The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP
NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG
GTKSEVEDVIPEGWKADTSYSAK
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB63699 Lol p 1.0103 263 1816 370.1 4.4e-104
P14946 Lol p 1 263 1785 363.9 3.2e-102
AAA63279 Lol p 1.0101 263 1779 362.7 7.2e-102
AAA63278 Lol p 1.0102 252 1735 354.0 3e-99
P43216 Hol l 1 265 1716 350.2 4.3e-98
P43213 Phl p 1 263 1688 344.6 2e-96
Q41260 Pha a 1 269 1688 344.6 2.1e-96
CAA10520 Poa p a 263 1674 341.8 1.4e-95
CAA93121 Hol l 1.0102 248 1661 339.3 7.8e-95
CAA10140 Hol l 1 263 1660 339.1 9.7e-95
CAA81613 Phl p 1.0101 263 1618 330.7 3.2e-92
AAF72983 Ory s 1 267 1302 267.8 2.7e-73
AAF72991 Ory s 1 267 1246 256.7 6.1e-70
A0A4D6FZ45 Uro m 1.0101 262 1211 249.7 7.4e-68
AAL14077 Cyn d 1.0202 262 1211 249.7 7.4e-68
AAL14079 Cyn d 1.0203 262 1211 249.7 7.4e-68
AAL14078 Cyn d 1 262 1203 248.2 2.2e-67
AAK96255 Cyn d 1.0201 244 1189 245.4 1.4e-66
AAF80379 Cyn d 1.0204 244 1186 244.8 2.1e-66
ABC58726 Sor h 1.0101 239 1178 243.2 6.2e-66
A0A4D6G2J8 Uro m 1.0201 229 1173 242.3 1.2e-65
Q40638 Ory s 1 263 1149 237.4 3.8e-64
ACA23876 Pas n 1.0101 265 1143 236.2 8.8e-64
QCX36431 Zoy m 1.0101 272 1133 234.2 3.6e-63
O04701 Cyn d 1 246 1129 233.5 5.5e-63
P58738 Zea m 1 269 1099 227.5 3.9e-61
AAF72990 Ory s 1 269 1092 226.1 1e-60
AAF72987 Ory s 1 275 942 196.2 1e-51
AAF72984 Ory s 1 268 927 193.2 7.7e-51
AAF72985 Ory s 1 286 911 190.0 7.6e-50
AAB61710 Ory s 1 261 879 183.7 5.6e-48
AAF72989 Ory s 1 271 877 183.3 7.7e-48
AAD10496 Tri a ps93 271 869 181.7 2.3e-47
Q07154 Zea m 1 191 806 169.3 8.7e-44
AAF72988 Ory s 1 327 739 155.8 1.8e-39
AAA50175 Gly m 2 277 704 148.9 1.8e-37
AAF72986 Ory s 1 275 703 148.7 2.1e-37
CAB37496 Ara t expansin 265 425 93.4 8.7e-21
BAA85432 Ory s 1 284 383 85.0 3.1e-18
AAG13596 Ory s 1 275 380 84.4 4.5e-18
CAA10346 Cyn d 2 122 269 62.7 6.9e-12
CAA10345 Dac g 2 122 269 62.7 6.9e-12
CAA10348 Poa p 2 122 269 62.7 6.9e-12
P43214 Phl p 2 122 269 62.7 6.9e-12
Q7M1X8 Dac g 1.0101 34 236 56.7 1.2e-10
Q7M1X6 Ant o 1.0101 32 224 54.4 5.8e-10
P14947 Lol p 2 97 233 55.7 7.3e-10
P93124 Dac g 3 96 225 54.1 2.2e-09
CAA51775 Lol p 2 88 217 52.5 5.8e-09
AAP80171 Cyn d 15 112 216 52.2 9.1e-09
2JNZ_A Phl p 3.0101 108 200 49.1 7.9e-08
P14948 Lol p 3 97 185 46.1 5.4e-07
CAA90746 Tri a 3 118 158 40.7 2.9e-05
A0A077B2S0 Sor h 2.0201 121 132 35.5 0.0011
A0A077B7S9 Sor h 2.0101 119 131 35.3 0.0012
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 370.1 bits 1816,  Expect = 4e-104
 Identities = 263/263 100%, Positives = 263/263 100%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
Sbjct  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
            GTKSEVEDVIPEGWKADTSYSAK
Sbjct  241  GTKSEVEDVIPEGWKADTSYSAK 263

Sequence Alignment: 2. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 363.9 bits 1785,  Expect = 3e-102
 Identities = 258/263 98%, Positives = 260/263 98%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFGSMAKKGEEQ +RSAGELELQFRRVKCKYPD TKPTFHVEKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
            GTKSE EDVIPEGWKADTSYSAK
Sbjct  241  GTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 3. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 362.7 bits 1779,  Expect = 7e-102
 Identities = 257/263 97%, Positives = 259/263 98%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYK+VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE
Sbjct  61   GGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFGSMAKKGEEQ +RSAGELELQFRRVKCKYPD TKPTFHVEKASNP
Sbjct  121  EPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLAILVKYVDGDGDVVAVDIKEKGKDKW ELKESWGAVWRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
            GTKSE EDVIPEGWKADTSYSAK
Sbjct  241  GTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 4. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 354.0 bits 1735,  Expect = 3e-99
 Identities = 248/252 98%, Positives = 249/252 98%, Gaps = 0/252 0%
Query  12   ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDK 71
            ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDK
Sbjct  1    ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDK 60
Query  72   APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS 131
            APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS
Sbjct  61   APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS 120
Query  132  GHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVD 191
            GHAFGSMAKKGEEQ +RSAGELELQFRRVKCKYPD TKPTFHVEK SNPNYLAILVKYVD
Sbjct  121  GHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVD 180
Query  192  GDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIP 251
            GDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIP
Sbjct  181  GDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIP 240
Query  252  EGWKADTSYSAK 263
            EGWKADTSYSAK
Sbjct  241  EGWKADTSYSAK 252

