The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD
FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT
NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV
TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT
KNAGVVA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9LLT1 Jun v 1.0101 367 2527 582.4 1e-167
AAF80164 Jun v 1.0102 367 2519 580.6 3.6e-167
CAC48400 Jun o 1 367 2437 561.9 1.5e-161
AAD03609 Jun a 1.0102 367 2430 560.3 4.7e-161
P81294 Jun a 1.0101 367 2430 560.3 4.7e-161
AAF72626 Cup s 1.0102 367 2422 558.5 1.6e-160
AAF72625 Cup s 1.0101 367 2417 557.4 3.6e-160
AAF72627 Cup s 1.0103 367 2413 556.4 6.8e-160
AAF72628 Cup s 1.0104 367 2407 555.1 1.8e-159
AAF72629 Cup s 1.0105 367 2400 553.5 5.3e-159
CAC37790 Cup a 1 367 2366 545.7 1.1e-156
Q9SCG9 Cup a 1 346 2260 521.6 2e-149
Q96385 Cha o 1 375 2198 507.4 4e-145
P18632 Cry j 1.0101 374 2067 477.6 3.9e-136
BAB86287 Cry j 1.0103 374 2064 476.9 6.2e-136
BAA05543 Cry j 1.0102 374 2046 472.8 1.1e-134
AY904433 Art v 6.0101 396 1070 250.3 1.1e-67
A0A251RNJ1 Hel a 6.0101 394 1060 248.0 5.2e-67
P27761 Amb a 1 397 1059 247.8 6.1e-67
AAA32669 Amb a 1 397 1059 247.8 6.1e-67
P27762 Amb a 2 397 1055 246.9 1.1e-66
P27759 Amb a 1 396 1033 241.9 3.7e-65
P27760 Amb a 1 398 1033 241.9 3.7e-65
P28744 Amb a 1 392 973 228.2 4.8e-61
ABM60783 Pen c 32.0101 290 263 66.4 1.7e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Jun v 1.0101 Sequence ID: Q9LLT1

 Score = 582.4 bits 2527,  Expect = 1e-167
 Identities = 367/367 100%, Positives = 367/367 100%, Gaps = 0/367 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVVA 367
            KNAGVVA
Sbjct  361  KNAGVVA 367

Sequence Alignment: 2. Allergen Name: Jun v 1.0102 Sequence ID: AAF80164

 Score = 580.6 bits 2519,  Expect = 4e-167
 Identities = 366/367 99%, Positives = 366/367 99%, Gaps = 0/367 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITI NNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITIFNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVVA 367
            KNAGVVA
Sbjct  361  KNAGVVA 367

Sequence Alignment: 3. Allergen Name: Jun o 1 Sequence ID: CAC48400

 Score = 561.9 bits 2437,  Expect = 2e-161
 Identities = 354/366 96%, Positives = 360/366 98%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCL A LVFLCAIVSC SDNPIDSCWRGDSNWGQNRMKLADC VGFGSSTMGGKGG+
Sbjct  1    MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGE 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTSA+DNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYD+DKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWRSTRDAF+NGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 4. Allergen Name: Jun a 1.0102 Sequence ID: AAD03609

 Score = 560.3 bits 2430,  Expect = 5e-161
 Identities = 354/366 96%, Positives = 356/366 97%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTS DDNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 5. Allergen Name: Jun a 1.0101 Sequence ID: P81294

 Score = 560.3 bits 2430,  Expect = 5e-161
 Identities = 354/366 96%, Positives = 356/366 97%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTS DDNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILH LHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWRSTRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVV 366
            KNAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 6. Allergen Name: Cup s 1.0102 Sequence ID: AAF72626

 Score = 558.5 bits 2422,  Expect = 2e-160
 Identities = 354/367 96%, Positives = 356/367 97%, Gaps = 0/367 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTSA+DNPVNPTPGTLRYGATREK LWIIFSQNMNIKL+MPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLEMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAPNENYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVVA 367
            KNAGVVA
Sbjct  361  KNAGVVA 367

