The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN
GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND
EPIAAYHFDLSGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL
ALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARR
SSAEDAIPDPGRRQRVQVNVQAK
Sequence Info Allergen Name Length Opt Bits Score E Value
Q40638 Ory s 1 263 1813 381.5 1.6e-107
AAF72983 Ory s 1 267 1556 328.5 1.4e-91
AAF72991 Ory s 1 267 1389 294.1 3.3e-81
CAA81613 Phl p 1.0101 263 1212 257.7 3e-70
P43213 Phl p 1 263 1192 253.6 5.3e-69
CAA10520 Poa p a 263 1171 249.2 1.1e-67
CAA10140 Hol l 1 263 1160 247.0 5.1e-67
Q41260 Pha a 1 269 1157 246.3 8.1e-67
CAB63699 Lol p 1.0103 263 1149 244.7 2.5e-66
AAA63279 Lol p 1.0101 263 1146 244.1 3.8e-66
P43216 Hol l 1 265 1145 243.9 4.4e-66
P14946 Lol p 1 263 1144 243.7 5e-66
CAA93121 Hol l 1.0102 248 1129 240.6 4e-65
AAA63278 Lol p 1.0102 252 1118 238.3 2e-64
AAF72990 Ory s 1 269 1060 226.4 8.4e-61
A0A4D6FZ45 Uro m 1.0101 262 1052 224.7 2.5e-60
AAL14079 Cyn d 1.0203 262 1052 224.7 2.5e-60
AAL14077 Cyn d 1.0202 262 1052 224.7 2.5e-60
AAL14078 Cyn d 1 262 1037 221.6 2.2e-59
A0A4D6G2J8 Uro m 1.0201 229 1033 220.8 3.3e-59
AAK96255 Cyn d 1.0201 244 1031 220.4 4.7e-59
P58738 Zea m 1 269 1031 220.4 5.3e-59
AAF80379 Cyn d 1.0204 244 1028 219.8 7.2e-59
QCX36431 Zoy m 1.0101 272 1018 217.7 3.4e-58
ACA23876 Pas n 1.0101 265 1014 216.9 5.9e-58
O04701 Cyn d 1 246 996 213.2 7e-57
ABC58726 Sor h 1.0101 239 963 206.4 7.6e-55
AAF72987 Ory s 1 275 806 174.0 4.9e-45
AAF72984 Ory s 1 268 803 173.4 7.2e-45
Q07154 Zea m 1 191 785 169.8 6.4e-44
AAD10496 Tri a ps93 271 774 167.4 4.6e-43
AAF72989 Ory s 1 271 768 166.2 1.1e-42
AAF72985 Ory s 1 286 766 165.8 1.5e-42
AAB61710 Ory s 1 261 738 160.0 7.5e-41
AAF72988 Ory s 1 327 696 151.3 3.9e-38
AAA50175 Gly m 2 277 617 135.1 2.6e-33
AAF72986 Ory s 1 275 585 128.5 2.5e-31
CAB37496 Ara t expansin 265 399 90.2 8.1e-20
AAG13596 Ory s 1 275 339 77.8 4.5e-16
CAA10346 Cyn d 2 122 262 62.1 1e-11
P43214 Phl p 2 122 260 61.7 1.4e-11
CAA10348 Poa p 2 122 260 61.7 1.4e-11
CAA10345 Dac g 2 122 258 61.3 1.8e-11
P14947 Lol p 2 97 241 57.9 1.6e-10
P93124 Dac g 3 96 239 57.5 2.1e-10
CAA51775 Lol p 2 88 230 55.6 6.8e-10
2JNZ_A Phl p 3.0101 108 230 55.6 8.6e-10
BAA85432 Ory s 1 284 220 53.3 1.1e-08
P14948 Lol p 3 97 204 50.2 3.1e-08
CAA90746 Tri a 3 118 180 45.2 1.2e-06
AAP80171 Cyn d 15 112 169 43.0 5.5e-06
Q7M1X8 Dac g 1.0101 34 145 38.3 4.2e-05
A0A077B7S9 Sor h 2.0101 119 149 38.9 0.0001
Q7M1X6 Ant o 1.0101 32 132 35.7 0.00025
A0A077B2S0 Sor h 2.0201 121 123 33.5 0.0043
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 381.5 bits 1813,  Expect = 2e-107
 Identities = 263/263 100%, Positives = 263/263 100%, Gaps = 0/263 0%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN
Sbjct  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAAYHFDLSGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL 180
            EPIAAYHFDLSGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL
Sbjct  121  EPIAAYHFDLSGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL 180
Query  181  ALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARR 240
            ALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARR
Sbjct  181  ALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARR 240
Query  241  SSAEDAIPDPGRRQRVQVNVQAK 263
            SSAEDAIPDPGRRQRVQVNVQAK
Sbjct  241  SSAEDAIPDPGRRQRVQVNVQAK 263

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 328.5 bits 1556,  Expect = 1e-91
 Identities = 234/263 88%, Positives = 239/263 90%, Gaps = 4/263 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSSLLLACVVVAAMVS    G PKVPPGPNITTSYGDKWLEA+      P+   PKDN
Sbjct  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIAAYHFDLSGLA   MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP
Sbjct  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG
Sbjct  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
Query  238  ARRSSAEDAIPDPGRRQRV-QVNVQAK 263
              +  AEDAIPD  +   V + NVQAK
Sbjct  241  GEKIIAEDAIPDGWKADSVYKSNVQAK 267

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 294.1 bits 1389,  Expect = 3e-81
 Identities = 196/249 78%, Positives = 216/249 86%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASS LLLACVV AAMVS    G PKVPPGPNIT +YG +WLEAR     +P+   P DN
Sbjct  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKD+DKAPFLGMNSCGNDPIFKDGKGCGSCFE+KCSKPEACSDKP +IH+TDMN 
Sbjct  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIAAYHFDLSG A   MAK+GKDEELRKAGIID QFRRV+CKYP +TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NY+A+LVKYV GDGDVV+VE+KEKGSEEWK L ESWGAIWRIDTPKPLKGPFS+RVTTE 
Sbjct  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
Query  238  ARRSSAEDAIPD 249
             ++  A D IPD
Sbjct  241  DQKLVANDVIPD 252

