The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ
CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA01999 Ory s TAI 95 668 102.9 1.5e-24
BAA01997 Ory s TAI 162 668 103.2 2.2e-24
BAA02000 Ory s TAI 166 478 76.8 1.9e-16
BAA07713 Ory s TAI 160 460 74.3 1.1e-15
BAA01998 Ory s TAI 165 457 73.9 1.4e-15
BAA07710 Ory s TAI 166 441 71.7 6.7e-15
BAA01996 Ory s TAI 157 420 68.8 4.9e-14
BAA07712 Ory s TAI 157 420 68.8 4.9e-14
BAA07711 Ory s TAI 160 412 67.7 1.1e-13
AAB99797 Ory s TAI 157 294 51.3 8.9e-09
P16968 Hor v 15.0101 146 268 47.6 1e-07
P16968 Hor v 1 146 268 47.6 1e-07
BAA07773 Ory s TAI 109 208 39.2 2.7e-05
P01083 Tri a TAI 123 205 38.8 3.9e-05
CAI84642 Tri a 28.0101 119 203 38.5 4.6e-05
P01085 Tri a TAI 124 203 38.6 4.8e-05
CBA13560 Tri a 15.0101 121 194 37.3 0.00011
BAA07772 Ory s TAI 111 193 37.1 0.00012
CAA08836 Hor v 1 152 194 37.4 0.00013
CAA31794 Hor v 1 147 192 37.1 0.00015
BAA07774 Ory s TAI 113 181 35.5 0.00037
P01084 Tri a TAI 124 181 35.5 0.00039
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 102.9 bits 668,  Expect = 2e-24
 Identities = 95/95 100%, Positives = 95/95 100%, Gaps = 0/95 0%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD
Sbjct  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 103.2 bits 668,  Expect = 2e-24
 Identities = 95/95 100%, Positives = 95/95 100%, Gaps = 0/95 0%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD
Sbjct  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 76.8 bits 478,  Expect = 2e-16
 Identities = 70/94 74%, Positives = 82/94 87%, Gaps = 6/94 6%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFS LLL+++SVLAA  ATMADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSALLLIIVSVLAAT-ATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  58   RRQCVGRGA--SAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            +RQCVG GA   A DEQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALN 99

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 74.3 bits 460,  Expect = 1e-15
 Identities = 69/93 74%, Positives = 79/93 84%, Gaps = 5/93 5%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+P   C+PG+ YP Y LP+CR L
Sbjct  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
Query  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            V+RQCVGRG +AA EQV +DCCRQLAAVDD WCRC A+
Sbjct  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAI 97

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 73.9 bits 457,  Expect = 1e-15
 Identities = 66/94 70%, Positives = 79/94 84%, Gaps = 5/94 5%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSALLLIIVSVLAAT-TRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  58   RRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            +RQCVG R   A DEQ+ QDCCR+LAAVDD WCRC AL+
Sbjct  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALN 98

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 71.7 bits 441,  Expect = 7e-15
 Identities = 65/94 69%, Positives = 78/94 82%, Gaps = 6/94 6%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSALLLIIVSVLAAT-GPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  58   RRQCVGRGASAA--DEQVWQDCCRQLAAVDDGWCRCGALD 95
            +RQCV     AA  +EQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN 99

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 68.8 bits 420,  Expect = 5e-14
 Identities = 65/91 71%, Positives = 77/91 84%, Gaps = 6/91 6%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHH---QVYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFSVLLL V+SVLAA  ATMA++H   QV     +C+PG+ YP YSLP+CR LV
Sbjct  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
Query  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            +RQC  RG++AA EQV +DCCRQLAAVDD WCRC A+
Sbjct  60   KRQC--RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAI 94

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 68.8 bits 420,  Expect = 5e-14
 Identities = 62/92 67%, Positives = 73/92 79%, Gaps = 6/92 6%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVV   LL+VV+SVLAA   TMADHHQ   VY+PG+ C+PGI YPTY LP+CR +V
Sbjct  1    MASNKVVIPALLVVVVSVLAAT-TTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
Query  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            +RQCV  G    DEQV + CCRQLA +D  WCRC AL+
Sbjct  60   KRQCVAPGT--LDEQVRRGCCRQLAGIDSSWCRCDALN 95

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 67.7 bits 412,  Expect = 1e-13
 Identities = 59/84 70%, Positives = 71/84 84%, Gaps = 6/84 7%
Query  11   LLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGA- 66
            LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V+RQCVG GA 
Sbjct  4    LLLIIVSVLAATR-RMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
Query  67   -SAADEQVWQDCCRQLAAVDDGWCRCGALD 95
              A DEQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALN 92

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 51.3 bits 294,  Expect = 9e-09
 Identities = 53/91 58%, Positives = 63/91 69%, Gaps = 7/91 7%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+PG  C+PG+ YP Y L +   +
Sbjct  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGV 58
Query  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
                 +GR A      V  DCCRQ+  VD  WCRC A+
Sbjct  59   GEAPLLGR-ARPRRRAVPGDCCRQFPPVDYSWCRCEAI 95