Sequence Alignment: 5. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 350.2 bits 1716,  Expect = 4e-98
 Identities = 247/263 93%, Positives = 255/263 96%, Gaps = 2/263 0%
Query  1    MASSS-SVLLVVA-LFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPK 58
            MASSS SVLL+VA LFAVFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPK
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPK 60
Query  59   DNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 118
            DNGGACGYKDVDK PF+GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGE VTV ITDD
Sbjct  61   DNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDD 120
Query  119  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKAS 178
            NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELEL+FRRVKCKYPDGTKPTFHVEK S
Sbjct  121  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGS 180
Query  179  NPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTT 238
            NPNYLA+LVKY+DGDGDVVAVDIKEKGKDKWIELKESWGAVWR+DTPDKLTGPFTVRYTT
Sbjct  181  NPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 240
Query  239  EGGTKSEVEDVIPEGWKADTSYSAK 263
            EGGTK E EDVIPEGWKADT+Y AK
Sbjct  241  EGGTKGEAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 6. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 344.6 bits 1688,  Expect = 2e-96
 Identities = 240/263 91%, Positives = 251/263 95%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVV LFAVFLGSA+GI KVPPGPNITA YGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKDVDK PF+GMTGCGNTPIFK GRGCGSCFEIKCTKPE+CSGE V V ITDDNE
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIAPYHFDLSGHAFG+MAKKG+EQKLRSAGELELQFRRVKCKYP+GTK TFHVEK SNP
Sbjct  121  EPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV+GDGDVVAVDIKEKGKDKWIELKESWGA+WRIDTPDKLTGPFTVRYTTEG
Sbjct  181  NYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
            GTK+E EDVIPEGWKADTSY +K
Sbjct  241  GTKTEAEDVIPEGWKADTSYESK 263

Sequence Alignment: 7. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 344.6 bits 1688,  Expect = 2e-96
 Identities = 237/262 90%, Positives = 253/262 96%, Gaps = 0/262 0%
Query  2    ASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            +SSSS+L+V AL+AVF+GSA+GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG
Sbjct  8    SSSSSLLVVAALLAVFVGSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 67
Query  62   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
            GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFE+KC+KPESCSGE +TV ITDDNEE
Sbjct  68   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEE 127
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPN 181
            PIAPYHFDLSGHAFGSMAKKGEE+ +R AGELELQFRRVKCKYPDGTKPTFHVEK SNPN
Sbjct  128  PIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPN 187
Query  182  YLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGG 241
            YLA+LVKYVDGDGDVVAVDIKEKGKDKWIELKESWGA+WRIDTPDKLTGPFTVRYTTEGG
Sbjct  188  YLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGG 247
Query  242  TKSEVEDVIPEGWKADTSYSAK 263
            TK+E EDVIPEGWKADT  ++K
Sbjct  248  TKAEFEDVIPEGWKADTHDASK 269

Sequence Alignment: 8. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 341.8 bits 1674,  Expect = 1e-95
 Identities = 238/263 90%, Positives = 251/263 95%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLG+AHGIAKVPPGPNITA YGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKDVDKAPF+GMTGCGNTPIFK GRGCGSCFEIKCTKPESCSGE V V ITDDNE
Sbjct  61   GGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIA YHFDLSG AFG+MAKKGEEQKLRSAGELEL+FRRVKC+YP+GTK TFHVEK SNP
Sbjct  121  EPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV GDGDVVAVDIKEKGKDKWIELKESWG++WR+DTPDKLTGPFTVRYTTEG
Sbjct  181  NYLALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
            GTK E EDVIPEGWKADT+Y++K
Sbjct  241  GTKGEAEDVIPEGWKADTAYASK 263

Sequence Alignment: 9. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 339.3 bits 1661,  Expect = 8e-95
 Identities = 232/248 93%, Positives = 240/248 96%, Gaps = 0/248 0%
Query  16   VFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFN 75
            VFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPKDNGGACGYKDVDK PF+
Sbjct  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
Query  76   GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
            GMTGCGNTPIFKDGRGCGSCFEIKC+KPESCSGE VTV ITDDNEEPIAPYHFDLSGHAF
Sbjct  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
Query  136  GSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGD 195
            GSMAKKGEEQKLRSAGELEL+FRRVKCKYPDGTKPTFHVEK SNPNYLA+LVKY+DGDGD
Sbjct  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
Query  196  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWK 255
            VVAVDIKEKGKDKWIELKESWGAVWR+DTPDKLTGPFTVRYTTEGGTK E EDVIPEGWK
Sbjct  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
Query  256  ADTSYSAK 263
            ADT+Y AK
Sbjct  241  ADTAYEAK 248

Sequence Alignment: 10. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 339.1 bits 1660,  Expect = 1e-94
 Identities = 237/263 90%, Positives = 248/263 94%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSS VLLVVALFAVFLG+AHGIAKVPPGPNITA YGDKWLDAKSTWYGKPTGAGPKDN
Sbjct  1    MASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKDVDK PF+GMTGCGNTPIFK GRGCGSCFEIKCTKPESCSGE + V ITDDNE
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIA YH+DLSG AFG+MAKKGEEQKLRSAGELEL+FRRVKC+YP GTK TFHVEK SNP
Sbjct  121  EPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWR+DTPDKLTGPFTVRYTTEG
Sbjct  181  NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
            GTK E EDVIPEGWKADT+Y +K
Sbjct  241  GTKVEAEDVIPEGWKADTAYESK 263