Sequence Alignment: 4. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 257.7 bits 1212,  Expect = 3e-70
 Identities = 170/249 68%, Positives = 201/249 80%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSS +L  V + A+   S  G PKVPPGPNIT +YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDK PF GM  CGN PIFK G+GCGSCFEIKC+KPEACS +P ++H+TD N+
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIAAYHFDLSG+A   MAK G +++LR AG ++ QFRRVKCKYP  TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLALLVK+VAGDGDVV V+IKEKG ++W ALKESWGAIWRIDTP+ LKGPF+VR TTEG
Sbjct  181  NYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEG 240
Query  238  ARRSSAEDAIPD 249
              +  A+D IP+
Sbjct  241  GTKGEAKDVIPE 252

Sequence Alignment: 5. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 253.6 bits 1192,  Expect = 5e-69
 Identities = 169/249 67%, Positives = 197/249 79%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSS +L  VV+ A+   S  G PKVPPGPNIT +YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDK PF GM  CGN PIFK G+GCGSCFEIKC+KPEACS +P ++H+TD N+
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIA YHFDLSG A   MAK G +++LR AG ++ QFRRVKCKYP  TK+TFH+EK SNP
Sbjct  121  EPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLALLVKYV GDGDVV V+IKEKG ++W  LKESWGAIWRIDTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEG 240
Query  238  ARRSSAEDAIPD 249
              ++ AED IP+
Sbjct  241  GTKTEAEDVIPE 252

Sequence Alignment: 6. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 249.2 bits 1171,  Expect = 1e-67
 Identities = 164/249 65%, Positives = 197/249 79%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSS +L  V + A+   +  G  KVPPGPNIT +YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPF GM  CGN PIFK G+GCGSCFEIKC+KPE+CS +P L+H+TD N+
Sbjct  61   GGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNE 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIAAYHFDLSG A   MAK G++++LR AG ++ +FRRVKC+YP  TK+TFH+EK SNP
Sbjct  121  EPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLALLVKYV GDGDVV V+IKEKG ++W  LKESWG+IWR+DTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEG 240
Query  238  ARRSSAEDAIPD 249
              +  AED IP+
Sbjct  241  GTKGEAEDVIPE 252

Sequence Alignment: 7. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 247.0 bits 1160,  Expect = 5e-67
 Identities = 162/249 65%, Positives = 197/249 79%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSSL+L  V + A+   +  G  KVPPGPNIT +YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDK PF GM  CGN PIFK G+GCGSCFEIKC+KPE+CS +P ++H+TD N+
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNE 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIAAYH+DLSG A   MAK G++++LR AG ++ +FRRVKC+YP  TK+TFH+EK SNP
Sbjct  121  EPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLALLVKYV GDGDVV V+IKEKG ++W  LKESWGA+WR+DTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEG 240
Query  238  ARRSSAEDAIPD 249
              +  AED IP+
Sbjct  241  GTKVEAEDVIPE 252

Sequence Alignment: 8. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 246.3 bits 1157,  Expect = 8e-67
 Identities = 166/247 67%, Positives = 193/247 78%, Gaps = 4/247 1%
Query  2    ASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNG 61
            +SSSLL+   ++A  V  S  G  KVPPGPNIT  YGDKWL+A+     +P    PKDNG
Sbjct  9    SSSSLLVVAALLAVFVG-SAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 67
Query  62   GACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDE 121
            GACGYKDVDKAPF GM  CGN PIFKDG+GCGSCFE+KCSKPE+CS +P  +H+TD N+E
Sbjct  68   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEE 127
Query  122  PIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPN 178
            PIA YHFDLSG A   MAK G++E +R AG ++ QFRRVKCKYP  TK TFH+EK SNPN
Sbjct  128  PIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPN 187
Query  179  YLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGA 238
            YLALLVKYV GDGDVV V+IKEKG ++W  LKESWGAIWRIDTP  L GPF+VR TTEG 
Sbjct  188  YLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGG 247
Query  239  RRSSAEDAIPD 249
             ++  ED IP+
Sbjct  248  TKAEFEDVIPE 258

Sequence Alignment: 9. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 244.7 bits 1149,  Expect = 2e-66
 Identities = 165/249 66%, Positives = 193/249 77%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSS +L  V + A+   S  G  KVPPGPNIT  YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYKDVDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIA YHFDLSG A   MAK G++++LR AG ++ QFRRVKCKYP  TK TFH+EKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  238  ARRSSAEDAIPD 249
              +S  ED IP+
Sbjct  241  GTKSEVEDVIPE 252

Sequence Alignment: 10. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 244.1 bits 1146,  Expect = 4e-66
 Identities = 164/249 65%, Positives = 193/249 77%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSS +L  V + A+   S  G  KVPPGPNIT  YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYK+VDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIA YHFDLSG A   MAK G+++ +R AG ++ QFRRVKCKYP DTK TFH+EKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  238  ARRSSAEDAIPD 249
              +S  ED IP+
Sbjct  241  GTKSEFEDVIPE 252

Sequence Alignment: 11. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 243.9 bits 1145,  Expect = 4e-66
 Identities = 162/249 65%, Positives = 194/249 77%, Gaps = 5/249 2%
Query  1    MASSS--LLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPK 58
            MASSS  +LL    + A+   S  G  KVPPGPNIT +YGD+WL+A+     +P    PK
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPK 60
Query  59   DNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
            DNGGACGYKDVDK PF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +P  +H+TD 
Sbjct  61   DNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDD 120
Query  119  NDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKAS 175
            N+EPIA YHFDLSG A   MAK G++++LR AG ++ +FRRVKCKYP  TK TFH+EK S
Sbjct  121  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGS 180
Query  176  NPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTT 235
            NPNYLALLVKY+ GDGDVV V+IKEKG ++W  LKESWGA+WR+DTP  L GPF+VR TT
Sbjct  181  NPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 240
Query  236  EGARRSSAEDAIPD 249
            EG  +  AED IP+
Sbjct  241  EGGTKGEAEDVIPE 254