Sequence Alignment: 7. Allergen Name: Cup s 1.0101 Sequence ID: AAF72625

 Score = 557.4 bits 2417,  Expect = 4e-160
 Identities = 353/367 96%, Positives = 354/367 96%, Gaps = 0/367 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YT TSA+DNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTATSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSF APNENYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVVA 367
            KNAGVVA
Sbjct  361  KNAGVVA 367

Sequence Alignment: 8. Allergen Name: Cup s 1.0103 Sequence ID: AAF72627

 Score = 556.4 bits 2413,  Expect = 7e-160
 Identities = 353/367 96%, Positives = 354/367 96%, Gaps = 0/367 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTSA+DNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIH CNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHSCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSL DCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLPDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAPNENYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVVA 367
            KNAGVVA
Sbjct  361  KNAGVVA 367

Sequence Alignment: 9. Allergen Name: Cup s 1.0104 Sequence ID: AAF72628

 Score = 555.1 bits 2407,  Expect = 2e-159
 Identities = 352/367 95%, Positives = 354/367 96%, Gaps = 0/367 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTSA+DNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLG+VLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSF APNENYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGC STSACANWVWRSTRDAFSNGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVVA 367
            KNAGVVA
Sbjct  361  KNAGVVA 367

Sequence Alignment: 10. Allergen Name: Cup s 1.0105 Sequence ID: AAF72629

 Score = 553.5 bits 2400,  Expect = 5e-159
 Identities = 351/367 95%, Positives = 353/367 96%, Gaps = 0/367 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLIA LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTSA+DNPVNPTPGTLRYGATREK LWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLG+VLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSF APNENYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGC STSACANWVWRSTRDAFSNGAYFVSSGK EETNIY SNEAFKVENGN APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYTSNEAFKVENGNLAPQLT 360
Query  361  KNAGVVA 367
            KNAGVVA
Sbjct  361  KNAGVVA 367

Sequence Alignment: 11. Allergen Name: Cup a 1 Sequence ID: CAC37790

 Score = 545.7 bits 2366,  Expect = 1e-156
 Identities = 343/366 93%, Positives = 352/366 96%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            MASPCL+A LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
             YTVTS+DDNPVNPTPGTLRYGATREK LWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWR TRDAF+NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVV 366
            +NAGVV
Sbjct  361  QNAGVV 366

Sequence Alignment: 12. Allergen Name: Cup a 1 Sequence ID: Q9SCG9

 Score = 521.6 bits 2260,  Expect = 2e-149
 Identities = 327/346 94%, Positives = 337/346 97%, Gaps = 0/346 0%
Query  22   DNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTSADDNPVNPTPGTLRY 81
            DNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG+ YTVTS++DNPVNPTPGTLRY
Sbjct  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
Query  82   GATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
            GATREK LWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
Query  142  LHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
            LHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
Query  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
            GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
Query  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTR 321
            ANNNYD WNIYAIGGSSNPTILSEGNSFTAPNE+YKKEVTKRIGCE+TSACANWVWRSTR
Sbjct  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
Query  322  DAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVA 367
            DAF+NGAYFVSSGK E+TNIYNSNEAFKVENGNAAPQLT+NAGVVA
Sbjct  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346

Sequence Alignment: 13. Allergen Name: Cha o 1 Sequence ID: Q96385

 Score = 507.4 bits 2198,  Expect = 4e-145
 Identities = 312/366 85%, Positives = 343/366 93%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            MAS  L+A LVFLCAIVSC SDNPIDSCWRGD+NW QNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            FYTVTS+DD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG+KTIDGRGA+V
Sbjct  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMR VSHVILHGL+IHGCNTSV G+VL+SE+ GVVPVHAQDGDAITMRNVT
Sbjct  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAF
Sbjct  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAPN++ KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            T+R+GCES S CANWVWRST+D+F+NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
Query  361  KNAGVV 366
            KNAGV+
Sbjct  361  KNAGVL 366

