The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE
IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV
HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF
NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT
QNAGVVT
Sequence Info Allergen Name Length Opt Bits Score E Value
CAC37790 Cup a 1 367 2509 578.3 1.8e-166
P81294 Jun a 1.0101 367 2404 554.4 2.8e-159
AAD03609 Jun a 1.0102 367 2404 554.4 2.8e-159
CAC48400 Jun o 1 367 2403 554.2 3.3e-159
AAF72626 Cup s 1.0102 367 2392 551.7 1.9e-158
AAF72625 Cup s 1.0101 367 2382 549.4 9.2e-158
AAF72627 Cup s 1.0103 367 2378 548.5 1.7e-157
AAF72628 Cup s 1.0104 367 2372 547.1 4.4e-157
Q9LLT1 Jun v 1.0101 367 2366 545.7 1.1e-156
AAF72629 Cup s 1.0105 367 2365 545.5 1.3e-156
AAF80164 Jun v 1.0102 367 2358 543.9 4.1e-156
Q9SCG9 Cup a 1 346 2300 530.7 3.6e-152
Q96385 Cha o 1 375 2163 499.5 1e-142
P18632 Cry j 1.0101 374 2030 469.1 1.3e-133
BAB86287 Cry j 1.0103 374 2027 468.5 2.1e-133
BAA05543 Cry j 1.0102 374 2018 466.4 8.9e-133
AY904433 Art v 6.0101 396 1049 245.5 2.9e-66
P27762 Amb a 2 397 1048 245.3 3.5e-66
AAA32669 Amb a 1 397 1040 243.5 1.2e-65
P27761 Amb a 1 397 1040 243.5 1.2e-65
A0A251RNJ1 Hel a 6.0101 394 1035 242.3 2.7e-65
P27760 Amb a 1 398 1010 236.6 1.4e-63
P27759 Amb a 1 396 1007 235.9 2.2e-63
P28744 Amb a 1 392 938 220.2 1.2e-58
ABM60783 Pen c 32.0101 290 261 66.0 2.4e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cup a 1 Sequence ID: CAC37790

 Score = 578.3 bits 2509,  Expect = 2e-166
 Identities = 367/367 100%, Positives = 367/367 100%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE
Sbjct  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV
Sbjct  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  QNAGVVT 367
            QNAGVVT
Sbjct  361  QNAGVVT 367

Sequence Alignment: 2. Allergen Name: Jun a 1.0101 Sequence ID: P81294

 Score = 554.4 bits 2404,  Expect = 3e-159
 Identities = 349/367 95%, Positives = 355/367 96%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            MASPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
             YTVTS+DDNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILH LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWR TRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  QNAGVVT 367
            +NAGVVT
Sbjct  361  KNAGVVT 367

Sequence Alignment: 3. Allergen Name: Jun a 1.0102 Sequence ID: AAD03609

 Score = 554.4 bits 2404,  Expect = 3e-159
 Identities = 349/367 95%, Positives = 355/367 96%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            MASPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
             YTVTS+DDNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILH LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCES SACANWVWR TRDAF NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  QNAGVVT 367
            +NAGVVT
Sbjct  361  KNAGVVT 367

Sequence Alignment: 4. Allergen Name: Jun o 1 Sequence ID: CAC48400

 Score = 554.2 bits 2403,  Expect = 3e-159
 Identities = 351/367 95%, Positives = 357/367 97%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            MASPCL AVLVFLCAIVSCYSDNPIDSCWRGDSNW QNRMKLADCVVGFGS TMGGKGGE
Sbjct  1    MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGE 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
             YTVTS++DNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   FYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYD+D SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAPSESYKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWR TRDAFTNGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  QNAGVVT 367
            +NAGVVT
Sbjct  361  KNAGVVT 367

Sequence Alignment: 5. Allergen Name: Cup s 1.0102 Sequence ID: AAF72626

 Score = 551.7 bits 2392,  Expect = 2e-158
 Identities = 346/366 94%, Positives = 356/366 97%, Gaps = 0/366 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            IYTVTS++DNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLEMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWR TRDAF+NGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  QNAGVV 366
            +NAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 6. Allergen Name: Cup s 1.0101 Sequence ID: AAF72625