Sequence Alignment: 11. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 330.7 bits 1618,  Expect = 3e-92
 Identities = 231/263 87%, Positives = 244/263 92%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSSSVLLVVALFAVFLGSAHGI KVPPGPNITA YGDKWLDAKSTWYGKPT AGPKDN
Sbjct  1    MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKDVDK PF+GMTGCGNTPIFK GRGCGSCFEIKCTKPE+CSGE V V ITDDNE
Sbjct  61   GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIA YHFDLSG AFGSMAKKG+EQKLRSAGE+E+QFRRVKCKYP+GTK TFHVEK SNP
Sbjct  121  EPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVK+V GDGDVVAVDIKEKGKDKWI LKESWGA+WRIDTP+ L GPFTVRYTTEG
Sbjct  181  NYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
            GTK E +DVIPEGWKADT+Y +K
Sbjct  241  GTKGEAKDVIPEGWKADTAYESK 263

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 267.8 bits 1302,  Expect = 3e-73
 Identities = 181/262 69%, Positives = 211/262 80%, Gaps = 0/262 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSS +L  V + A+    + G  KVPPGPNIT  YGDKWL+AK+TWYG P GAGPKDN
Sbjct  1    MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKDVDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIA YHFDLSG AFG+MAK G++++LR AG ++ QFRRVKCKYP  TK TFH+EKASNP
Sbjct  121  EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  181  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 240
Query  241  GTKSEVEDVIPEGWKADTSYSA 262
            G K   ED IP+GWKAD+ Y +
Sbjct  241  GEKIIAEDAIPDGWKADSVYKS 262

Sequence Alignment: 13. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 256.7 bits 1246,  Expect = 6e-70
 Identities = 170/263 64%, Positives = 206/263 78%, Gaps = 0/263 0%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASS  +L  V   A+    + G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DN
Sbjct  1    MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKD+DKAPF GM  CGN PIFKDG+GCGSCFE+KC+KPE+CS + V + ITD N 
Sbjct  61   GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIA YHFDLSGHAFG+MAK+G++++LR AG +++QFRRV+CKYP  TK TFHVEK SNP
Sbjct  121  EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP 180
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NY+A+LVKYV GDGDVV V++KEKG ++W  L ESWGA+WRIDTP  L GPF++R TTE 
Sbjct  181  NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES 240
Query  241  GTKSEVEDVIPEGWKADTSYSAK 263
              K    DVIP+ WKA+  Y ++
Sbjct  241  DQKLVANDVIPDNWKANALYKSE 263

Sequence Alignment: 14. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 249.7 bits 1211,  Expect = 7e-68
 Identities = 174/257 67%, Positives = 200/257 77%, Gaps = 2/257 0%
Query  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
            GYKDVDKAPF+ MTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  PYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLA 184
             YHFDLSG AFG+MAKKGEE KLR AGEL LQFRRVKC+YP  TK  FHVEK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  ILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
            +LVKY  GDG++V+VDIK KG D+++ +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  EVEDVIPEGWKADTSYSAK 263
            E EDVIPE WK DT Y +K
Sbjct  241  EQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 15. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 249.7 bits 1211,  Expect = 7e-68
 Identities = 174/257 67%, Positives = 200/257 77%, Gaps = 2/257 0%
Query  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
            GYKDVDKAPF+GMTGCGN PIFKDG  CGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  PYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLA 184
             YHFDLSG AFG+MAKKGEE KLR AGEL LQFRRVKC+YP  TK  FHVEK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  ILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
            +LVKY  GDG++V+VDIK KG D+++ +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  EVEDVIPEGWKADTSYSAK 263
            E EDVIPE WK DT Y +K
Sbjct  241  EQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 16. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 249.7 bits 1211,  Expect = 7e-68
 Identities = 174/257 67%, Positives = 200/257 77%, Gaps = 2/257 0%
Query  7    VLLVVAL-FAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGAC 64
            +L VVA+ +A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGAC
Sbjct  1    MLAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  65   GYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIA 124
            GYKDVDKAPF+ MTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA
Sbjct  61   GYKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  125  PYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLA 184
             YHFDLSG AFG+MAKKGEE KLR AGEL LQFRRVKC+YP  TK  FHVEK SNPNYLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLA 180
Query  185  ILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKS 244
            +LVKY  GDG++V+VDIK KG D+++ +K+SWGA+WRID P  L GPFT+R T+E G   
Sbjct  181  LLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHV 240
Query  245  EVEDVIPEGWKADTSYSAK 263
            E EDVIPE WK DT Y +K
Sbjct  241  EQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 17. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 248.2 bits 1203,  Expect = 2e-67
 Identities = 171/254 67%, Positives = 195/254 76%, Gaps = 1/254 0%
Query  10   VVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKD 68
            V  ++A  +G A       PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKD
Sbjct  5    VAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKD 64
Query  69   VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHF 128
            VDKAPF+GMTGCGN PIFKDG GCGSC+EIKC +P  CSGE V + ITD N E IA YHF
Sbjct  65   VDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHF 124
Query  129  DLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVK 188
            DLSG AFG+MAKKGEE KLR AGEL LQFRRVKC+YP  TK TFHVEK S+PNYLA+LVK
Sbjct  125  DLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVK 184
Query  189  YVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVED 248
            Y  GDG++V VDIK KG D ++ +K SWGA+WR+D P  L GPFT+R T+E G   E ED
Sbjct  185  YAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQED 244
Query  249  VIPEGWKADTSYSAK 263
            VIPE WK DT Y +K
Sbjct  245  VIPEDWKPDTVYKSK 259