Sequence Alignment: 14. Allergen Name: Cry j 1.0101 Sequence ID: P18632

 Score = 477.6 bits 2067,  Expect = 4e-136
 Identities = 288/366 78%, Positives = 330/366 90%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LV+   I SC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVLSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            ++GNGGPC+F+++VS+VI+HGLH++GC+TSVLG+VL++ES GV PVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAPNE+YKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVV 366
            KNAGV+
Sbjct  361  KNAGVL 366

Sequence Alignment: 15. Allergen Name: Cry j 1.0103 Sequence ID: BAB86287

 Score = 476.9 bits 2064,  Expect = 6e-136
 Identities = 288/366 78%, Positives = 330/366 90%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLG+VL++ES GV PVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAPNE+YKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVV 366
            KNAGV+
Sbjct  361  KNAGVL 366

Sequence Alignment: 16. Allergen Name: Cry j 1.0102 Sequence ID: BAA05543

 Score = 472.8 bits 2046,  Expect = 1e-134
 Identities = 285/366 77%, Positives = 329/366 89%, Gaps = 0/366 0%
Query  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLG+VL++ES GV PVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVM LGHDD Y DDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMSLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAPNE+YKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA P+LT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPHLT 360
Query  361  KNAGVV 366
            +NAGV+
Sbjct  361  QNAGVL 366

Sequence Alignment: 17. Allergen Name: Art v 6.0101 Sequence ID: AY904433

 Score = 250.3 bits 1070,  Expect = 1e-67
 Identities = 167/344 48%, Positives = 214/344 62%, Gaps = 5/344 1%
Query  19   CCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-ADDNPVNPTPG 77
            C + N ID CWR  ++W +NR  LA CA GF   T GG GG+ Y VT  +DDN  NP PG
Sbjct  44   CAAHNIIDKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNAANPKPG 103
Query  78   TLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHV 137
            TLR G T++K LWIIF ++M IKLK  L +   KTIDGRGA+V +  GG  L +  V +V
Sbjct  104  TLRCGVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVEITCGG--LTIHNVCNV 161
Query  138  ILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLI 197
            I+H +HIH    +  G ++ +        H  DGD I +   +  WIDH +LS   DGLI
Sbjct  162  IIHNIHIHDIKVTE-GGIIKATDAKPGHRHKSDGDGICVAGSSKIWIDHCTLSHGPDGLI 220
Query  198  DVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYG 257
            DVTLGST +TISN  F +H+K++LLG D+++ DDK M VTVAFN+F     QRMPR R+G
Sbjct  221  DVTLGSTAVTISNCKFSHHQKILLLGADNSHVDDKKMHVTVAFNRFAEACDQRMPRCRFG 280
Query  258  LVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVW 317
            + +V NN+Y  W  YAIGGS+NPTILS+GN F APN+  KK V  R     T +   W W
Sbjct  281  FFQVVNNDYTSWGTYAIGGSANPTILSQGNRFHAPNDPMKKNVLVRADAPHTES-MKWNW 339
Query  318  RSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366
            RS +D + NGA FV+SG          +     E G+A  QLT  AG +
Sbjct  340  RSEKDLLENGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTL 388

