The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ
CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG
CRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA01997 Ory s TAI 162 1162 173.9 2e-45
BAA02000 Ory s TAI 166 943 143.2 3.5e-36
BAA01998 Ory s TAI 165 922 140.2 2.7e-35
BAA07710 Ory s TAI 166 906 138.0 1.3e-34
BAA07711 Ory s TAI 160 865 132.2 6.7e-33
BAA07713 Ory s TAI 160 827 126.9 2.7e-31
BAA01996 Ory s TAI 157 787 121.3 1.3e-29
BAA07712 Ory s TAI 157 763 117.9 1.3e-28
BAA01999 Ory s TAI 95 668 104.3 9.9e-25
BAA07773 Ory s TAI 109 663 103.7 1.8e-24
BAA07774 Ory s TAI 113 646 101.3 9.3e-24
BAA07772 Ory s TAI 111 637 100.1 2.2e-23
AAB99797 Ory s TAI 157 556 88.9 7.2e-20
P16968 Hor v 1 146 492 79.9 3.5e-17
P16968 Hor v 15.0101 146 492 79.9 3.5e-17
P01083 Tri a TAI 123 383 64.5 1.2e-12
CBA13560 Tri a 15.0101 121 374 63.2 2.9e-12
CAA08836 Hor v 1 152 367 62.4 6.7e-12
CAI84642 Tri a 28.0101 119 311 54.4 1.3e-09
P01085 Tri a TAI 124 311 54.4 1.4e-09
P01084 Tri a TAI 124 290 51.5 1e-08
CAA31794 Hor v 1 147 228 42.9 4.8e-06
P01086 Hor v 1 144 197 38.5 9.6e-05
CAA46705 Hor v 1 148 197 38.5 9.7e-05
CAA35188 Hor v 1 144 196 38.4 0.00011
CAA49556 Hor v 1 149 169 34.6 0.0015
CAA34709 Tri a TAI 143 162 33.6 0.0029
Q41540 Tri a 40.0101 143 158 33.1 0.0042
CAA42453 Tri a TAI 143 158 33.1 0.0042
CAA39099 Tri a TAI 145 155 32.6 0.0057
AAO32314 Car i 1.0101 143 152 32.2 0.0076
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 173.9 bits 1162,  Expect = 2e-45
 Identities = 162/162 100%, Positives = 162/162 100%, Gaps = 0/162 0%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG 120
            CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG
Sbjct  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG 120
Query  121  CRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            CRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH
Sbjct  121  CRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 143.2 bits 943,  Expect = 3e-36
 Identities = 132/161 81%, Positives = 146/161 90%, Gaps = 6/161 3%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFS LLL+++SVLAA  ATMADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSALLLIIVSVLAAT-ATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  58   RRQCVGRGA--SAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMA 115
            +RQCVG GA   A DEQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMA
Sbjct  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  116  EVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            EVFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 140.2 bits 922,  Expect = 3e-35
 Identities = 128/161 79%, Positives = 143/161 88%, Gaps = 5/161 3%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSALLLIIVSVLAAT-TRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  58   RRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAE 116
            +RQCVG R   A DEQ+ QDCCR+LAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMAE
Sbjct  60   KRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE 119
Query  117  VFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            VFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  120  VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 138.0 bits 906,  Expect = 1e-34
 Identities = 127/161 78%, Positives = 142/161 88%, Gaps = 6/161 3%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFS LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V
Sbjct  1    MASNKVVFSALLLIIVSVLAAT-GPMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVV 59
Query  58   RRQCVGRGASAA--DEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMA 115
            +RQCV     AA  +EQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMA
Sbjct  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  116  EVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            EVFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 132.2 bits 865,  Expect = 7e-33
 Identities = 121/151 80%, Positives = 135/151 89%, Gaps = 7/151 4%
Query  11   LLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGA- 66
            LLL+++SVLAA    MADHH+   VYS GE+C+PG+ YP YSLP+CR +V+RQCVG GA 
Sbjct  4    LLLIIVSVLAATR-RMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAP 62
Query  67   -SAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPGCRRGD 125
              A DEQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMAEVFPGCRRGD
Sbjct  63   GGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 122
Query  126  LERAAASLPAFCNVDIPNGPGGVCYWLGY-PRTPRTGH 162
            LERAAASLPAFCNVDIPNG GGVCYWLGY PRTPRTGH
Sbjct  123  LERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 126.9 bits 827,  Expect = 3e-31