Sequence Alignment: 18. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 245.4 bits 1189,  Expect = 1e-66
 Identities = 165/235 70%, Positives = 188/235 80%, Gaps = 1/235 0%
Query  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 87
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKDVDKAPF+GMTGCGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 147
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
            R AGEL LQFRRVKC+YP  TK  FHVEK S+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263
            +++ +K+SWGA+WRID P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241

Sequence Alignment: 19. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 244.8 bits 1186,  Expect = 2e-66
 Identities = 164/235 69%, Positives = 188/235 80%, Gaps = 1/235 0%
Query  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 87
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKDVDKAPF+GMTGCGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 147
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  148  RSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
            R AGEL LQFRRVKC+YP  TK  FHVEK S+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  208  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241

Sequence Alignment: 20. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 243.2 bits 1178,  Expect = 6e-66
 Identities = 170/235 72%, Positives = 193/235 82%, Gaps = 5/235 2%
Query  26   KVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPI 85
            KV  G NIT  YG  WL+ K+TWYGKPTGAGP DNGGACGYKDV+KAPFN M  CGN PI
Sbjct  3    KVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPI 62
Query  86   FKDGRGCGSCFEIKCTKPES--CSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGE 143
            FKDG  CGSCFEIKC KP+   CSGEAV V ITD N E IA YHFDL+GHAFG+MAKKG+
Sbjct  63   FKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQ 121
Query  144  EQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKE 203
            E+KL  AG ++++FRRVKCKY  G K TFHVEK SNPNYLA+LVKYVDGDGD+V VDIKE
Sbjct  122  EEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKE 179
Query  204  KGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263
            KG D +  LK SWGA+WR D+PD +  P TV+ TTEGGTK+  +DVIPEGWKADT+Y+AK
Sbjct  180  KGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 21. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 242.3 bits 1173,  Expect = 1e-65
 Identities = 160/224 71%, Positives = 183/224 81%, Gaps = 0/224 0%
Query  40   KWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIK 99
            KWLDAK+TWYGKPTGAGP DNGGACGYKDV+KAPFN M  CGN PIFKDG GCGSC+EIK
Sbjct  3    KWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  100  CTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRR 159
            C KP  CSGE V V ITD N EPIA YHFDL+G AFG+MAKKGEE+KLR AG +++QFRR
Sbjct  63   CDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRR 122
Query  160  VKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAV 219
            VKCKYP  TK  FHVEK  NPNY+A+L+KY  GDGD+VAVDIKEKG +++I LK SWGA+
Sbjct  123  VKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAI 182
Query  220  WRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263
            WRID+P  + GP  VR T+EGGT    +D IPEGWKADT Y++K
Sbjct  183  WRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSK 226

Sequence Alignment: 22. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 237.4 bits 1149,  Expect = 4e-64
 Identities = 165/249 66%, Positives = 193/249 77%, Gaps = 3/249 1%
Query  1    MASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 60
            MASSS +L  V + A+   S  G  KVPPGPNIT  YGDKWL+A+     +P    PKDN
Sbjct  1    MASSSLLLACVVVAAMVSPSPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDN 60
Query  61   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GGACGYKDVDKAPF GM  CGN PIFKDG+GCGSCFEIKC+KPE+CS +   + +TD N+
Sbjct  61   GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND 120
Query  121  EPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNP 180
            EPIA YHFDLSG A   MAK G++++LR AG ++ QFRRVKCKYP  TK TFH+EKASNP
Sbjct  121  EPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP 177
Query  181  NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEG 240
            NYLA+LVKYV GDGDVV V+IKEKG ++W  LKESWGA+WRIDTP  L GPF+VR TTEG
Sbjct  178  NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG 237
Query  241  GTKSEVEDVIPE 252
              +S  ED IP+
Sbjct  238  ARRSSAEDAIPD 249

Sequence Alignment: 23. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 236.2 bits 1143,  Expect = 9e-64
 Identities = 159/260 61%, Positives = 196/260 75%, Gaps = 3/260 1%
Query  1    MASSSSVLLVVALFAVFL-GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKD 59
            M S + ++ V A++A ++ G + G  KVPPGPNIT  Y  KWL AK+TWYG+P GAGP D
Sbjct  1    MGSLAKIVAVAAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDD 60
Query  60   NGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDN 119
            NGGACG K+V+  P+NG T CGN PIFKDG+GCGSC+EI+C KPE CSG+ VTV ITD N
Sbjct  61   NGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDMN 119
Query  120  EEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASN 179
             EPIAPYHFDLSG AFG+MAK G   KLR  G ++L+FRRV+CKY  G K  FHVEK SN
Sbjct  120  YEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSN 179
Query  180  PNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTE 239
            PNYLA+LVK+V  DGD+V +++KEK  D W  +K SWGA+WR+DTP  L  PF++R T+E
Sbjct  180  PNYLAMLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSE 238
Query  240  GGTKSEVEDVIPEGWKADTSYSA 262
             G K   +DVIP  WK DT Y++
Sbjct  239  SGKKVIAQDVIPVNWKPDTVYNS 261