Sequence Alignment: 11. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 47.6 bits 268,  Expect = 1e-07
 Identities = 33/58 56%, Positives = 41/58 70%, Gaps = 3/58 5%
Query  34   SPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGA 93
            SPGE C PG+ YP Y +P+CR LV+ QC G       E + +DCCRQ+AA+ D WC CGA
Sbjct  15   SPGEWCWPGMGYPVYPFPRCRALVKSQCAG---GQVVESIQKDCCRQIAAIGDEWCICGA 71
Query  94   L 94
            L
Sbjct  72   L 72

Sequence Alignment: 12. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 47.6 bits 268,  Expect = 1e-07
 Identities = 33/58 56%, Positives = 41/58 70%, Gaps = 3/58 5%
Query  34   SPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGA 93
            SPGE C PG+ YP Y +P+CR LV+ QC G       E + +DCCRQ+AA+ D WC CGA
Sbjct  15   SPGEWCWPGMGYPVYPFPRCRALVKSQCAG---GQVVESIQKDCCRQIAAIGDEWCICGA 71
Query  94   L 94
            L
Sbjct  72   L 72

Sequence Alignment: 13. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 39.2 bits 208,  Expect = 3e-05
 Identities = 28/40 70%, Positives = 32/40 80%, Gaps = 1/40 2%
Query  56   LVRRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            +V+RQCV  R    ADEQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALN 42

Sequence Alignment: 14. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 38.8 bits 205,  Expect = 4e-05
 Identities = 27/57 47%, Positives = 35/57 61%, Gaps = 3/57 5%
Query  35   PGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            P   C P   Y   +L  CR +V+ QCVG   S   E V +DCC+QLA +++ WCRCG L
Sbjct  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADINNEWCRCGDL 59

Sequence Alignment: 15. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 38.5 bits 203,  Expect = 5e-05
 Identities = 28/52 53%, Positives = 36/52 69%, Gaps = 4/52 7%
Query  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            C PG ++   +LP CR L+R QC G   S   E V +DCC+QLA + + WCRCGAL
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNG---SQVPEAVLRDCCQQLAHISE-WCRCGAL 52

Sequence Alignment: 16. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 38.6 bits 203,  Expect = 5e-05
 Identities = 28/52 53%, Positives = 36/52 69%, Gaps = 4/52 7%
Query  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            C PG ++   +LP CR L+R QC G   S   E V +DCC+QLA + + WCRCGAL
Sbjct  6    CYPGQAFQVPALPACRPLLRLQCNG---SQVPEAVLRDCCQQLAHISE-WCRCGAL 57

Sequence Alignment: 17. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 37.3 bits 194,  Expect = 0.0001
 Identities = 26/54 48%, Positives = 33/54 61%, Gaps = 3/54 5%
Query  35   PGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRC 91
            P   C P   Y   +L  CR +V+ QCVG   S   E V +DCC+QLA V++ WCRC
Sbjct  3    PWSWCDPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADVNNEWCRC 56

Sequence Alignment: 18. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 37.1 bits 193,  Expect = 0.0001
 Identities = 28/42 66%, Positives = 31/42 73%, Gaps = 2/42 4%
Query  54   RTLVRRQCVGRGASAAD--EQVWQDCCRQLAAVDDGWCRCGALD 95
            R  V+RQCV     AA   EQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALN 44

Sequence Alignment: 19. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 37.4 bits 194,  Expect = 0.0001
 Identities = 30/82 36%, Positives = 47/82 57%, Gaps = 4/82 4%
Query  9    SVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASA 68
            S+LL+++L +L     T A       P   C P + +    L +CR LV+ +CVG   + 
Sbjct  8    SMLLVLLLCMLMVTPMTGA-RSDNSGPWMWCDPEMGHKVSPLTRCRALVKLECVG---NR 63
Query  69   ADEQVWQDCCRQLAAVDDGWCRCGAL 94
              E V +DCC+++A + + WCRCG L
Sbjct  64   VPEDVLRDCCQEVANISNEWCRCGDL 89

Sequence Alignment: 20. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 37.1 bits 192,  Expect = 0.0002
 Identities = 39/86 45%, Positives = 52/86 60%, Gaps = 8/86 9%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MAS+   F +   V+LSVLA A AT+       S  ++C+ G+ +P   L  C T V ++
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLE------SVKDECQLGVDFPHNPLATCHTYVIKR 54
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
              GRG S     V + CCR+LAAV D  CRC AL
Sbjct  55   VCGRGPSRP-MLVKERCCRELAAVPDH-CRCEAL 86

Sequence Alignment: 21. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 35.5 bits 181,  Expect = 0.0004
 Identities = 25/38 65%, Positives = 29/38 76%, Gaps = 2/38 5%
Query  58   RRQCVG--RGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            +RQCVG  R      +Q+ QDCCRQLAAVDD WCRC AL+
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALN 46

Sequence Alignment: 22. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 35.5 bits 181,  Expect = 0.0004
 Identities = 26/52 50%, Positives = 35/52 67%, Gaps = 4/52 7%
Query  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            C PG ++   +LP CR L++ QC G   S   E V +DCC+QLA + + W RCGAL
Sbjct  6    CYPGQAFQVPALPGCRPLLKLQCNG---SQVPEAVLRDCCQQLADISE-WPRCGAL 57

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.