Sequence Alignment: 12. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 243.7 bits 1144,  Expect = 5e-66
 Identities = 164/249 65%, Positives = 193/249 77%, Gaps = 3/249 1%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            MASSS +L  V + A+   S  G  KVPPGPNIT  YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACGYK+VDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
            EPIA YHFDLSG A   MAK G+++ +R AG ++ QFRRVKCKYP DTK TFH+EKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  238  ARRSSAEDAIPD 249
              +S  ED IP+
Sbjct  241  GTKSEFEDVIPE 252

Sequence Alignment: 13. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 240.6 bits 1129,  Expect = 4e-65
 Identities = 155/230 67%, Positives = 183/230 79%, Gaps = 3/230 1%
Query  20   SPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNS 79
            S  G  KVPPGPNIT +YGD+WL+A+     +P    PKDNGGACGYKDVDK PF GM  
Sbjct  5    SAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTG 64
Query  80   CGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MA 136
            CGN PIFKDG+GCGSCFEIKCSKPE+CS +P  +H+TD N+EPIA YHFDLSG A   MA
Sbjct  65   CGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMA 124
Query  137  KDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEV 196
            K G++++LR AG ++ +FRRVKCKYP  TK TFH+EK SNPNYLALLVKY+ GDGDVV V
Sbjct  125  KKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAV 184
Query  197  EIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            +IKEKG ++W  LKESWGA+WR+DTP  L GPF+VR TTEG  +  AED IP+
Sbjct  185  DIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPE 237

Sequence Alignment: 14. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 238.3 bits 1118,  Expect = 2e-64
 Identities = 156/230 67%, Positives = 181/230 78%, Gaps = 3/230 1%
Query  20   SPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNS 79
            S  G  KVPPGPNIT  YGDKWL+A+     +P    PKDNGGACGYKDVDKAPF GM  
Sbjct  9    SAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTG 68
Query  80   CGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MA 136
            CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+EPIA YHFDLSG A   MA
Sbjct  69   CGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMA 128
Query  137  KDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEV 196
            K G+++ +R AG ++ QFRRVKCKYP DTK TFH+EK SNPNYLA+LVKYV GDGDVV V
Sbjct  129  KKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAV 188
Query  197  EIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            +IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG  +S  ED IP+
Sbjct  189  DIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPE 241

Sequence Alignment: 15. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 226.4 bits 1060,  Expect = 8e-61
 Identities = 147/246 59%, Positives = 185/246 75%, Gaps = 3/246 1%
Query  3    SSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGG 62
            +++++LA  VVAA+V     G PKVPPGPNITT+Y   WL AR     +P      DNGG
Sbjct  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
Query  63   ACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEP 122
            ACG K+V+  P+ GM SCGN PIFKDG+GCGSC+E+KC +P ACS +P  + +TDMN EP
Sbjct  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
Query  123  IAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNY 179
            I+AYHFD+SG A   MA  GK+ ELRKAGIID QFRRV+CKYP   K+TFH+EK SNPNY
Sbjct  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
Query  180  LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGAR 239
            LA+LVK+VA DGDV++++++E G   W+ +K SWGAIWR+DT  PLK PFS+RVTTE  +
Sbjct  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
Query  240  RSSAEDAIP 248
               A+D IP
Sbjct  245  SLIAKDVIP 253

Sequence Alignment: 16. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 224.7 bits 1052,  Expect = 3e-60
 Identities = 153/243 62%, Positives = 186/243 76%, Gaps = 5/243 2%
Query  6    LLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGAC 64
            L +  VV+A+MV  +        PGPNIT +YGDKWL+A+       PR  AP D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
            GYKDVDKAPF  M  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 181
            AYHFDLSG A   MAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  182  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRS 241
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E     
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  242  SAEDAIPD 249
              ED IP+
Sbjct  241  EQEDVIPE 248

Sequence Alignment: 17. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 224.7 bits 1052,  Expect = 3e-60
 Identities = 153/243 62%, Positives = 186/243 76%, Gaps = 5/243 2%
Query  6    LLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGAC 64
            L +  VV+A+MV  +        PGPNIT +YGDKWL+A+       PR  AP D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
            GYKDVDKAPF  M  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 181
            AYHFDLSG A   MAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  182  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRS 241
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E     
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  242  SAEDAIPD 249
              ED IP+
Sbjct  241  EQEDVIPE 248

Sequence Alignment: 18. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 224.7 bits 1052,  Expect = 3e-60
 Identities = 153/243 62%, Positives = 186/243 76%, Gaps = 5/243 2%
Query  6    LLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGAC 64
            L +  VV+A+MV  +        PGPNIT +YGDKWL+A+       PR  AP D+GGAC
Sbjct  2    LAVVAVVLASMVGGALCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIA 124
            GYKDVDKAPF GM  CGN+PIFKDG  CGSC+EIKC +P  CS +P LI +TD N E IA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  AYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLA 181
            AYHFDLSG A   MAK G++++LRKAG +  QFRRVKC+YP+DTKI FH+EK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  182  LLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRS 241
            LLVKY AGDG++V V+IK KGS+E+  +K+SWGAIWRID PKPLKGPF++R+T+E     
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  242  SAEDAIPD 249
              ED IP+
Sbjct  241  EQEDVIPE 248