 Identities = 119/151 78%, Positives = 131/151 86%, Gaps = 5/151 3%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+P   C+PG+ YP Y LP+CR L
Sbjct  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPAPLCQPGMGYPMYPLPRCRAL 59
Query  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAE 116
            V+RQCVGRG +AA EQV +DCCRQLAAVDD WCRC A+ HML GIYRELGA + GHPM+E
Sbjct  60   VKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSE 119
Query  117  VFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWL 152
            VF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  120  VFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 121.3 bits 787,  Expect = 1e-29
 Identities = 115/149 77%, Positives = 129/149 86%, Gaps = 6/149 4%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHH---QVYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVVFSVLLL V+SVLAA  ATMA++H   QV     +C+PG+ YP YSLP+CR LV
Sbjct  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTRARCQPGMGYPMYSLPRCRALV 59
Query  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEV 117
            +RQC  RG++AA EQV +DCCRQLAAVDD WCRC A+ HML GIYRELGA + GHPM+EV
Sbjct  60   KRQC--RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMSEV 117
Query  118  FPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWL 152
            F GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  118  FRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 117.9 bits 763,  Expect = 1e-28
 Identities = 113/154 73%, Positives = 127/154 82%, Gaps = 11/154 7%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPTYSLPQCRTLV 57
            MASNKVV   LL+VV+SVLAA   TMADHHQ   VY+PG+ C+PGI YPTY LP+CR +V
Sbjct  1    MASNKVVIPALLVVVVSVLAAT-TTMADHHQEQVVYTPGQLCQPGIGYPTYPLPRCRAFV 59
Query  58   RRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEV 117
            +RQCV  G    DEQV + CCRQLA +D  WCRC AL+HML  IYRE  A +AGHPMAEV
Sbjct  60   KRQCVAPG--TLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHPMAEV 117
Query  118  FPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            F GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  118  FRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 104.3 bits 668,  Expect = 1e-24
 Identities = 95/95 100%, Positives = 95/95 100%, Gaps = 0/95 0%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ
Sbjct  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95
            CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD
Sbjct  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 103.7 bits 663,  Expect = 2e-24
 Identities = 88/107 82%, Positives = 95/107 88%, Gaps = 1/107 0%
Query  56   LVRRQCVG-RGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPM 114
            +V+RQCV  R    ADEQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPM
Sbjct  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
Query  115  AEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            AEVFPGCRRGDLERA A+LPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 101.3 bits 646,  Expect = 9e-24
 Identities = 87/105 82%, Positives = 93/105 88%, Gaps = 2/105 1%
Query  58   RRQCVG--RGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMA 115
            +RQCVG  R      +Q+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMA
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  116  EVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            EVFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 100.1 bits 637,  Expect = 2e-23
 Identities = 87/109 79%, Positives = 92/109 84%, Gaps = 2/109 1%
Query  54   RTLVRRQCVGRGASAAD--EQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAG 111
            R  V+RQCV     AA   EQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ G
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  112  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 13. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 88.9 bits 556,  Expect = 7e-20
 Identities = 91/148 61%, Positives = 103/148 69%, Gaps = 8/148 5%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYPTYSLPQCRTL 56
            MASNKVVFSVLLL V+SVLAA  ATMA+ HHQ   VY+PG  C+PG+ YP Y L +   +
Sbjct  1    MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPGPLCQPGMGYPMYPL-RVAGV 58
Query  57   VRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAE 116
                 +GR A      V  DCCRQ+  VD  WCRC A+ HML GIYRELGA + GHPM+E
Sbjct  59   GEAPLLGR-ARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSE 117
Query  117  VFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWL 152
            VF GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  118  VFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152