Sequence Alignment: 18. Allergen Name: Hel a 6.0101 Sequence ID: A0A251RNJ1

 Score = 248.0 bits 1060,  Expect = 5e-67
 Identities = 168/344 48%, Positives = 213/344 61%, Gaps = 7/344 2%
Query  18   SCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-ADDNPVNPTP 76
            +C + N +D CWR  ++W  NR  +ADCA GF   T GGKGGD Y VTS ADD+P NP  
Sbjct  41   ACEAVNIMDQCWRCKADWADNRQAMADCAQGFAKGTTGGKGGDVYVVTSEADDDPANPKE 100
Query  77   GTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+G T+ + LWI F ++M I L   L VA  KTIDGRGA V + NGG  L +  V +
Sbjct  101  GTLRFGVTQGRPLWITFEKDMVISLTQELVVASDKTIDGRGAKVEITNGG--LTLMDVKN 158
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGL 196
            +I+  +++H     + G ++ S        +  DGD IT+      WIDH S+S   DGL
Sbjct  159  IIISNINVHDV-VELPGGMIKSGDGPATQRQKSDGDCITVAGGKQIWIDHCSFSKAFDGL 217
Query  197  IDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            +DVTLGS+ +T+SN  F  H KVMLLG DD +  DK+M VTVAFN F  N  QRMPR R+
Sbjct  218  VDVTLGSSHVTVSNCKFTQHSKVMLLGADDGHHQDKNMVVTVAFNLFTDNCDQRMPRCRF 277
Query  257  GLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGC-ESTSACANW 315
            G+ +V NNNYD W  YAIGGSS PTILS+GN F AP++  KK V  R    ES S    W
Sbjct  278  GFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKKNVCVRADAPESESM--TW 335
Query  316  VWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366
             WR+ +D + NGA FV SG              + E G  AP+LT +AGV+
Sbjct  336  NWRTEKDVLENGAVFVPSGSDPALTGEQQGGMIQAEPGENAPKLTASAGVL 386

Sequence Alignment: 19. Allergen Name: Amb a 1 Sequence ID: P27761

 Score = 247.8 bits 1059,  Expect = 6e-67
 Identities = 171/342 50%, Positives = 213/342 62%, Gaps = 9/342 2%
Query  18   SCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTSA-DDNPVNPTP 76
            +C + N ID CWRG ++W  NR  LADCA GF   T GGK GD YTVTS  DD+  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+ A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +  V +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVVPV--HAQDGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H ++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDGP-PILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRA 254
            GL+DVTLGST +TISN  F  + K +LLG DDT+  DK M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACAN 314
            R+G+ +V NNNYD W  YAIGGSS PTIL +GN F AP++  KK V  R G  +  + A 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGV 365
            W WRS +D + NGA FV+SG         S      E G AA +LT +AGV
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGV 388

Sequence Alignment: 20. Allergen Name: Amb a 1 Sequence ID: AAA32669

 Score = 247.8 bits 1059,  Expect = 6e-67
 Identities = 171/342 50%, Positives = 213/342 62%, Gaps = 9/342 2%
Query  18   SCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTSA-DDNPVNPTP 76
            +C + N ID CWRG ++W  NR  LADCA GF   T GGK GD YTVTS  DD+  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+ A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +  V +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVVPV--HAQDGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H ++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDGP-PILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRA 254
            GL+DVTLGST +TISN  F  + K +LLG DDT+  DK M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACAN 314
            R+G+ +V NNNYD W  YAIGGSS PTIL +GN F AP++  KK V  R G  +  + A 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGV 365
            W WRS +D + NGA FV+SG         S      E G AA +LT +AGV
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGV 388

Sequence Alignment: 21. Allergen Name: Amb a 2 Sequence ID: P27762

 Score = 246.9 bits 1055,  Expect = 1e-66
 Identities = 166/343 48%, Positives = 215/343 62%, Gaps = 7/343 2%
Query  19   CCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-ADDNPVNPTPG 77
            C + N ID CWR   +W +NR  L +CA GFG +T GGK GD Y VTS  DD+ VNP  G
Sbjct  45   CEAHNIIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVNPKEG 104
Query  78   TLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHV 137
            TLR+GAT+++ LWIIF ++M I L+  + V   KTIDGRGA V L  GG  + +  V +V
Sbjct  105  TLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELVYGG--ITLMNVKNV 162
Query  138  ILHGLHIHGCNTSVL-GDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGL 196
            I+H + IH  +  VL G  + S     +P H  DGDAI +   ++ WIDH +LS   DGL
Sbjct  163  IIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGDAIHVTGSSDIWIDHCTLSKSFDGL 220
Query  197  IDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARY 256
            +DV  GSTG+TISN  F +H K +LLG  DT+  D  M VT+A+N F     +RMPR R+
Sbjct  221  VDVNWGSTGVTISNCKFTHHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRF 280
Query  257  GLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWV 316
            G+ ++ NN YD W+ YAIGGSSNPTILS+GN F AP+  YKK V  R G +       W 
Sbjct  281  GFFQIVNNFYDRWDKYAIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWN 339
Query  317  WRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366
            WR+  D + NGA FV+SG         +    + E G+  PQLT NAGV+
Sbjct  340  WRTQNDVLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVL 389