Sequence Alignment: 24. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 234.2 bits 1133,  Expect = 4e-63
 Identities = 167/262 63%, Positives = 197/262 75%, Gaps = 6/262 2%
Query  1    MASSSS-----VLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGK-PTG 54
            MASSS+     +  V  L++  +GSA       PGPNITA Y ++W DAK+T+YG  P G
Sbjct  1    MASSSARRQAQLAAVAVLLSAMVGSALCEIGDKPGPNITATYNEEWQDAKATFYGSNPRG 60
Query  55   AGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVT 114
            A P D+GGACGYK+VDKAPF GMTGCGN PIFKDG GCGSCFEIKC +P  CS + V + 
Sbjct  61   AAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIR 120
Query  115  ITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHV 174
            ITD N E IA YHFDLSG AFGSMAK+G+E  LR AGEL LQFRRVKC+YP  TK TFHV
Sbjct  121  ITDKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHV 180
Query  175  EKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTV 234
            EK  N NYLA+LV+Y  GDGD+VAVDIK KG D+++ +K SWGA+WRID    L GPFTV
Sbjct  181  EKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTV 240
Query  235  RYTTEGGTKSEVEDVIPEGWKADTSYSA 262
            R T+E G K   EDVIP  WK +T+Y++
Sbjct  241  RLTSESGAKLVQEDVIPADWKPNTAYTS 268

Sequence Alignment: 25. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 233.5 bits 1129,  Expect = 6e-63
 Identities = 157/235 66%, Positives = 184/235 78%, Gaps = 1/235 0%
Query  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 87
            PGPNITA YG KWL+A++T+YG  P GA P D+GGACGYKDVDK PF+GMT CGN PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 147
            DG GC +C+EIKC +P  CSGE V V ITD N E IA YHFDLSG AFG+MAKKG+E KL
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  148  RSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
            R AGEL LQFRRVKCKYP GTK TFH+EK SN +YLA+LVKY  GDG++VAVDIK +  D
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  208  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263
            ++I +K SWGA+WRID    L GPF++R T+EGG     +DVIP  WK DT Y++K
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241

Sequence Alignment: 26. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 227.5 bits 1099,  Expect = 4e-61
 Identities = 148/257 57%, Positives = 194/257 75%, Gaps = 3/257 1%
Query  5    SSVLLVVALFAVFL-GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
            +++++V A++A ++ G + G  KVPPGPNIT  Y  KWL A++TWYG+P GAG  DNGGA
Sbjct  6    NNIMVVGAVLAALVAGGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGA 65
Query  64   CGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEP 122
            CG K+V+  P++GMT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EP
Sbjct  66   CGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEP 124
Query  123  IAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNY 182
            IAPYHFDLSG AFGS+AK G   K+R  G ++++FRRV+CKYP G K  FH+EK  NPNY
Sbjct  125  IAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 184
Query  183  LAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
            LA+LVKYV  DGD+V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G 
Sbjct  185  LAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGK 244
Query  243  KSEVEDVIPEGWKADTSYSA 262
            K   +DVIP  W+ D  Y++
Sbjct  245  KVIAKDVIPANWRPDAVYTS 264

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 226.1 bits 1092,  Expect = 1e-60
 Identities = 147/257 57%, Positives = 188/257 73%, Gaps = 1/257 0%
Query  4    SSSVLLVVALFAVFLGSAH-GIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGG 62
            +++++L VA+ A ++G    G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGG
Sbjct  5    TTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGG 64
Query  63   ACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEP 122
            ACG K+V+  P+NGM  CGN PIFKDGRGCGSC+E+KC +P +CS + VTV ITD N EP
Sbjct  65   ACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEP 124
Query  123  IAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNY 182
            I+ YHFD+SG AFG+MA  G+E +LR AG +++QFRRV+CKYP G K TFHVEK SNPNY
Sbjct  125  ISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNY 184
Query  183  LAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGT 242
            LA+LVK+V  DGDV+ +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G 
Sbjct  185  LAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGK 244
Query  243  KSEVEDVIPEGWKADTSY 260
                +DVIP  W  D  Y
Sbjct  245  SLIAKDVIPVNWMPDAIY 262

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 196.2 bits 942,  Expect = 1e-51
 Identities = 133/253 52%, Positives = 180/253 71%, Gaps = 12/253 4%
Query  5    SSVLLVVALFAVFLGSAHGIAKVPP-GPNIT--AEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            S V  ++A+++V++   HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNG
Sbjct  7    SKVAAILAILSVLV--VHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNG 64
Query  62   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
            GACG+K+V++ PF+ MT CGN PIFKDG+GCGSC++I+C K  SCSG   TV ITD N  
Sbjct  65   GACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYY 124
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPN 181
            P+A YHFDLSG AFG+MAK G   KLR +G +++QFRRV C YP G K  FHVE+ SNP 
Sbjct  125  PVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPV 183
Query  182  YLAILVKYVDGDGDVVAVDIKEK------GKDKWIELKESWGAVWRIDTPDKLTGPFTVR 235
            Y+A+LV+Y D DGDVV VD+ E           W  ++ESWG++WR+D+  +L  PF++R
Sbjct  184  YFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLR 243
Query  236  YTTEGGTKSEVEDVIPEGWKADTSY 260
              ++ G      +VIP  W  +++Y
Sbjct  244  IRSDSGKTLVANNVIPANWSPNSNY 268