Sequence Alignment: 14. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 79.9 bits 492,  Expect = 3e-17
 Identities = 70/123 56%, Positives = 84/123 68%, Gaps = 7/123 5%
Query  34   SPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGA 93
            SPGE C PG+ YP Y +P+CR LV+ QC G G     E + +DCCRQ+AA+ D WC CGA
Sbjct  15   SPGEWCWPGMGYPVYPFPRCRALVKSQCAG-GQVV--ESIQKDCCRQIAAIGDEWCICGA 71
Query  94   LDHMLSGIYRELGATEAGHP--MAEVFPGCRRGDLERAAASLPAFCNVDIPN--GPGGVC 149
            L  M   +Y+ELG   A     +AEVFPGCR   ++RA ASLPA CN  IPN  G  GVC
Sbjct  72   LGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVC 131
Query  150  YWLGYPRTPR 159
            YWL Y + PR
Sbjct  132  YWLSYYQPPR 141

Sequence Alignment: 15. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 79.9 bits 492,  Expect = 3e-17
 Identities = 70/123 56%, Positives = 84/123 68%, Gaps = 7/123 5%
Query  34   SPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGA 93
            SPGE C PG+ YP Y +P+CR LV+ QC G G     E + +DCCRQ+AA+ D WC CGA
Sbjct  15   SPGEWCWPGMGYPVYPFPRCRALVKSQCAG-GQVV--ESIQKDCCRQIAAIGDEWCICGA 71
Query  94   LDHMLSGIYRELGATEAGHP--MAEVFPGCRRGDLERAAASLPAFCNVDIPN--GPGGVC 149
            L  M   +Y+ELG   A     +AEVFPGCR   ++RA ASLPA CN  IPN  G  GVC
Sbjct  72   LGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVC 131
Query  150  YWLGYPRTPR 159
            YWL Y + PR
Sbjct  132  YWLSYYQPPR 141

Sequence Alignment: 16. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 64.5 bits 383,  Expect = 1e-12
 Identities = 57/114 50%, Positives = 72/114 63%, Gaps = 12/114 10%
Query  35   PGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            P   C P   Y   +L  CR +V+ QCVG   S   E V +DCC+QLA +++ WCRCG L
Sbjct  3    PWSWCNPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADINNEWCRCGDL 59
Query  95   DHMLSGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPG---GVCY- 150
              ML  +Y+ELG  E      EV+PGCR+  ++  AAS+P  C V IPN  G   GVCY 
Sbjct  60   SSMLRSVYQELGVREG----KEVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYG 115
Query  151  -WLGYP 155
             W  YP
Sbjct  116  DWAAYP 121

Sequence Alignment: 17. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 63.2 bits 374,  Expect = 3e-12
 Identities = 57/114 50%, Positives = 71/114 62%, Gaps = 10/114 8%
Query  35   PGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94
            P   C P   Y   +L  CR +V+ QCVG   S   E V +DCC+QLA V++ WCRC  L
Sbjct  3    PWSWCDPATGYKVSALTGCRAMVKLQCVG---SQVPEAVLRDCCQQLADVNNEWCRCEDL 59
Query  95   DHMLSGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPG---GVCYW 151
              ML  +Y+ELGA E      EV+PGCR+  ++  AAS+P    V IPN  G   GVCYW
Sbjct  60   SSMLRSVYQELGAREG----KEVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYW 115
Query  152  LGYP 155
              YP
Sbjct  116  AAYP 119