 Score = 549.4 bits 2382,  Expect = 9e-158
 Identities = 344/366 93%, Positives = 354/366 96%, Gaps = 0/366 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            IYT TS++DNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   IYTATSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSF AP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWR TRDAF+NGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  QNAGVV 366
            +NAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 7. Allergen Name: Cup s 1.0103 Sequence ID: AAF72627

 Score = 548.5 bits 2378,  Expect = 2e-157
 Identities = 344/366 93%, Positives = 354/366 96%, Gaps = 0/366 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            IYTVTS++DNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIH CNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHSCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSL DCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLPDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWR TRDAF+NGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  QNAGVV 366
            +NAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 8. Allergen Name: Cup s 1.0104 Sequence ID: AAF72628

 Score = 547.1 bits 2372,  Expect = 4e-157
 Identities = 343/366 93%, Positives = 354/366 96%, Gaps = 0/366 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            IYTVTS++DNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLG+VLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSF AP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGC STSACANWVWR TRDAF+NGAYFVSSGK EETNIYNSNEAFKVENGN APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  QNAGVV 366
            +NAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 9. Allergen Name: Jun v 1.0101 Sequence ID: Q9LLT1

 Score = 545.7 bits 2366,  Expect = 1e-156
 Identities = 343/366 93%, Positives = 352/366 96%, Gaps = 0/366 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            MASPCL+A LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
             YTVTS+DDNPVNPTPGTLRYGATREK LWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWR TRDAF+NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  QNAGVV 366
            +NAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 10. Allergen Name: Cup s 1.0105 Sequence ID: AAF72629

 Score = 545.5 bits 2365,  Expect = 1e-156
 Identities = 342/366 93%, Positives = 353/366 96%, Gaps = 0/366 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCL+AVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            IYTVTS++DNPVNPTPGTLRYGATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLG+VLVSESIGVEPVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTL STGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSF AP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGC STSACANWVWR TRDAF+NGAYFVSSGK EETNIY SNEAFKVENGN APQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYTSNEAFKVENGNLAPQLT 360
Query  361  QNAGVV 366
            +NAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 11. Allergen Name: Jun v 1.0102 Sequence ID: AAF80164

 Score = 543.9 bits 2358,  Expect = 4e-156
 Identities = 342/366 93%, Positives = 351/366 95%, Gaps = 0/366 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            MASPCL+A LVFLCAIVSC SDNPIDSCWRGDSNW QNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
             YTVTS+DDNPVNPTPGTLRYGATREK LWIIFSQNMNIKL+MPLYVAG+KTIDGRGADV
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            HLGNGGPCLFMR  SHVILHGLHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVT
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            NAWIDHNSLSDCSDGLIDVTLGSTGITI NNHFFNHHKVMLLGHDDTYDDD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITIFNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGLVHVANNNYD WNIYAIGGSSNPTILSEGNSFTAP+E+YKKEV
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            TKRIGCESTSACANWVWR TRDAF+NGAYFVSSGK EETNIYNSNEAFKVENGNAAPQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  QNAGVV 366
            +NAGVV
Sbjct  361  KNAGVV 366

Sequence Alignment: 12. Allergen Name: Cup a 1 Sequence ID: Q9SCG9

 Score = 530.7 bits 2300,  Expect = 4e-152
 Identities = 336/345 97%, Positives = 340/345 98%, Gaps = 0/345 0%
Query  22   DNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSSDDNPVNPTPGTLRY 81
            DNPIDSCWRGDSNWDQNRMKLADCVVGFGS TMGGKGGEIYTVTSS+DNPVNPTPGTLRY
Sbjct  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
Query  82   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASHVILHG 141
            GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGA VHLGNGGPCLFMR ASHVILHG
Sbjct  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
Query  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
Query  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
            GSTGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
Query  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRFTR 321
            ANNNYDQWNIYAIGGSSNPTILSEGNSFTAP+ESYKKEVTKRIGCE+TSACANWVWR TR
Sbjct  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
Query  322  DAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVV 366
            DAFTNGAYFVSSGKAE+TNIYNSNEAFKVENGNAAPQLTQNAGVV
Sbjct  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345