Sequence Alignment: 19. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 221.6 bits 1037,  Expect = 2e-59
 Identities = 151/238 63%, Positives = 184/238 77%, Gaps = 5/238 2%
Query  11   VVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGACGYKDV 69
            VV+A+MV  +        PGPNIT +YGDKWL+A+       PR  AP D+GGACGYKDV
Sbjct  7    VVLASMVGGAWCAMGD-KPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDV 65
Query  70   DKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFD 129
            DKAPF GM  CGN+PIFKDG GCGSC+EIKC +P  CS +P LI +TD N E IAAYHFD
Sbjct  66   DKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFD 125
Query  130  LSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKY 186
            LSG A   MAK G++++LRKAG +  QFRRVKC+YP+DTKITFH+EK S+PNYLALLVKY
Sbjct  126  LSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKY 185
Query  187  VAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDA 246
             AGDG++V V+IK KGS+ +  +K SWGAIWR+D PKPLKGPF++R+T+E       ED 
Sbjct  186  AAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDV 245
Query  247  IPD 249
            IP+
Sbjct  246  IPE 248

Sequence Alignment: 20. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 220.8 bits 1033,  Expect = 3e-59
 Identities = 142/210 67%, Positives = 170/210 80%, Gaps = 3/210 1%
Query  40   KWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIK 99
            KWL+A+     +P    P DNGGACGYKDV+KAPF  M +CGN PIFKDG GCGSC+EIK
Sbjct  3    KWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  100  CSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRR 156
            C KP  CS +P ++H+TD N EPIAAYHFDL+G A   MAK G++E+LRKAGIID QFRR
Sbjct  63   CDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRR 122
Query  157  VKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAI 216
            VKCKYPA+TKI FH+EK  NPNY+ALL+KY AGDGD+V V+IKEKGSEE+  LK SWGAI
Sbjct  123  VKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAI 182
Query  217  WRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            WRID+PKP+KGP +VR+T+EG      +DAIP+
Sbjct  183  WRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPE 215

Sequence Alignment: 21. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 220.4 bits 1031,  Expect = 5e-59
 Identities = 145/221 65%, Positives = 176/221 79%, Gaps = 4/221 1%
Query  29   PGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
            PGPNIT +YGDKWL+A+       PR  AP D+GGACGYKDVDKAPF GM  CGN+PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEEL 144
            DG  CGSC+EIKC +P  CS +P LI +TD N E IAAYHFDLSG A   MAK G++++L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  145  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 204
            RKAG +  QFRRVKC+YP+DTKI FH+EK S+PNYLALLVKY AGDG++V V+IK KGS+
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  205  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            E+  +K+SWGAIWRID PKPLKGPF++R+T+E       +D IP+
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPE 230

Sequence Alignment: 22. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 220.4 bits 1031,  Expect = 5e-59
 Identities = 146/258 56%, Positives = 188/258 72%, Gaps = 4/258 1%
Query  4    SSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGGA 63
            +++++   V+AA+V+    G PKVPPGPNITT+Y  KWL AR     +P      DNGGA
Sbjct  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
Query  64   CGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPI 123
            CG K+V+  P+ GM +CGN PIFKDGKGCGSC+E++C +   CS  P  +++TDMN EPI
Sbjct  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPI 125
Query  124  AAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYL 180
            A YHFDLSG A   +AK G ++++R  GI+D +FRRV+CKYPA  KI FHIEK  NPNYL
Sbjct  126  APYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYL 185
Query  181  ALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARR 240
            A+LVKYVA DGD+V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E  ++
Sbjct  186  AVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKK 245
Query  241  SSAEDAIPDPGRRQRVQV-NVQ 261
              A+D IP   R   V   NVQ
Sbjct  246  VIAKDVIPANWRPDAVYTSNVQ 267

Sequence Alignment: 23. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 219.8 bits 1028,  Expect = 7e-59
 Identities = 144/221 65%, Positives = 176/221 79%, Gaps = 4/221 1%
Query  29   PGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
            PGPNIT +YGDKWL+A+       PR  AP D+GGACGYKDVDKAPF GM  CGN+PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEEL 144
            DG  CGSC+EIKC +P  CS +P LI +TD N E IAAYHFDLSG A   MAK G++++L
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  145  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 204
            RKAG +  QFRRVKC+YP+DTKI FH+EK S+PNYLALLVKY AGDG++V V+IK KGS+
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  205  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            E+  +K+SWGAIWR+D PKPLKGPF++R+T+E       +D IP+
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPE 230

Sequence Alignment: 24. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 217.7 bits 1018,  Expect = 3e-58
 Identities = 155/247 62%, Positives = 186/247 75%, Gaps = 11/247 4%
Query  1    MASSS------LLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGM-VRPR 53
            MASSS      L    V+++AMV  S        PGPNIT +Y ++W +A+       PR
Sbjct  1    MASSSARRQAQLAAVAVLLSAMVG-SALCEIGDKPGPNITATYNEEWQDAKATFYGSNPR 59
Query  54   VLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALI 113
              AP D+GGACGYK+VDKAPF+GM  CGN+PIFKDG GCGSCFEIKC +P  CSDKP LI
Sbjct  60   GAAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLI 119
Query  114  HVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFH 170
             +TD N E IAAYHFDLSG A   MAK G+++ LRKAG +  QFRRVKC+YP+ TKITFH
Sbjct  120  RITDKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFH 179
Query  171  IEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFS 230
            +EK  N NYLALLV+Y AGDGD+V V+IK KGS+E+  +K SWGAIWRID  KPLKGPF+
Sbjct  180  VEKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFT 239
Query  231  VRVTTEGARRSSAEDAIP 248
            VR+T+E   +   ED IP
Sbjct  240  VRLTSESGAKLVQEDVIP 257

Sequence Alignment: 25. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 216.9 bits 1014,  Expect = 6e-58
 Identities = 145/246 58%, Positives = 184/246 74%, Gaps = 6/246 2%
Query  1    MASSSLLLACV-VVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKD 59
            M S + ++A   V+AA+V+    G PKVPPGPNITT+Y  KWL A+     +P    P D
Sbjct  1    MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDD 60
Query  60   NGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMN 119
            NGGACG K+V+  P+ G  +CGN PIFKDGKGCGSC+EI+C+KPE CS +P  + +TDMN
Sbjct  61   NGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDMN 119
Query  120  DEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASN 176
             EPIA YHFDLSG A   MAK G +++LR  GI D +FRRV+CKY    KI FH+EK SN
Sbjct  120  YEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSN 179
Query  177  PNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTE 236
            PNYLA+LVK+VA DGD+V +E+KEK S+ WK +K SWGAIWR+DTPK L  PFS+R+T+E
Sbjct  180  PNYLAMLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSE 238
Query  237  GARRSSAEDAIP 248
              ++  A+D IP
Sbjct  239  SGKKVIAQDVIP 250