Sequence Alignment: 18. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 62.4 bits 367,  Expect = 7e-12
 Identities = 58/136 42%, Positives = 82/136 60%, Gaps = 10/136 7%
Query  9    SVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASA 68
            S+LL+++L +L     T A       P   C P + +    L +CR LV+ +CVG   + 
Sbjct  8    SMLLVLLLCMLMVTPMTGA-RSDNSGPWMWCDPEMGHKVSPLTRCRALVKLECVG---NR 63
Query  69   ADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPGCRRGDLER 128
              E V +DCC+++A + + WCRCG L  ML  +Y  LG    G P  EVFPGC++  ++ 
Sbjct  64   VPEDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALGV--GGGP-EEVFPGCQKDVMKL 120
Query  129  AAASLPAFCNVDIPN---GPGGVCYW 151
              A +PA+CNV IPN   G  GVCYW
Sbjct  121  LVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 19. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 54.4 bits 311,  Expect = 1e-09
 Identities = 51/106 48%, Positives = 67/106 63%, Gaps = 9/106 8%
Query  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHML 98
            C PG ++   +LP CR L+R QC G   S   E V +DCC+QLA + + WCRCGAL  ML
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNG---SQVPEAVLRDCCQQLAHISE-WCRCGALYSML 56
Query  99   SGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGPGG-VC 149
              +Y+E GA E G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  57   DSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 54.4 bits 311,  Expect = 1e-09
 Identities = 51/106 48%, Positives = 67/106 63%, Gaps = 9/106 8%
Query  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHML 98
            C PG ++   +LP CR L+R QC G   S   E V +DCC+QLA + + WCRCGAL  ML
Sbjct  6    CYPGQAFQVPALPACRPLLRLQCNG---SQVPEAVLRDCCQQLAHISE-WCRCGALYSML 61
Query  99   SGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGPGG-VC 149
              +Y+E GA E G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  62   DSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 51.5 bits 290,  Expect = 1e-08
 Identities = 48/106 45%, Positives = 66/106 62%, Gaps = 9/106 8%
Query  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHML 98
            C PG ++   +LP CR L++ QC G   S   E V +DCC+QLA + + W RCGAL  ML
Sbjct  6    CYPGQAFQVPALPGCRPLLKLQCNG---SQVPEAVLRDCCQQLADISE-WPRCGALYSML 61
Query  99   SGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGPGG-VC 149
              +Y+E G +E G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  62   DSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 22. Allergen Name: Hor v 1 Sequence ID: CAA31794

 Score = 42.9 bits 228,  Expect = 5e-06
 Identities = 52/136 38%, Positives = 73/136 53%, Gaps = 12/136 8%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MAS+   F +   V+LSVLA A AT+       S  ++C+ G+ +P   L  C T V ++
Sbjct  1    MASDHRRFVLSGAVLLSVLAVAAATLE------SVKDECQLGVDFPHNPLATCHTYVIKR 54
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG 120
              GRG S     V + CCR+LAAV D  CRC AL  ++ G+    G    G  + +    
Sbjct  55   VCGRGPSRP-MLVKERCCRELAAVPDH-CRCEALRILMDGVRTPEGRVVEGR-LGDRRD- 110
Query  121  CRRGDLERAAASL--PAFCNVDIPNGPG 146
            C R +    AA+L   A CN+     PG
Sbjct  111  CPREEQRAFAATLVTAAECNLSSVQAPG 138

Sequence Alignment: 23. Allergen Name: Hor v 1 Sequence ID: P01086

 Score = 38.5 bits 197,  Expect = 0.0001
 Identities = 46/140 32%, Positives = 67/140 47%, Gaps = 13/140 9%
Query  6    VVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRG 65
            + F   LL+  +V+ A +   A      S G+ C PG + P   L  CRT V  Q   +G
Sbjct  1    MAFKYQLLLSAAVMLAILVATAT-----SFGDSCAPGDALPHNPLRACRTYVVSQICHQG 55
Query  66   ASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPGCRRGD 125
                   + + CC +L+A+   +CRC AL  ++ G+    GA E  +      P C R  
Sbjct  56   PRLLTSDMKRRCCDELSAIP-AYCRCEALRIIMQGVVTWQGAFEGAYFKDS--PNCPRER 112
Query  126  LERAAASL--PAFCNVDIPNGPGGVCYWL--GY 154
                AA+L  P  CN+   +G    C  L  GY
Sbjct  113  QTSYAANLVTPQECNLGTIHG-SAYCPELQPGY 144

