2    GPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQH 59
Query  93   CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
            CRC A+ + +G   R    +D    + + +PGC R      A  L  P  CNV
Sbjct  60   CRCEAVRYFIG---RR---SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNV 106

Sequence Alignment: 29. Allergen Name: Tri a 29.0201 Sequence ID: CBA13559

 Score = 33.9 bits 163,  Expect = 0.002
 Identities = 37/97 38%, Positives = 49/97 50%, Gaps = 17/97 17%
Query  38   GERCQPGMGYPMYSLPRCRAVVKRQ-C----VATAHPAARGNEQLRQDCCRQLAAVDDSW 92
            G  C PGMG P   L  CR  V +Q C    V +      GN   R  CC++L   D S 
Sbjct  2    GPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTP-RDRCCKEL--YDASQ 58
Query  93   -CRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
             C C A+ + +G        +D    + + +PGC R     +A  L  P  CNV
Sbjct  59   HCWCEAVRYFIG------RTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNV 106

Sequence Alignment: 30. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 34.1 bits 164,  Expect = 0.002
 Identities = 47/132 35%, Positives = 69/132 52%, Gaps = 24/132 18%
Query  1    MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA-VV 59
            MAS+   F     +++SVLA      +  KD+        CQ G+ +P   L  C   V+
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLESVKDE--------CQLGVDFPHNPLATCHTYVI 52
Query  60   KRQCVATAHPAARGNEQ---LRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH 116
            KR C        RG  +   +++ CCR+LAAV D  CRC AL  ++ G+    G    G 
Sbjct  53   KRVC-------GRGPSRPMLVKERCCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGR 104
Query  117  PMAEVFPGCRRGDLERAAASL--PAFCNVDIPNGTG 150
             + +    C R +    AA+L   A CN+      G
Sbjct  105  -LGDRRD-CPREEQRAFAATLVTAAECNLSSVQAPG 138

Sequence Alignment: 31. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 33.4 bits 159,  Expect = 0.003
 Identities = 46/124 37%, Positives = 67/124 54%, Gaps = 32/124 25%
Query  1    MASNK---VVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA 57
            MAS     ++F+ALL+ I + +AA G               E C P     +  LP CR 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVG--------------NEDCTPWTSTLITPLPSCRN 46
Query  58   VVKRQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH 116
             V+ Q      P   G   L +Q+CC QLA +    CRC AL + +G   R     D   
Sbjct  47   YVEEQACRIEMP---GPPYLAKQECCEQLANIPQQ-CRCQALRYFMGPKSR----PDQSG 98
Query  117  PMAEVFPGCRRGDLERAAASL---PAFCNVDIPNGT 149
             M   +PGC R +++     +   P +CN+   + T
Sbjct  99   LME--LPGCPR-EVQMNFVPILVTPGYCNLTTVHNT 131

Sequence Alignment: 32. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 33.4 bits 159,  Expect = 0.003
 Identities = 46/124 37%, Positives = 67/124 54%, Gaps = 32/124 25%
Query  1    MASNK---VVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRA 57
            MAS     ++F+ALL+ I + +AA G               E C P     +  LP CR 
Sbjct  1    MASKSNYNLLFTALLVFIFAAVAAVG--------------NEDCTPWTSTLITPLPSCRN 46
Query  58   VVKRQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH 116
             V+ Q      P   G   L +Q+CC QLA +    CRC AL + +G   R     D   
Sbjct  47   YVEEQACRIEMP---GPPYLAKQECCEQLANIPQQ-CRCQALRYFMGPKSR----PDQSG 98
Query  117  PMAEVFPGCRRGDLERAAASL---PAFCNVDIPNGT 149
             M   +PGC R +++     +   P +CN+   + T
Sbjct  99   LME--LPGCPR-EVQMNFVPILVTPGYCNLTTVHNT 131

Sequence Alignment: 33. Allergen Name: Tri a TAI Sequence ID: CAA35598

 Score = 32.6 bits 153,  Expect = 0.006
 Identities = 49/122 40%, Positives = 66/122 54%, Gaps = 30/122 24%
Query  1    MASNKVVFSALLL--IIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAV 58
            MAS K   S LLL  ++VSV+AA              + G  C  GMG P+  L  CR  
Sbjct  1    MAS-KSSISPLLLATVLVSVFAAAT------------ATGPYCYAGMGLPINPLEGCREY 47
Query  59   VKRQ-CVATAHPAARGNEQL---RQDCCRQLAAVDDSW-CRCSALNHMVGGIYRELGATD 113
            V +Q C  +   +A   E     R  CC++L   D S  CRC A+ + +G   R    +D
Sbjct  48   VAQQTCGISISGSAVSTEPGNTPRDRCCKEL--YDASQHCRCEAVRYFIG---RR---SD 99
Query  114  VGHPMAEVFPGCRRGDLERAAASL--PAFCNV 143
                + + +PGC R      A  L     CNV
Sbjct  100  PNSSVLKDLPGCPREPQRDFAKVLVTSGHCNV 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.