Sequence Alignment: 26. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 213.2 bits 996,  Expect = 7e-57
 Identities = 143/220 65%, Positives = 171/220 77%, Gaps = 4/220 1%
Query  29   PGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
            PGPNIT +YG KWLEAR       PR  AP D+GGACGYKDVDK PF GM +CGN+PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEEL 144
            DG GC +C+EIKC +P  CS +P L+ +TD N E IAAYHFDLSG A   MAK G++++L
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  145  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 204
            RKAG +  QFRRVKCKYP+ TKITFHIEK SN +YLALLVKY AGDG++V V+IK + S+
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  205  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248
            E+  +K SWGAIWRID  KPLKGPFS+R+T+EG      +D IP
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIP 229

Sequence Alignment: 27. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 206.4 bits 963,  Expect = 8e-55
 Identities = 140/222 63%, Positives = 172/222 77%, Gaps = 8/222 3%
Query  25   PKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDP 84
            PKV  G NIT +YG  WLE +     +P    P DNGGACGYKDV+KAPF  M +CGN P
Sbjct  2    PKVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLP 61
Query  85   IFKDGKGCGSCFEIKCSKPEA--CSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDG 139
            IFKDG  CGSCFEIKC KP+   CS +  ++H+TDMN E IAAYHFDL+G A   MAK G
Sbjct  62   IFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKG 120
Query  140  KDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIK 199
            ++E+L KAGIID +FRRVKCKY    K+TFH+EK SNPNYLALLVKYV GDGD+V V+IK
Sbjct  121  QEEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIK 178
Query  200  EKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            EKG + ++ LK SWGAIWR D+P P+K P +V++TTEG  +++ +D IP+
Sbjct  179  EKGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPE 228

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 174.0 bits 806,  Expect = 5e-45
 Identities = 119/246 48%, Positives = 163/246 66%, Gaps = 11/246 4%
Query  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
            M S    +  ++   +V  S  GHP V    +  ++YG  WL AR      P    P DN
Sbjct  5    MGSKVAAILAILSVLVVHGSCKGHP-VNYNVSDASAYGSGWLPARATWYGAPTGAGPDDN 63
Query  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
            GGACG+K+V++ PF  M SCGN+PIFKDGKGCGSC++I+C+K  +CS     + +TDMN 
Sbjct  64   GGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNY 123
Query  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
             P+A YHFDLSG A   MAK G +++LR +GIID QFRRV C YP   KI FH+E+ SNP
Sbjct  124  YPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPG-LKINFHVEEGSNP 182
Query  178  NYLALLVKYVAGDGDVVEVEIKEKGSEE------WKALKESWGAIWRIDTPKPLKGPFSV 231
             Y+A+LV+Y   DGDVV+V++ E  S        W  ++ESWG+IWR+D+   L+ PFS+
Sbjct  183  VYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSL 242
Query  232  RVTTEGARRSSAEDAIP 248
            R+ ++  +   A + IP
Sbjct  243  RIRSDSGKTLVANNVIP 259

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 173.4 bits 803,  Expect = 7e-45
 Identities = 108/207 52%, Positives = 146/207 70%, Gaps = 4/207 1%
Query  41   WLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC 100
            W  AR      P    P D+GGACG+K+ ++ PF  M SCGN+PIFKDGKGCGSC++I+C
Sbjct  42   WEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC 101
Query  101  SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRV 157
                ACS  P  + +TDMN  P++ YHFDLSG A   MAK G++++LR AGIID QF+RV
Sbjct  102  VNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRV 161
Query  158  KCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIW 217
             C +P   K+TFH+E+ SNP Y+A+LV+Y  GDGDVV+V++ E  S+ W  ++ESWG+IW
Sbjct  162  PCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIW 220
Query  218  RIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248
            R+D+   L  PFS+R+T E  ++  A   IP
Sbjct  221  RLDSNHRLTAPFSLRITNESGKQLVASQVIP 251

Sequence Alignment: 30. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 169.8 bits 785,  Expect = 6e-44
 Identities = 114/184 61%, Positives = 142/184 77%, Gaps = 6/184 3%
Query  77   MNSCGNDPIFKDGKGCGSCFEIKCS-KPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA- 134
            M +CGN PIFKDGKGCGSC+E++C  KPE CS  P  + +TDMN EPIA YHFDLSG A 
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
Query  135  --MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGD 192
              +AK G +++LR  GI+D +FRRV+CKYPA  KI FHIEK  NPNY+A+LVK+VA DGD
Sbjct  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
Query  193  VVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPDPGR 252
            +V +EI++K S EWK +K SWGAIWR+DT K LKGPFS+R+T+E  ++  A+D IP   R
Sbjct  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
Query  253  RQRVQV-NVQ 261
               V   NVQ
Sbjct  180  PDAVYTSNVQ 189

Sequence Alignment: 31. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 167.4 bits 774,  Expect = 5e-43
 Identities = 115/242 47%, Positives = 163/242 67%, Gaps = 12/242 4%
Query  4    SSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGGA 63
            SS  +A V + +M+  S      V     +  SY   WL A+      P    P DNGGA
Sbjct  5    SSNAIALVALLSMLFTSV--RSAVNYDTAVARSYTSGWLPAKATWYGAPNGAGPDDNGGA 62
Query  64   CGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC--SKPEACSDKPALIHVTDMNDE 121
            CG+K+V++ P   M +CGN+PIF  G+GCG C+EIKC  S   +CS +P  I +TDMN  
Sbjct  63   CGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITDMNYY 122
Query  122  PIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPN 178
            P+A YH+DLSG A   MAK G ++ LR AGIID QFRRV C +P   K+TFH+++ SNPN
Sbjct  123  PVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPG-MKVTFHVQRGSNPN 181
Query  179  YLALLVKYVAGDGDVVEVEIKE----KGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVT 234
            YLA+LV+YV  DG VV +E+ +    + +  W+ ++ SWG++WR+DT +P++GPFS+R+T
Sbjct  182  YLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRIT 241
Query  235  TEGARRSSAEDAIP 248
            ++  +   A +AIP
Sbjct  242  SDTGKTLVANNAIP 255