Sequence Alignment: 13. Allergen Name: Cha o 1 Sequence ID: Q96385

 Score = 499.5 bits 2163,  Expect = 1e-142
 Identities = 308/367 83%, Positives = 338/367 92%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            MAS  L+AVLVFLCAIVSC+SDNPIDSCWRGD+NWDQNRMKLADC VGFGS  MGGKGG 
Sbjct  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
             YTVTSSDD+PVNP PGTLRYGATRE++LWIIFS+N+NIKL MPLY+AG KTIDGRGA+V
Sbjct  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            H+GNGGPCLFMRT SHVILHGL+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT
Sbjct  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            + WIDHNSLSD SDGL+DVTL STG+TISNNHFFNHHKVMLLGH D Y DD SMKVTVAF
Sbjct  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPNAGQRMPRARYGL+HVANNNYD W+IYAIGGSSNPTILSEGNSFTAP++S KKEV
Sbjct  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            T+R+GCES S CANWVWR T+D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT
Sbjct  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
Query  361  QNAGVVT 367
            +NAGV+T
Sbjct  361  KNAGVLT 367

Sequence Alignment: 14. Allergen Name: Cry j 1.0101 Sequence ID: P18632

 Score = 469.1 bits 2030,  Expect = 1e-133
 Identities = 284/367 77%, Positives = 326/367 88%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCLVA+LV+   I SC+SDNPIDSCWRGDSNW QNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLVALLVLSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            +YTVT+SDD+PVNP PGTLRYGATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            ++GNGGPC+F++  S+VI+HGLH++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DD SMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC+++S+C+NWVW+ T+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  QNAGVVT 367
            +NAGV+T
Sbjct  361  KNAGVLT 367

Sequence Alignment: 15. Allergen Name: Cry j 1.0103 Sequence ID: BAB86287

 Score = 468.5 bits 2027,  Expect = 2e-133
 Identities = 284/367 77%, Positives = 326/367 88%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCLVA+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            +YTVT+SDD+PVNP PGTLRYGATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            ++GNGGPC+F++  S+VI+HGL+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DD SMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC+++S+C+NWVW+ T+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  QNAGVVT 367
            +NAGV+T
Sbjct  361  KNAGVLT 367

Sequence Alignment: 16. Allergen Name: Cry j 1.0102 Sequence ID: BAA05543

 Score = 466.4 bits 2018,  Expect = 9e-133
 Identities = 283/367 77%, Positives = 325/367 88%, Gaps = 0/367 0%
Query  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
            M SPCLVA+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
            +YTVT+SDD+PVNP PGTLRYGATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
            ++GNGGPC+F++  S+VI+HGL+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVM LGHDD Y DD SMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMSLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
            T RIGC+++S+C+NWVW+ T+D F NGAYFVSSGK E  NIY   EAF VENGNA P+LT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPHLT 360
Query  361  QNAGVVT 367
            QNAGV+T
Sbjct  361  QNAGVLT 367

Sequence Alignment: 17. Allergen Name: Art v 6.0101 Sequence ID: AY904433

 Score = 245.5 bits 1049,  Expect = 3e-66
 Identities = 164/344 47%, Positives = 212/344 61%, Gaps = 5/344 1%
Query  19   CYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTS-SDDNPVNPTPG 77
            C + N ID CWR  ++W++NR  LA C  GF   T GG GGEIY VT  SDDN  NP PG
Sbjct  44   CAAHNIIDKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNAANPKPG 103
Query  78   TLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASHV 137
            TLR G T++K LWIIF ++M IKL+  L +   KTIDGRGA+V +  GG  L +    +V
Sbjct  104  TLRCGVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVEITCGG--LTIHNVCNV 161
Query  138  ILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLI 197
            I+H +HIH    +  G ++ +        H  DGD I +   +  WIDH +LS   DGLI
Sbjct  162  IIHNIHIHDIKVTE-GGIIKATDAKPGHRHKSDGDGICVAGSSKIWIDHCTLSHGPDGLI 220
Query  198  DVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARYG 257
            DVTLGST +TISN  F +H+K++LLG D+++ DD  M VTVAFN+F     QRMPR R+G
Sbjct  221  DVTLGSTAVTISNCKFSHHQKILLLGADNSHVDDKKMHVTVAFNRFAEACDQRMPRCRFG 280
Query  258  LVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVW 317
            + +V NN+Y  W  YAIGGS+NPTILS+GN F AP++  KK V  R     T +   W W
Sbjct  281  FFQVVNNDYTSWGTYAIGGSANPTILSQGNRFHAPNDPMKKNVLVRADAPHTES-MKWNW 339
Query  318  RFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVV 366
            R  +D + NGA FV+SG          +     E G+A  QLT  AG +
Sbjct  340  RSEKDLLENGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTL 388