Sequence Alignment: 24. Allergen Name: Hor v 1 Sequence ID: CAA46705

 Score = 38.5 bits 197,  Expect = 0.0001
 Identities = 46/140 32%, Positives = 67/140 47%, Gaps = 13/140 9%
Query  6    VVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRG 65
            + F   LL+  +V+ A +   A      S G+ C PG + P   L  CRT V  Q   +G
Sbjct  1    MAFKYQLLLSAAVMLAILVATAT-----SFGDSCAPGDALPHNPLRACRTYVVSQICHQG 55
Query  66   ASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPGCRRGD 125
                   + + CC +L+A+   +CRC AL  ++ G+    GA E  +      P C R  
Sbjct  56   PRLLTSDMKRRCCDELSAIP-AYCRCEALRIIMQGVVTWQGAFEGAYFKDS--PNCPRER 112
Query  126  LERAAASL--PAFCNVDIPNGPGGVCYWL--GY 154
                AA+L  P  CN+   +G    C  L  GY
Sbjct  113  QTSYAANLVTPQECNLGTIHG-SAYCPELQPGY 144

Sequence Alignment: 25. Allergen Name: Hor v 1 Sequence ID: CAA35188

 Score = 38.4 bits 196,  Expect = 0.0001
 Identities = 42/131 32%, Positives = 64/131 48%, Gaps = 10/131 7%
Query  6    VVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQCVGRG 65
            + F   LL+  +V+ A +   A      S G+ C PG + P   L  CRT V  Q   +G
Sbjct  1    MAFKYQLLLSAAVMLAILVATAT-----SFGDSCAPGDALPHNPLRACRTYVVSQICHQG 55
Query  66   ASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPGCRRGD 125
                   + + CC +L+A+   +CRC AL  ++ G+    GA E  +   +  P C R  
Sbjct  56   PRLLTSDMKRRCCDELSAIP-AYCRCEALRIIMQGVVTWQGAFEGAY--FKDSPNCPRER 112
Query  126  LERAAASL--PAFCNVDIPNG 144
                AA+L  P  CN+   +G
Sbjct  113  QTSYAANLVTPQECNLGTIHG 133

Sequence Alignment: 26. Allergen Name: Hor v 1 Sequence ID: CAA49556

 Score = 34.6 bits 169,  Expect = 0.001
 Identities = 46/128 35%, Positives = 64/128 50%, Gaps = 21/128 16%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MAS K    +LL  VL  + AA+A +          E C P  + P   LP CR  V +Q
Sbjct  1    MAS-KSSCDLLLAAVLVSIFAAVAAVGS--------EDCTPWTATPITPLPSCRDYVEQQ 51
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG 120
                          Q CC +LA +    CRC AL   +    R+    ++G  + E+ PG
Sbjct  52   ACRIETPGPPYLAKQQCCGELANIPQ-QCRCQALRFFMG---RKSRPDQSG--LMEL-PG 104
Query  121  CRRG---DLERAAASLPAFCNVD-IPNGP 145
            C R    D+ R   + P FCN+  + N P
Sbjct  105  CPREVQMDFVRILVT-PGFCNLTTVHNTP 132

Sequence Alignment: 27. Allergen Name: Tri a TAI Sequence ID: CAA34709

 Score = 33.6 bits 162,  Expect = 0.003
 Identities = 43/128 33%, Positives = 64/128 50%, Gaps = 21/128 16%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MAS      +L  V++S++AA  A            E C P +S     LP CR  V +Q
Sbjct  1    MASKSNCVLLLAAVLVSIFAAVAAI---------GNEDCTPWMSTLITPLPSCRDYVEQQ 51
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG 120
                    +     Q CC +LA +    CRC AL + +    R     ++G  + E+ PG
Sbjct  52   ACRIETPGSPYLAKQQCCGELANIPQ-QCRCQALRYFMGPKSRP---DQSG--LMEL-PG 104
Query  121  CRRG---DLERAAASLPAFCNVD-IPNGP 145
            C R    D+ R   + P +CN+  + N P
Sbjct  105  CPREVQMDFVRILVT-PGYCNLTTVHNTP 132