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 166.2 bits 768,  Expect = 1e-42
 Identities = 100/207 48%, Positives = 147/207 71%, Gaps = 6/207 2%
Query  41   WLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC 100
            W  A+     +P      DNGGACG+K V++ PF+GM SCGN P++K GKGCGSC+ ++C
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  101  SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRV 157
            ++  ACS     + +TDMN  P++ YHFDLSG+A   +AK G+ ++LR+AGIID QF RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  158  KCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE--EWKALKESWGA 215
             C++P   K+ FH+E+ S+P YLA+LV+Y  GDGDV +V++KE G+    W  ++ESWG+
Sbjct  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
Query  216  IWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248
            +WR+D+   L+ PFS+R+ ++  +   A D IP
Sbjct  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIP 254

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 165.8 bits 766,  Expect = 2e-42
 Identities = 104/211 49%, Positives = 149/211 70%, Gaps = 10/211 4%
Query  37   YGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
            Y   W +AR     +P    P DNGGACG+K  ++ PF+ M SCGN P+FKDGKGCGSC+
Sbjct  51   YWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCY 110
Query  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQ 153
            +I+C+K ++CS +   + +TDMN  P+A +HFDLSG A   +AK G +++LR +GIID +
Sbjct  111  KIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIE 170
Query  154  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE------EWK 207
            F RV C++P   KI FH+E+ SNP Y+A+LV+Y  GDGDVV+V++ E  +       +W 
Sbjct  171  FTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWT 229
Query  208  ALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248
             ++ESWG+IWR+DT   L+ PFS+R+  E  +   A + IP
Sbjct  230  PMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIP 270

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 160.0 bits 738,  Expect = 8e-41
 Identities = 100/211 47%, Positives = 144/211 68%, Gaps = 9/211 4%
Query  37   YGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
            Y + WL A+     +P    P DNGGACG+K+ ++ PF+ M SCGN+P+F+DGKGCG+C+
Sbjct  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
Query  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQ 153
            +I+C+   +CS +P  + +TDMN  P+A YHFDLSG A   MA+ G +++LR AGIID Q
Sbjct  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
Query  154  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKE-----KGSEEWKA 208
            FRRV C Y     + FH+E  SNP YLA+LV++   DG VV++++ E     K +  W  
Sbjct  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
Query  209  LKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248
            ++ SWG+IWR+D    L+GP S+R+ +E  +   A   IP
Sbjct  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIP 245

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 151.3 bits 696,  Expect = 4e-38
 Identities = 125/231 54%, Positives = 164/231 70%, Gaps = 20/231 8%
Query  17   VSPSP-AGHPKVP-PGPNITTSY----GDKWLEARPPGMVRPRVLAPKDNGGACGYKDVD 70
            V+P+P A  P +P PG   +       G  WL AR      P    P DNGGACG+K+V+
Sbjct  62   VAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVN 121
Query  71   KAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDL 130
              PF  M SCGN+P+FKDGKGCGSC++I+C    ACS  P  + +TDMN  P++ YHFDL
Sbjct  122  LPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDL 181
Query  131  SGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYV 187
            SG A   MAKD +++ELR AGIID QFRRV C+YP  T +TFH+E+ SNP Y+A+LV+Y 
Sbjct  182  SGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYE 240
Query  188  AGDGDVVEVEIKEK--------GSEE--WKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
             GDGDVV+V++ E         G+    W  ++ESWG+IWR+DT  PL+GPFS+R+T E 
Sbjct  241  NGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES 300
Query  238  ARRSSAEDAIP 248
             +   A+  IP
Sbjct  301  GKTLIADQVIP 311

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 135.1 bits 617,  Expect = 3e-33
 Identities = 107/252 42%, Positives = 149/252 59%, Gaps = 18/252 7%
Query  3    SSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN-- 60
            S  L L  ++   +V PS   +PK     +  +     W     P +      A  D   
Sbjct  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSDW----SPAVATWYGPANGDGSE 65
Query  61   GGACGYKD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTD-- 117
            GGACGY + V + PF  + S G+  I+  GKGCGSC+E+KC+   ACS  P  + +TD  
Sbjct  66   GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
Query  118  MNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKA 174
                  A YHFDLSG A   MA  G+DE LR AG I+ Q RR++C YP  + I FH++  
Sbjct  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYPGRS-IAFHVDSG 184
Query  175  SNPNYLALLVKYVAGDGDVVEVEIKEK-GSEEWKALKESWGAIWRIDTPKPLKGPFSVRV 233
            SN  Y+A LV+Y  GDGD+ +VE+KE   S  W ++++SWGA+W+ D   PL+ PFS+++
Sbjct  185  SNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKL 244
Query  234  TT-EGARRSSAEDAIP---DPGRRQRVQVN 259
            TT E  +   A + IP    PG+  R  VN
Sbjct  245  TTLESGQTIVANNVIPAGWTPGQTYRSIVN 274