Sequence Alignment: 18. Allergen Name: Amb a 2 Sequence ID: P27762

 Score = 245.3 bits 1048,  Expect = 3e-66
 Identities = 166/344 48%, Positives = 213/344 61%, Gaps = 7/344 2%
Query  19   CYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSS-DDNPVNPTPG 77
            C + N ID CWR   +W +NR  L +C  GFG  T GGK G+IY VTS  DD+ VNP  G
Sbjct  45   CEAHNIIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVNPKEG 104
Query  78   TLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASHV 137
            TLR+GAT+++ LWIIF ++M I LQ  + V   KTIDGRGA V L  GG  + +    +V
Sbjct  105  TLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELVYGG--ITLMNVKNV 162
Query  138  ILHGLHIHGCNTSVL-GDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGL 196
            I+H + IH  +  VL G  + S      P H  DGDAI +   ++ WIDH +LS   DGL
Sbjct  163  IIHNIDIH--DVRVLPGGRIKSNGGPAIPRHQSDGDAIHVTGSSDIWIDHCTLSKSFDGL 220
Query  197  IDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARY 256
            +DV  GSTG+TISN  F +H K +LLG  DT+  D+ M VT+A+N F     +RMPR R+
Sbjct  221  VDVNWGSTGVTISNCKFTHHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRF 280
Query  257  GLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWV 316
            G+ ++ NN YD+W+ YAIGGSSNPTILS+GN F AP   YKK V  R G +       W 
Sbjct  281  GFFQIVNNFYDRWDKYAIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWN 339
Query  317  WRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT 367
            WR   D + NGA FV+SG         +    + E G+  PQLT NAGV+T
Sbjct  340  WRTQNDVLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLT 390

Sequence Alignment: 19. Allergen Name: Amb a 1 Sequence ID: AAA32669

 Score = 243.5 bits 1040,  Expect = 1e-65
 Identities = 166/344 48%, Positives = 213/344 61%, Gaps = 9/344 2%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSS-DDNPVNPTP 76
            +C + N ID CWRG ++W+ NR  LADC  GF   T GGK G++YTVTS+ DD+  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASH 136
            GTLR+ A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +    +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVEPV--HAQDGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H ++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRA 254
            GL+DVTLGST +TISN  F  + K +LLG DDT+  D  M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACAN 314
            R+G+ +V NNNYD+W  YAIGGSS PTIL +GN F AP +  KK V  R G  +  + A 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT 367
            W WR  +D + NGA FV+SG         S      E G AA +LT +AGV +
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFS 390

Sequence Alignment: 20. Allergen Name: Amb a 1 Sequence ID: P27761

 Score = 243.5 bits 1040,  Expect = 1e-65
 Identities = 166/344 48%, Positives = 213/344 61%, Gaps = 9/344 2%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSS-DDNPVNPTP 76
            +C + N ID CWRG ++W+ NR  LADC  GF   T GGK G++YTVTS+ DD+  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASH 136
            GTLR+ A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +    +
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVEPV--HAQDGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H ++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRA 254
            GL+DVTLGST +TISN  F  + K +LLG DDT+  D  M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACAN 314
            R+G+ +V NNNYD+W  YAIGGSS PTIL +GN F AP +  KK V  R G  +  + A 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT 367
            W WR  +D + NGA FV+SG         S      E G AA +LT +AGV +
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFS 390