Sequence Alignment: 28. Allergen Name: Tri a 40.0101 Sequence ID: Q41540

 Score = 33.1 bits 158,  Expect = 0.004
 Identities = 42/128 32%, Positives = 66/128 51%, Gaps = 21/128 16%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MAS K  +++L+  +L  + AA+A + +        E C P  S     LP CR  V  Q
Sbjct  1    MAS-KSNYNLLFTALLVFIFAAVAAVGN--------EDCTPWTSTLITPLPSCRNYVEEQ 51
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG 120
                          Q+CC QLA +    CRC AL + +    R     ++G  + E+ PG
Sbjct  52   ACRIEMPGPPYLAKQECCEQLANIPQ-QCRCQALRYFMGPKSRP---DQSG--LMEL-PG 104
Query  121  CRRGDLERAAASL---PAFCNVD-IPNGP 145
            C R +++     +   P +CN+  + N P
Sbjct  105  CPR-EVQMNFVPILVTPGYCNLTTVHNTP 132

Sequence Alignment: 29. Allergen Name: Tri a TAI Sequence ID: CAA42453

 Score = 33.1 bits 158,  Expect = 0.004
 Identities = 42/128 32%, Positives = 66/128 51%, Gaps = 21/128 16%
Query  1    MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRRQ 60
            MAS K  +++L+  +L  + AA+A + +        E C P  S     LP CR  V  Q
Sbjct  1    MAS-KSNYNLLFTALLVFIFAAVAAVGN--------EDCTPWTSTLITPLPSCRNYVEEQ 51
Query  61   CVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMAEVFPG 120
                          Q+CC QLA +    CRC AL + +    R     ++G  + E+ PG
Sbjct  52   ACRIEMPGPPYLAKQECCEQLANIPQ-QCRCQALRYFMGPKSRP---DQSG--LMEL-PG 104
Query  121  CRRGDLERAAASL---PAFCNVD-IPNGP 145
            C R +++     +   P +CN+  + N P
Sbjct  105  CPR-EVQMNFVPILVTPGYCNLTTVHNTP 132

Sequence Alignment: 30. Allergen Name: Tri a TAI Sequence ID: CAA39099

 Score = 32.6 bits 155,  Expect = 0.006
 Identities = 49/128 38%, Positives = 67/128 52%, Gaps = 27/128 21%
Query  1    MASNKVVFSVLLLVVL-SVLAAAMATMADHHQVYSPGEQCRPGISYPTYSLPQCRTLVRR 59
            MAS   +  +LL  VL SV+AAA AT          G  C PG+  P+  L  CR  V +
Sbjct  1    MASKSSITHLLLAAVLVSVFAAAAAT----------GPYCYPGMGLPSNPLEGCREYVAQ 50
Query  60   Q-C----VGRGASAADEQVWQD-CCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHP 113
            Q C    VG   S       +D CC++L       CRC A+ + +    R    ++    
Sbjct  51   QTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQH-CRCEAVRYFIG---R---TSDPNSG 103
Query  114  MAEVFPGCRRGDLERAAASL--PAFCNV-DIPNGP 145
            + + +PGC R      A  L  P  CNV  + N P
Sbjct  104  VLKDLPGCPREPQRDFAKVLVTPGHCNVMTVHNTP 138

Sequence Alignment: 31. Allergen Name: Car i 1.0101 Sequence ID: AAO32314

 Score = 32.2 bits 152,  Expect = 0.008
 Identities = 38/126 30%, Positives = 66/126 52%, Gaps = 18/126 14%
Query  1    MASNKVVFSVLLLVV-LSVLAAAMATMADHHQVYSP---GEQCRPGISYPTYSLPQCRTL 56
            MA    ++  LL+V   + +   + TM     + +P   GE CR  I    Y L +C+  
Sbjct  1    MARVAALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGESCREQIQRQQY-LNRCQDY 59
Query  57   VRRQCVGRGASAADE-QVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMA 115
            +R+QC   G    ++ Q ++ CC+QL+ +++  C+C  L + +    +E G    G  M 
Sbjct  60   LRQQCRSGGYDEDNQRQHFRQCCQQLSQMEE-QCQCEGLRQAVRQQQQEEGIR--GEEME 116
Query  116  EVFPGCRRGDLERAAASLPAFCNV 139
            E+   C        A+ LP  C +
Sbjct  117  EMVQ-C--------ASDLPKECGI 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.