Sequence Alignment: 22. Allergen Name: Amb a 1 Sequence ID: P27759

 Score = 241.9 bits 1033,  Expect = 4e-65
 Identities = 161/341 47%, Positives = 214/341 62%, Gaps = 5/341 1%
Query  23   NPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTSA-DDNPVNPTPGTLRY 81
            N ID CWRG ++W +NR  LADCA GFG  T+GGK GD YTVTS  DD+  NP  GTLR+
Sbjct  48   NIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRF 107
Query  82   GATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
            GA + + LWIIF ++M I+L   + V   KTIDGRGA V + N G  + +  V +VI+H 
Sbjct  108  GAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAG--FTLNGVKNVIIHN 165
Query  142  LHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
            +++H    +  G ++ S      P    DGDAI++   +  WIDH SLS   DGL+D  L
Sbjct  166  INMHDVKVNP-GGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKL 224
Query  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
            G+T +T+SN+ F  H+ V+L+G  D   +D+ M  TVAFN F  N  QRMPR R+G+ +V
Sbjct  225  GTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQV 284
Query  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTR 321
             NNNYD W  YAIGGS++PTILS+GN F AP+E  KK V  R G E+ +    W WR+ +
Sbjct  285  VNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHG-EAAAESMKWNWRTNK 343
Query  322  DAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVA 367
            D + NGA FV+SG         S      E G +A  LT +AGV++
Sbjct  344  DVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLS 389

Sequence Alignment: 23. Allergen Name: Amb a 1 Sequence ID: P27760

 Score = 241.9 bits 1033,  Expect = 4e-65
 Identities = 165/344 47%, Positives = 213/344 61%, Gaps = 9/344 2%
Query  18   SCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTS-ADDNPVNPTP 76
            +C + N ID CWR  ++W  NR  LADCA GF   T GGK GD YTVTS  DD+  NP  
Sbjct  45   ACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKE 104
Query  77   GTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSH 136
            GTLR+ A + + LWIIF +NM I L   L V   KTIDGRG  V++ N G  L +  V +
Sbjct  105  GTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAG--LTLMNVKN 162
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQ--DGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H ++IH  +  V    ++  + G  P+  Q  DGDAI +   +  WIDH SLS  SD
Sbjct  163  IIIHNINIH--DIKVCPGGMIKSNDGP-PILRQQSDGDAINVAGSSQIWIDHCSLSKASD 219
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRA 254
            GL+D+TLGS+ +T+SN  F  H+ V+LLG DDT+  DK M  TVAFN F  +  QRMPR 
Sbjct  220  GLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRC 279
Query  255  RYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACAN 314
            R+G+ +V NNNYD W  YAIGGSS PTILS+GN F AP++  KK V  R G    +   +
Sbjct  280  RFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGT-GNAESMS 338
Query  315  WVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVA 367
            W WR+ RD + NGA F+ SG                E G A  +LT +AGV++
Sbjct  339  WNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLS 391