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 193.2 bits 927,  Expect = 8e-51
 Identities = 126/242 52%, Positives = 172/242 71%, Gaps = 5/242 2%
Query  10   VVALFAVFLGSAHGIAKVPPGPNITAEY-GD-KWLDAKSTWYGKPTGAGPKDNGGACGYK 67
            V ALF+ ++ +   +A   PG    +++  D  W  A++TWYG PTGAGP D+GGACG+K
Sbjct  11   VAALFSFLVVTC--VAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFK 68
Query  68   DVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYH 127
            + ++ PF+ MT CGN PIFKDG+GCGSC++I+C    +CSG   TV ITD N  P++ YH
Sbjct  69   NTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYH 128
Query  128  FDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILV 187
            FDLSG AFG+MAK G+  +LR AG +++QF+RV C +P G K TFHVE+ SNP Y+A+LV
Sbjct  129  FDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLV 187
Query  188  KYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVE 247
            +Y DGDGDVV VD+ E     W  ++ESWG++WR+D+  +LT PF++R T E G +    
Sbjct  188  EYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVAS 247
Query  248  DVIPEGW 254
             VIP  W
Sbjct  248  QVIPANW 254

Sequence Alignment: 30. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 190.0 bits 911,  Expect = 8e-50
 Identities = 122/225 54%, Positives = 161/225 71%, Gaps = 7/225 3%
Query  35   AEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGS 94
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FKDG+GCGS
Sbjct  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
Query  95   CFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELE 154
            C++I+CTK +SCSG + TV ITD N  P+AP+HFDLSG AFG +AK G   KLR +G ++
Sbjct  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
Query  155  LQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGK------DK 208
            ++F RV C++P G K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E          K
Sbjct  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
Query  209  WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260
            W  ++ESWG++WR+DT  +L  PF++R   E G      +VIP  W+ +T Y
Sbjct  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 183.7 bits 879,  Expect = 6e-48
 Identities = 125/249 50%, Positives = 175/249 70%, Gaps = 18/249 7%
Query  2    ASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            AS+  V ++++++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  4    ASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDNG 51
Query  62   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
            GACG+K+ ++ PF  MT CGN P+F+DG+GCG+C++I+CT   SCSG+  TV ITD N  
Sbjct  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPN 181
            P+A YHFDLSG AFG+MA+ G   +LR AG +++QFRRV C Y  G    FHVE  SNP 
Sbjct  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
Query  182  YLAILVKYVDGDGDVVAVDIKEK---GKDK--WIELKESWGAVWRIDTPDKLTGPFTVRY 236
            YLA+LV++ + DG VV +D+ E    GK    W  ++ SWG++WR+D   +L GP ++R 
Sbjct  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
Query  237  TTEGGTKSEVEDVIPEGWKADTSYSAK 263
             +E G       VIP  W+A+T+Y +K
Sbjct  231  VSESGQTVIAHQVIPANWRANTNYGSK 257

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 183.3 bits 877,  Expect = 8e-48
 Identities = 116/219 52%, Positives = 156/219 71%, Gaps = 3/219 1%
Query  41   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC 100
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  101  TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRV 160
             +  +CSG A TV ITD N  P++ YHFDLSG AFG +AK G    LR AG +++QF RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  161  KCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD--KWIELKESWGA 218
             C++P G K  FHVE+ S+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
Query  219  VWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260
            VWR+D+  +L  PF++R  ++ G      DVIP  W  +T Y
Sbjct  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263

Sequence Alignment: 33. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 181.7 bits 869,  Expect = 2e-47
 Identities = 124/254 48%, Positives = 174/254 68%, Gaps = 9/254 3%
Query  4    SSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGA 63
            SS+ + +VAL+++++ S    + V     +   Y   WL AK+TWYG P GAGP DNGGA
Sbjct  5    SSNAIALVALLSMLFTSVR--SAVNYDTAVARSYTSGWLPAKATWYGAPNGAGPDDNGGA 62
Query  64   CGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC--TKPESCSGEAVTVTITDDNEE 121
            CG+K+V++ P + M  CGN PIF  G GCG C+EIKC  +   SCSG+   + ITD N  
Sbjct  63   CGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITDMNYY 122
Query  122  PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPN 181
            P+A YH+DLSG AFGSMAK G   +LR AG +++QFRRV C +P G K TFHV++ SNPN
Sbjct  123  PVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFP-GMKVTFHVQRGSNPN 181
Query  182  YLAILVKYVDGDGDVVAVDIKE--KGKDK--WIELKESWGAVWRIDTPDKLTGPFTVRYT 237
            YLA+LV+YV+ DG VV +++ +   G+    W +++ SWG+VWR+DT   + GPF++R T
Sbjct  182  YLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRIT 241
Query  238  TEGGTKSEVEDVIPEGWKADTSY 260
            ++ G      + IP  W+ D +Y
Sbjct  242  SDTGKTLVANNAIPAYWQQDHAY 264

Sequence Alignment: 34. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 169.3 bits 806,  Expect = 9e-44
 Identities = 108/185 58%, Positives = 139/185 75%, Gaps = 2/185 1%
Query  77   MTGCGNTPIFKDGRGCGSCFEIKCT-KPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG  VTV ITD N EPIAPYHFDLSG AF
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
Query  136  GSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGD 195
            GS+AK G   KLR  G ++++FRRV+CKYP G K  FH+EK  NPNY+A+LVK+V  DGD
Sbjct  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
Query  196  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWK 255
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K   +D+IP  W+
Sbjct  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
Query  256  ADTSYSA 262
             D  Y++
Sbjct  180  PDAVYTS 186

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 155.8 bits 739,  Expect = 2e-39
 Identities = 126/224 56%, Positives = 163/224 72%, Gaps = 11/224 4%
Query  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFE 97
            G  WL+A++TWYG P GAGP DNGGACG+K+V+  PF+ MT CGN P+FKDG+GCGSC++
Sbjct  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
Query  98   IKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQF 157
            I+C    +CSG   TV ITD N  P++ YHFDLSG AFG+MAK     +LR AG +++QF
Sbjct  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
Query  158  RRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEK-----GKDK---- 208
            RRV C+YP G   TFHVE+ SNP Y+AILV+Y +GDGDVV VD+ E      G D     
Sbjct  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
Query  209  -WIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSA 262
             W  ++ESWG++WR+DT   L GPF++R T E G     + VIP  W+ +T YS+
Sbjct  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSS 322