Sequence Alignment: 21. Allergen Name: Hel a 6.0101 Sequence ID: A0A251RNJ1

 Score = 242.3 bits 1035,  Expect = 3e-65
 Identities = 162/346 46%, Positives = 210/346 60%, Gaps = 5/346 1%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTS-SDDNPVNPTP 76
            +C + N +D CWR  ++W  NR  +ADC  GF   T GGKGG++Y VTS +DD+P NP  
Sbjct  41   ACEAVNIMDQCWRCKADWADNRQAMADCAQGFAKGTTGGKGGDVYVVTSEADDDPANPKE 100
Query  77   GTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASH 136
            GTLR+G T+ + LWI F ++M I L   L VA  KTIDGRGA V + NGG  L +    +
Sbjct  101  GTLRFGVTQGRPLWITFEKDMVISLTQELVVASDKTIDGRGAKVEITNGG--LTLMDVKN 158
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGL 196
            +I+  +++H     + G ++ S        +  DGD IT+      WIDH S+S   DGL
Sbjct  159  IIISNINVHDV-VELPGGMIKSGDGPATQRQKSDGDCITVAGGKQIWIDHCSFSKAFDGL 217
Query  197  IDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARY 256
            +DVTLGS+ +T+SN  F  H KVMLLG DD +  D +M VTVAFN F  N  QRMPR R+
Sbjct  218  VDVTLGSSHVTVSNCKFTQHSKVMLLGADDGHHQDKNMVVTVAFNLFTDNCDQRMPRCRF 277
Query  257  GLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWV 316
            G+ +V NNNYD+W  YAIGGSS PTILS+GN F AP ++ KK V  R      S    W 
Sbjct  278  GFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKKNVCVRADAPE-SESMTWN 336
Query  317  WRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT 367
            WR  +D + NGA FV SG              + E G  AP+LT +AGV+T
Sbjct  337  WRTEKDVLENGAVFVPSGSDPALTGEQQGGMIQAEPGENAPKLTASAGVLT 387

Sequence Alignment: 22. Allergen Name: Amb a 1 Sequence ID: P27760

 Score = 236.6 bits 1010,  Expect = 1e-63
 Identities = 161/344 46%, Positives = 210/344 61%, Gaps = 9/344 2%
Query  18   SCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSS-DDNPVNPTP 76
            +C + N ID CWR  ++W  NR  LADC  GF   T GGK G++YTVTS  DD+  NP  
Sbjct  45   ACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKE 104
Query  77   GTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASH 136
            GTLR+ A + + LWIIF +NM I L   L V   KTIDGRG  V++ N G  L +    +
Sbjct  105  GTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAG--LTLMNVKN 162
Query  137  VILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQ--DGDAITMRNVTNAWIDHNSLSDCSD 194
            +I+H ++IH  +  V    ++  + G  P+  Q  DGDAI +   +  WIDH SLS  SD
Sbjct  163  IIIHNINIH--DIKVCPGGMIKSNDG-PPILRQQSDGDAINVAGSSQIWIDHCSLSKASD 219
Query  195  GLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRA 254
            GL+D+TLGS+ +T+SN  F  H+ V+LLG DDT+  D  M  TVAFN F  +  QRMPR 
Sbjct  220  GLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRC 279
Query  255  RYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACAN 314
            R+G+ +V NNNYD+W  YAIGGSS PTILS+GN F AP +  KK V  R G    +   +
Sbjct  280  RFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGT-GNAESMS 338
Query  315  WVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT 367
            W WR  RD + NGA F+ SG                E G A  +LT +AGV++
Sbjct  339  WNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLS 391