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 128.5 bits 585,  Expect = 2e-31
 Identities = 91/200 45%, Positives = 129/200 64%, Gaps = 15/200 7%
Query  61   GGACGYKD-VDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMN 119
            GGACGY+  V + PF  M + G   +FK+GKGCGSC++IKC+   ACS +P  + +TD  
Sbjct  63   GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSC 122
Query  120  DEPIA---AYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEK 173
               +    A HFD+SG A   MA  G  + LR AG++  Q++RV C++  +  + F ++ 
Sbjct  123  PGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMN--VAFKVDA 180
Query  174  ASNPNYLALLVKYVAGDGDVVEVEI-KEKGSEEWKALKESWGAIWRID--TPKPLKGPFS 230
             SNP YLA+LV+Y  GDGD+  V I K +G   WKA+++SWGA WR++  T KPL  PFS
Sbjct  181  GSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS 240
Query  231  VRVTTEGARRSSAEDAIPD---PGRRQRVQVNVQA 262
            +R+T+   +   A + IP     G   R  VN  A
Sbjct  241  IRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 90.2 bits 399,  Expect = 8e-20
 Identities = 68/175 38%, Positives = 97/175 55%, Gaps = 8/175 4%
Query  60   NGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMN 119
            + GAC Y  +    F G  +     I+KDG GCG+CF+++C  P  CS K   + VTD+N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  120  DEPIAAYHFDLSGL-AMAKD--GKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKAS- 175
                    +    + AMAK   G D +L K GI+D ++RRV C Y  + K+   +E++S 
Sbjct  101  KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDY-GNKKMNVRVEESSK 159
Query  176  NPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVR-VT 234
            NPNYLA+ + Y  G  +VV + I + GS  W  +  S GA+W  D  K   G +  R V 
Sbjct  160  NPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTD--KVPNGALQFRFVV 217
Query  235  TEG 237
            T G
Sbjct  218  TAG 220

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 77.8 bits 339,  Expect = 4e-16
 Identities = 59/172 34%, Positives = 92/172 53%, Gaps = 13/172 7%
Query  60   NGGACGYKDVDKAPFLGMNSCGNDP-IFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
            N G+CGY  +  A F G +     P +F+ G GCG+CF+++C   + CS   A + VT  
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVT-- 106
Query  119  NDEPIAAYHFDL-----SGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEK 173
             DE  +    DL     +  AMA+ G   +LR    +D +++RV C+Y A   ++  +E+
Sbjct  107  -DEARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEE 165
Query  174  ASNPNY-LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVR 232
             S P   L++   Y  G  D+V V++   GS  WK +   +G  W   T +   GP+  R
Sbjct  166  KSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFR 223
Query  233  VTTEG 237
            V   G
Sbjct  224  VVVTG 228

Sequence Alignment: 40. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 62.1 bits 262,  Expect = 1e-11
 Identities = 38/81 46%, Positives = 58/81 71%, Gaps = 4/81 4%
Query  166  KITFHIEKASNPNYLALLVKYVAGDGDVV-EVEIKEKGSEEWKALKESWGAIWRIDTPKP 224
            K+TF +EK SN  +LA+LVKY   +GD + EVE++E GS+EW A+ +  G +W  D+ +P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  225  LKGPFSVRVTTEGARRSSAEDAIPD 249
            LKGPF+ R  TE   ++  +D +P+
Sbjct  86   LKGPFNFRFLTEKGMKNVFDDVVPE 110

Sequence Alignment: 41. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 61.7 bits 260,  Expect = 1e-11
 Identities = 44/110 40%, Positives = 68/110 61%, Gaps = 7/110 6%
Query  133  LAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGD 192
            ++MA       L  A ++   F    C  P   K+TF +EK SN  +LA+LVKY  GD  
Sbjct  1    MSMASSSSSSLLAMA-VLAALFAGAWC-VP---KVTFTVEKGSNEKHLAVLVKY-EGD-T 53
Query  193  VVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            + EVE++E GS+EW A+ +  G +W  D+ +PL+GPF+ R  TE   ++  +D +P+
Sbjct  54   MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPE 110

Sequence Alignment: 42. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 61.7 bits 260,  Expect = 1e-11
 Identities = 44/110 40%, Positives = 68/110 61%, Gaps = 7/110 6%
Query  133  LAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGD 192
            ++MA       L  A ++   F    C  P   K+TF +EK SN  +LA+LVKY  GD  
Sbjct  1    MSMASSSSSSLLAMA-VLAALFAGAWC-VP---KVTFTVEKGSNEKHLAVLVKY-EGD-T 53
Query  193  VVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249
            + EVE++E GS+EW A+ +  G +W  D+ +PL+GPF+ R  TE   ++  +D +P+
Sbjct  54   MAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPE 110

Sequence Alignment: 43. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 61.3 bits 258,  Expect = 2e-11
 Identities = 37/81 45%, Positives = 58/81 71%, Gaps = 4/81 4%
Query  166  KITFHIEKASNPNYLALLVKYVAGDGDVV-EVEIKEKGSEEWKALKESWGAIWRIDTPKP 224
            K+TF +EK SN  +LA+LVKY   +GD + EVE++E GS+EW A+ +  G +W  D+ +P
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  225  LKGPFSVRVTTEGARRSSAEDAIPD 249
            L+GPF+ R  TE   ++  +D +P+
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPE 110

Sequence Alignment: 44. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 57.9 bits 241,  Expect = 2e-10
 Identities = 37/81 45%, Positives = 53/81 65%, Gaps = 2/81 2%
Query  167  ITFHIEKASNPNYLALLVKYVAGDGD-VVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 225
            + F +EK S+   LAL +KY   +GD + EVE+KE GS EW ALK++   +W I + KPL
Sbjct  4    VEFTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPL 62
Query  226  KGPFSVRVTTEGARRSSAEDAIP 248
            KGPF+ R  +E   R+  +D +P
Sbjct  63   KGPFNFRFVSEKGMRNVFDDVVP 85

Sequence Alignment: 45. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 57.5 bits 239,  Expect = 2e-10
 Identities = 33/82 40%, Positives = 52/82 63%, Gaps = 1/82 1%
Query  166  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 225
            K+TF +EK S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
Query  226  KGPFSVRVTTEGARRSSAEDAIP 248
             GPF+ R  ++G  R+  ++ IP
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIP 83