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 148.9 bits 704,  Expect = 2e-37
 Identities = 108/252 42%, Positives = 156/252 61%, Gaps = 12/252 4%
Query  5    SSVLLVVALFAVFL---GSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
            S +L ++A++++FL          K+      +    D W  A +TWYG   G G +  G
Sbjct  10   SELLTLIAILSIFLVIPSFCFNPKKLYNASYYSPSSSD-WSPAVATWYGPANGDGSE--G 66
Query  62   GACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNE 120
            GACGY + V + PF+ +   G+  I+  G+GCGSC+E+KCT   +CSG  V V ITD+  
Sbjct  67   GACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECA 126
Query  121  E--PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKAS 178
                 A YHFDLSG+AFG+MA  G+++ LR+AG++ +Q RR++C YP G    FHV+  S
Sbjct  127  GCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSGS 185
Query  179  NPNYLAILVKYVDGDGDVVAVDIKEK-GKDKWIELKESWGAVWRIDTPDKLTGPFTVRYT 237
            N  Y+A LV+Y DGDGD+  V++KE      W  +++SWGAVW+ D    L  PF+++ T
Sbjct  186  NQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLT 245
Query  238  T-EGGTKSEVEDVIPEGWKADTSY 260
            T E G      +VIP GW    +Y
Sbjct  246  TLESGQTIVANNVIPAGWTPGQTY 269

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 148.7 bits 703,  Expect = 2e-37
 Identities = 104/219 47%, Positives = 143/219 65%, Gaps = 11/219 5%
Query  38   GDKWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKAPFNGMTGCGNTPIFKDGRGCGSCF 96
            G  W    +TWYG P G G +  GGACGY+  V + PF+ M   G   +FK+G+GCGSC+
Sbjct  42   GYGWSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCY 99
Query  97   EIKCTKPESCSGEAVTVTITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEQKLRSAGEL 153
            +IKCT   +CSG  VTV ITD     +      HFD+SG AFG+MA +G   +LRSAG L
Sbjct  100  QIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVL 159
Query  154  ELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDI-KEKGKDKWIEL 212
            ++Q++RV C++       F V+  SNP YLAILV+Y +GDGD+ AV I K +G   W  +
Sbjct  160  KIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAM 217
Query  213  KESWGAVWRID--TPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260
            ++SWGA WR++  T   L+ PF++R T+  G      +VIP GW+A  +Y
Sbjct  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 93.4 bits 425,  Expect = 9e-21
 Identities = 75/197 38%, Positives = 110/197 55%, Gaps = 13/197 6%
Query  60   NGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDN 119
            + GAC Y  +    F G        I+KDG GCG+CF+++C  P  CS +  TV +TD N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  120  EEPIAPYHFDLSGHAFGSMAKK--GEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKA 177
            +       + LS  AF +MAK   G ++ L   G +++++RRV C Y +  K    VE++
Sbjct  101  KT--NQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGN-KKMNVRVEES 157
Query  178  S-NPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRID-TPDKLTGPFTVR 235
            S NPNYLAI + Y  G  +VVA+ I + G   W  +  S GAVW  D  P+   G +  R
Sbjct  158  SKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTDKVPN---GALQFR 214
Query  236  YTTEGGTKSEV---EDVIPEGWKADTSYSA 262
            +    G   ++   + V+P  W+A  SY A
Sbjct  215  FVVTAGYDGKMVWSQRVLPANWEAGKSYDA 244

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 85.0 bits 383,  Expect = 3e-18
 Identities = 81/218 37%, Positives = 118/218 54%, Gaps = 35/218 16%
Query  29   PGPNITAEYGDK-WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAP-FNGMTGCGNTPIF 86
            P P     Y    W D  +T+YG P+G G  D GGACGY   D    ++  T   +TP+F
Sbjct  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
Query  87   KDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPY--------------HFDLSG 132
             DG GCG C+E++C K   C+  + +V IT  N  P   Y              HFD++ 
Sbjct  98   ADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAP 157
Query  133  HAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDG 192
             +F  +A+       R AG + +Q+RRV C+   G +  F ++   N  +L + V  V G
Sbjct  158  PSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVGG 206
Query  193  DGDVVAVDIKEKGKD-KWIELKESWGAVWRI----DTPDKLTGPFTVRYTTEGGTKSEVE 247
             GDV ++ +K  G    WI+   +WG  +++    D  D LT  +T  Y+T   T   V 
Sbjct  207  AGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-VS 264
Query  248  DVIPEGWKADTSY 260
            D I   W     Y
Sbjct  265  DAISPWWITGLCY 277

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 84.4 bits 380,  Expect = 5e-18
 Identities = 65/199 32%, Positives = 101/199 50%, Gaps = 10/199 5%
Query  60   NGGACGYKDVDKAPFNGMTGCGNTP-IFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 118
            N G+CGY  +  A FNG      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
Query  119  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKAS 178
                     + LS  A+ +MA+ G   +LR+   ++++++RV C+Y  G   +  VE+ S
Sbjct  109  ARST-NRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
Query  179  NPNY-LAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYT 237
             P   L+I   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
Query  238  TEGGTKSEVE----DVIPEGWKADTSYSA 262
              GG   +      +V+P  W A   Y A
Sbjct  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 62.7 bits 269,  Expect = 7e-12
 Identities = 40/90 44%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+  +DV+PE +    +Y+
Sbjct  86   LKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 62.7 bits 269,  Expect = 7e-12
 Identities = 40/90 44%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+  +DV+PE +    +Y+
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 62.7 bits 269,  Expect = 7e-12
 Identities = 40/90 44%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+  +DV+PE +    +Y+
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 62.7 bits 269,  Expect = 7e-12
 Identities = 40/90 44%, Positives = 60/90 66%, Gaps = 4/90 4%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 227
            K TF VEK SN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  228  LTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261
            L GPF  R+ TE G K+  +DV+PE +    +Y+
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYA 119