Sequence Alignment: 24. Allergen Name: Amb a 1 Sequence ID: P28744

 Score = 228.2 bits 973,  Expect = 5e-61
 Identities = 161/343 46%, Positives = 214/343 62%, Gaps = 12/343 3%
Query  15   AIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTSA-DDNPVN 73
            ++ +C + N ID CWRG ++W +NR  LADCA GF   T+GGK GD YTVTS  DD+  N
Sbjct  41   SLTTCGTYNIIDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVAN 100
Query  74   PTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRK 133
            P  GTLR+GA + + LWIIF+++M I+L   L +   KTIDGRGA V + N G  ++   
Sbjct  101  PKEGTLRFGAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEIINAGFAIY--N 158
Query  134  VSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCS 193
            V ++I+H + +H    +  G ++ S     VP    DGDAI +   +  WIDH SLS   
Sbjct  159  VKNIIIHNIIMHDIVVNP-GGLIKSHDGPPVPRKGSDGDAIGISGGSQIWIDHCSLSKAV 217
Query  194  DGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPR 253
            DGLID   GST  T+SN  +F +H+ +LL  D    D++ M  TVAFN+F  N  QRMP 
Sbjct  218  DGLIDAKHGSTHFTVSNC-LFTQHQYLLLFWD---FDERGMLCTVAFNKFTDNVDQRMPN 273
Query  254  ARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACA 313
             R+G+V+V NNNY+ W  YA+GGS+ PTILS+GN F A   + KKEV  R G  + S   
Sbjct  274  LRHGFVQVVNNNYERWGSYALGGSAGPTILSQGNRFLAS--DIKKEVVGRYGESAMSESI 331
Query  314  NWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAF-KVENGNAAPQLTKNAGVVA 367
            NW WRS  D F NGA FV SG ++       N      E G A  +LT +AGV++
Sbjct  332  NWNWRSYMDVFENGAIFVPSG-VDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLS 385

Sequence Alignment: 25. Allergen Name: Pen c 32.0101 Sequence ID: ABM60783

 Score = 66.4 bits 263,  Expect = 2e-12
 Identities = 83/274 30%, Positives = 138/274 50%, Gaps = 47/274 17%
Query  42   LADCAVGFGS---STMGGKGGDFYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMN 98
            + D A G+ S    T GG GG   TV+S              Y A         F++ ++
Sbjct  1    VGDVATGYASENGGTTGGSGGTTTTVSS--------------YAA---------FTEAVS 37
Query  99   IKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVS 158
                  ++V+G  +     A V    G     + K S+ IL G+   G       +V++ 
Sbjct  38   GDDAKVVFVSGKISKTADQARV----GSNTSIIGKDSNAILSGF---GVLVKEASNVII- 89
Query  159  ESIGVVPVHAQDGDAITMRNVTNAWIDHNSLS-------DCSDGLIDVTLGSTGITISNN 211
             ++GV  V A +GDAI ++   N W+DH  +S       D  DGLID+T  +  +T+SN 
Sbjct  90   RNLGVEKVLADNGDAIGIQKSNNVWVDHCDVSSDRDHDKDYYDGLIDITHAADYVTVSNT 149
Query  212  HFFNHHKVMLLGHDDTY-DDDKS-MKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPW 269
               +H K  L+GH D+  D+DK  + VT+  N +  N   R P  R+G  HV N+ Y   
Sbjct  150  SIHDHWKACLIGHSDSNGDEDKGHLHVTLN-NNYWYNINSRGPSFRFGTGHVYNSYYLDM 208
Query  270  NIYAIGGSSNPTILSEGNSFTAPNEN-YKKEVTKRIGCEST-SACANWVWRSTRDAFSNG 327
            +   I        L E N+F+   +  Y  +    +  ++      N   + T  +    
Sbjct  209  S-DGINTRQGAQHLVESNTFSGSKKPLYSTDDGYAVANDNDFGDGENNAEKGTLTSVPYS 267
Query  328  AYFVSSGKIEETNIYNSNEAF 348
              +V SGK+++  +  + + +
Sbjct  268  YDLVGSGKVKDAVVGTAGQTL 288

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.