Sequence Alignment: 23. Allergen Name: Amb a 1 Sequence ID: P27759

 Score = 235.9 bits 1007,  Expect = 2e-63
 Identities = 159/341 46%, Positives = 211/341 61%, Gaps = 5/341 1%
Query  23   NPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSS-DDNPVNPTPGTLRY 81
            N ID CWRG ++W +NR  LADC  GFG  T+GGK G+IYTVTS  DD+  NP  GTLR+
Sbjct  48   NIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRF 107
Query  82   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASHVILHG 141
            GA + + LWIIF ++M I+L   + V   KTIDGRGA V + N G  + +    +VI+H 
Sbjct  108  GAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAG--FTLNGVKNVIIHN 165
Query  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
            +++H    +  G ++ S      P    DGDAI++   +  WIDH SLS   DGL+D  L
Sbjct  166  INMHDVKVNP-GGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKL 224
Query  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
            G+T +T+SN+ F  H+ V+L+G  D   +D  M  TVAFN F  N  QRMPR R+G+ +V
Sbjct  225  GTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQV 284
Query  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRFTR 321
             NNNYD+W  YAIGGS++PTILS+GN F AP E  KK V  R G E+ +    W WR  +
Sbjct  285  VNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHG-EAAAESMKWNWRTNK 343
Query  322  DAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT 367
            D + NGA FV+SG         S      E G +A  LT +AGV++
Sbjct  344  DVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLS 389

Sequence Alignment: 24. Allergen Name: Amb a 1 Sequence ID: P28744

 Score = 220.2 bits 938,  Expect = 1e-58
 Identities = 156/344 45%, Positives = 209/344 60%, Gaps = 10/344 2%
Query  15   AIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSS-DDNPVN 73
            ++ +C + N ID CWRG ++W +NR  LADC  GF   T+GGK G+IYTVTS  DD+  N
Sbjct  41   SLTTCGTYNIIDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVAN 100
Query  74   PTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRT 133
            P  GTLR+GA + + LWIIF+++M I+L   L +   KTIDGRGA V + N G  ++   
Sbjct  101  PKEGTLRFGAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEIINAGFAIY--N 158
Query  134  ASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCS 193
              ++I+H + +H    +  G ++ S      P    DGDAI +   +  WIDH SLS   
Sbjct  159  VKNIIIHNIIMHDIVVNP-GGLIKSHDGPPVPRKGSDGDAIGISGGSQIWIDHCSLSKAV 217
Query  194  DGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPR 253
            DGLID   GST  T+SN  +F +H+ +LL  D  +D+   M  TVAFN+F  N  QRMP 
Sbjct  218  DGLIDAKHGSTHFTVSNC-LFTQHQYLLLFWD--FDER-GMLCTVAFNKFTDNVDQRMPN 273
Query  254  ARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACA 313
             R+G+V+V NNNY++W  YA+GGS+ PTILS+GN F A     KKEV  R G  + S   
Sbjct  274  LRHGFVQVVNNNYERWGSYALGGSAGPTILSQGNRFLAS--DIKKEVVGRYGESAMSESI 331
Query  314  NWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVVT 367
            NW WR   D F NGA FV SG         +      E G A  +LT +AGV++
Sbjct  332  NWNWRSYMDVFENGAIFVPSGVDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLS 385

Sequence Alignment: 25. Allergen Name: Pen c 32.0101 Sequence ID: ABM60783

 Score = 66.0 bits 261,  Expect = 2e-12
 Identities = 65/219 29%, Positives = 109/219 49%, Gaps = 21/219 9%
Query  59   GEIYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGA 118
            G++ T  +S++       G    G T   + +  F++ ++      ++V+G  +     A
Sbjct  2    GDVATGYASENGGTTGGSG----GTTTTVSSYAAFTEAVSGDDAKVVFVSGKISKTADQA 57
Query  119  DVHLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRN 178
             V    G     +   S+ IL G+   G       +V++  ++GVE V A +GDAI ++ 
Sbjct  58   RV----GSNTSIIGKDSNAILSGF---GVLVKEASNVII-RNLGVEKVLADNGDAIGIQK 109
Query  179  VTNAWIDHNSLS-------DCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDD 231
              N W+DH  +S       D  DGLID+T  +  +T+SN    +H K  L+GH D+  D+
Sbjct  110  SNNVWVDHCDVSSDRDHDKDYYDGLIDITHAADYVTVSNTSIHDHWKACLIGHSDSNGDE 169
Query  232  ISMKVTVAFNQ-FGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFT 290
                + V +N  +  N   R P  R+G  HV N+ Y   +   I        L E N+F+
Sbjct  170  DKGHLHVTLNNNYWYNINSRGPSFRFGTGHVYNSYYLDMS-DGINTRQGAQHLVESNTFS 228

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.