Sequence Alignment: 45. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 56.7 bits 236,  Expect = 1e-10
 Identities = 32/34 94%, Positives = 32/34 94%, Gaps = 0/34 0%
Query  24   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGP 57
            I KVPPGPNITA YGDKWLDAKSTWYGKPTGAGP
Sbjct  1    IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 46. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 54.4 bits 224,  Expect = 6e-10
 Identities = 31/32 96%, Positives = 31/32 96%, Gaps = 0/32 0%
Query  24   IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGA 55
            IAKVPPGPNITA YGDKWLDAKSTWYGKPTGA
Sbjct  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 55.7 bits 233,  Expect = 7e-10
 Identities = 35/88 39%, Positives = 57/88 64%, Gaps = 2/88 2%
Query  172  FHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDKLTG 230
            F VEK S+   LA+ +KY + +GD +A V++KE G ++W+ LK++   VW I +   L G
Sbjct  6    FTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 64
Query  231  PFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260
            PF  R+ +E G ++  +DV+P  +K  T+Y
Sbjct  65   PFNFRFVSEKGMRNVFDDVVPADFKVGTTY 94

Sequence Alignment: 48. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 54.1 bits 225,  Expect = 2e-09
 Identities = 34/91 37%, Positives = 58/91 63%, Gaps = 3/91 3%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 227
            K TF VEK S+P  L + +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
Query  228  LTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261
            LTGPF  R+ ++GG ++  ++VIP  +K  T+Y+
Sbjct  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93

Sequence Alignment: 49. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 52.5 bits 217,  Expect = 6e-09
 Identities = 34/86 39%, Positives = 53/86 61%, Gaps = 2/86 2%
Query  172  FHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDKLTG 230
            F VEK S+   LA+ +KY   +GD +A V++KE G ++W+ LK++   VW I +   L G
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  231  PFTVRYTTEGGTKSEVEDVIPEGWKADT 258
            PF  R+ +E G  +  +DV+P  +K  T
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 50. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 52.2 bits 216,  Expect = 9e-09
 Identities = 38/85 44%, Positives = 52/85 61%, Gaps = 7/85 8%
Query  172  FHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGP 231
            FHVE+ S+P + A+ +K  D   ++  VD++E G D    + +S G  W ID P  L GP
Sbjct  24   FHVEE-SSPKF-ALSIK--DSAKEITQVDVREHGADNMDPMTKS-GDSWTIDKP--LKGP 76
Query  232  FTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263
            + +R   EGG     +DVIPE WKA T Y  K
Sbjct  77   LNIRLRAEGGGSRVQDDVIPENWKAGTDYPTK 108

Sequence Alignment: 51. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 49.1 bits 200,  Expect = 8e-08
 Identities = 27/89 30%, Positives = 50/89 56%, Gaps = 1/89 1%
Query  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTG 230
            TF V+K S+P  L + +KY      +  V++++ G ++W  L +  G VW + +   L G
Sbjct  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
Query  231  PFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260
            PF  R+ ++GG ++  ++VIP  +    +Y
Sbjct  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104

Sequence Alignment: 52. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 46.1 bits 185,  Expect = 5e-07
 Identities = 29/92 31%, Positives = 54/92 58%, Gaps = 3/92 3%
Query  168  TKPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPD 226
            TK  + VEK S+   L + +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
Query  227  KLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261
             LTGP   R+ ++GG K+  ++VIP  +    +Y+
Sbjct  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93

Sequence Alignment: 53. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 40.7 bits 158,  Expect = 3e-05
 Identities = 24/91 26%, Positives = 46/91 50%, Gaps = 1/91 1%
Query  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKL 228
            K  + V+K S+   LA+ + Y   +  +  V++++ G ++W  L +  G VW +     L
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  229  TGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260
             GPF  R+ ++ G K   ++V    +K   +Y
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

Sequence Alignment: 54. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 35.5 bits 132,  Expect = 0.001
 Identities = 27/89 30%, Positives = 45/89 50%, Gaps = 6/89 6%
Query  167  GTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIE-LKESWGAVWRIDTP 225
            GT  T  V K S    L+++         +  V +K KG   + + LKES    + +D+ 
Sbjct  26   GTTLTIEVGKDSTSTKLSLITNVA-----ISEVSVKPKGATDFTDDLKESEPKTFTLDSK 80
Query  226  DKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260
            + + GP   R+  +GG    V++ IP  +KA + Y
Sbjct  81   EPIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVY 115

Sequence Alignment: 55. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 35.3 bits 131,  Expect = 0.001
 Identities = 28/88 31%, Positives = 47/88 53%, Gaps = 6/88 6%
Query  171  TFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIE-LKESWGAVWRIDTPDKLT 229
            T+ + K S    L +LV       DV  V +K+KG   + + LKES    +  ++ + + 
Sbjct  28   TWTIGKDSTSTRL-VLV----ASADVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIK 82
Query  230  GPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263
            GP++VR+  +G      +DVIP  +K  + Y  K
Sbjct  83   GPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTK 116

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.