Sequence Alignment: 46. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 55.6 bits 230,  Expect = 7e-10
 Identities = 36/79 45%, Positives = 52/79 65%, Gaps = 2/79 2%
Query  169  FHIEKASNPNYLALLVKYVAGDGDVV-EVEIKEKGSEEWKALKESWGAIWRIDTPKPLKG 227
            F +EK S+   LAL +KY + +GD + EVE+KE GS EW ALK++   +W I + KPLKG
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  228  PFSVRVTTEGARRSSAEDAIP 248
            PF+ R  +E    +  +D +P
Sbjct  61   PFNFRFVSEKGMWNVFDDVVP 81

Sequence Alignment: 47. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 55.6 bits 230,  Expect = 9e-10
 Identities = 31/82 37%, Positives = 52/82 63%, Gaps = 1/82 1%
Query  166  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 225
            ++TF ++K S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPL 72
Query  226  KGPFSVRVTTEGARRSSAEDAIP 248
             GPF+ R  ++G  R+  ++ IP
Sbjct  73   VGPFNFRFMSKGGMRNVFDEVIP 95

Sequence Alignment: 48. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 53.3 bits 220,  Expect = 1e-08
 Identities = 69/233 29%, Positives = 107/233 45%, Gaps = 33/233 14%
Query  6    LLLACVVVAAMVSPSPAGHP-----KVPPGPNITTSYGDK-WLEARPPGMVRPRVLAPKD 59
            +L A + VA       AG       +  P P   T Y    W +        P  +   D
Sbjct  11   FLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMGD-D 69
Query  60   NGGACGYKDVDKAPFLGMNSCG-NDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
             GGACGY   D   +    +   + P+F DG GCG C+E++C K   C+     + +T  
Sbjct  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
Query  119  NDEPIAAY--------------HFDLSGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPAD 164
            N  P   Y              HFD++  +  K  +    R AGI+  Q+RRV C+    
Sbjct  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ----RVAGIVPVQYRRVPCQRTGG 185
Query  165  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE-EWKALKESWGAIWRIDTPK 223
             +  ++     N  +L L V  V G GDV  + +K  G    W     +WG  +++    
Sbjct  186  VRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAAL 241
Query  224  PLKGPFSVRVTTEGARRSS--AEDAI 247
                 ++V++TT    + +    DAI
Sbjct  242  DNSDGLTVKLTTYSTPQQTIIVSDAI 267

Sequence Alignment: 49. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 50.2 bits 204,  Expect = 3e-08
 Identities = 28/83 33%, Positives = 50/83 60%, Gaps = 1/83 1%
Query  165  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKP 224
            TK+ + +EK S+   L L +KY      + EVE+++ GSEEW+ + +  G +W + + KP
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
Query  225  LKGPFSVRVTTEGARRSSAEDAIP 248
            L GP + R  ++G  ++  ++ IP
Sbjct  60   LTGPMNFRFLSKGGMKNVFDEVIP 83

Sequence Alignment: 50. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 45.2 bits 180,  Expect = 1e-06
 Identities = 26/74 35%, Positives = 46/74 62%, Gaps = 2/74 2%
Query  166  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 225
            K+ + ++K S+   LAL + Y   +  + EVE+++ GSEEW+ L +  G +W +   KPL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  226  KGPFSVR-VTTEGARR 240
             GPF+ R ++  G ++
Sbjct  83   VGPFNFRFLSKNGMKK 98

Sequence Alignment: 51. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 43.0 bits 169,  Expect = 5e-06
 Identities = 30/76 39%, Positives = 51/76 67%, Gaps = 7/76 9%
Query  167  ITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLK 226
            I FH+E+ S+P + AL +K  A   ++ +V+++E G++    + +S G  W ID  KPLK
Sbjct  22   IIFHVEE-SSPKF-ALSIKDSAK--EITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  227  GPFSVRVTTEGARRSSAEDAIPD 249
            GP+++R+  EG      +D IP+
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPE 97

Sequence Alignment: 52. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 38.3 bits 145,  Expect = 4e-05
 Identities = 19/33 57%, Positives = 23/33 69%, Gaps = 0/33 0%
Query  25   PKVPPGPNITTSYGDKWLEARPPGMVRPRVLAP 57
            PKVPPGPNIT +YGDKWL+A+     +P    P
Sbjct  2    PKVPPGPNITATYGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 53. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 38.9 bits 149,  Expect = 0.0001
 Identities = 32/91 35%, Positives = 51/91 56%, Gaps = 9/91 9%
Query  165  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKA-LKESWGAIWRIDTPK 223
            T +T+ I K S    L L+        DV EV +K+KG+ ++   LKES    +  ++ +
Sbjct  25   TLMTWTIGKDSTSTRLVLV-----ASADVSEVAVKDKGATDFSDDLKESPAKTFTYESKE 79
Query  224  PLKGPFSVRVTTEGARRSSAEDAIP---DPGRRQRVQVNV 260
            P+KGP+SVR   +G    + +D IP    PG   + +  V
Sbjct  80   PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV 119

Sequence Alignment: 54. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 35.7 bits 132,  Expect = 0.0003
 Identities = 17/27 62%, Positives = 21/27 77%, Gaps = 0/27 0%
Query  26   KVPPGPNITTSYGDKWLEARPPGMVRP 52
            KVPPGPNIT +YGDKWL+A+     +P
Sbjct  3    KVPPGPNITATYGDKWLDAKSTWYGKP 29

Sequence Alignment: 55. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 33.5 bits 123,  Expect = 0.004
 Identities = 26/79 32%, Positives = 45/79 56%, Gaps = 6/79 7%
Query  165  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKA-LKESWGAIWRIDTPK 223
            T +T  + K S    L+L+   VA    + EV +K KG+ ++   LKES    + +D+ +
Sbjct  27   TTLTIEVGKDSTSTKLSLITN-VA----ISEVSVKPKGATDFTDDLKESEPKTFTLDSKE 81
Query  224  PLKGPFSVRVTTEGARRSSAEDAIP 248
            P++GP + R   +G      ++AIP
Sbjct  82   PIEGPIAFRFLAKGGGYRVVDNAIP 106

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.