The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFY
GDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPG
SPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQRVAGIVPVQYRRVPC
QRTGGVRFCLQGNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAA
LDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA85432 Ory s 1 284 2032 486.8 3.7e-139
AAF72986 Ory s 1 275 420 106.2 1.4e-24
AAF72990 Ory s 1 269 386 98.2 3.5e-22
AAF72988 Ory s 1 327 386 98.1 4.5e-22
CAB63699 Lol p 1.0103 263 383 97.5 5.5e-22
AAB61710 Ory s 1 261 382 97.3 6.4e-22
P43213 Phl p 1 263 382 97.3 6.4e-22
P58738 Zea m 1 269 378 96.3 1.3e-21
ACA23876 Pas n 1.0101 265 377 96.1 1.5e-21
P43216 Hol l 1 265 377 96.1 1.5e-21
Q41260 Pha a 1 269 376 95.8 1.8e-21
CAA93121 Hol l 1.0102 248 375 95.6 1.9e-21
AAA63278 Lol p 1.0102 252 373 95.2 2.6e-21
CAA10140 Hol l 1 263 372 94.9 3.3e-21
AAF72991 Ory s 1 267 372 94.9 3.4e-21
AAF72987 Ory s 1 275 371 94.6 4.1e-21
P14946 Lol p 1 263 368 93.9 6.4e-21
AAF72989 Ory s 1 271 368 93.9 6.6e-21
A0A4D6G2J8 Uro m 1.0201 229 365 93.3 8.6e-21
AAF72984 Ory s 1 268 366 93.5 9.1e-21
AAD10496 Tri a ps93 271 364 93.0 1.3e-20
AAA63279 Lol p 1.0101 263 362 92.5 1.7e-20
AAF72983 Ory s 1 267 359 91.8 2.8e-20
CAA10520 Poa p a 263 357 91.4 3.9e-20
CAA81613 Phl p 1.0101 263 354 90.6 6.3e-20
AAF72985 Ory s 1 286 345 88.5 3.1e-19
AAA50175 Gly m 2 277 342 87.8 4.8e-19
A0A4D6FZ45 Uro m 1.0101 262 335 86.2 1.4e-18
AAL14079 Cyn d 1.0203 262 335 86.2 1.4e-18
QCX36431 Zoy m 1.0101 272 328 84.5 4.7e-18
AAL14077 Cyn d 1.0202 262 323 83.3 1e-17
ABC58726 Sor h 1.0101 239 318 82.2 2e-17
AAL14078 Cyn d 1 262 315 81.4 3.7e-17
O04701 Cyn d 1 246 309 80.1 9.1e-17
AAK96255 Cyn d 1.0201 244 308 79.8 1.1e-16
AAF80379 Cyn d 1.0204 244 305 79.1 1.7e-16
Q07154 Zea m 1 191 262 69.1 1.4e-13
Q40638 Ory s 1 263 220 59.0 2.1e-10
CAB37496 Ara t expansin 265 204 55.2 2.9e-09
AAG13596 Ory s 1 275 186 50.9 5.9e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 486.8 bits 2032,  Expect = 4e-139
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFY 60
            MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFY
Sbjct  1    MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFY 60
Query  61   GDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPG 120
            GDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPG
Sbjct  61   GDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPG 120
Query  121  SPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQRVAGIVPVQYRRVPC 180
            SPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQRVAGIVPVQYRRVPC
Sbjct  121  SPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQRVAGIVPVQYRRVPC 180
Query  181  QRTGGVRFCLQGNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAA 240
            QRTGGVRFCLQGNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAA
Sbjct  181  QRTGGVRFCLQGNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAA 240
Query  241  LDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY 284
            LDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY
Sbjct  241  LDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY 284

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 106.2 bits 420,  Expect = 1e-24
 Identities = 79/218 36%, Positives = 127/218 58%, Gaps = 25/218 11%
Query  52   WHDGSATFYGDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRC 111
            W  G AT+YG P G G + GGACGY S      +S+  AA    LF +G GCG CY+++C
Sbjct  45   WSSGGATWYGGPQGDGSE-GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKC 103
Query  112  VKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQR----- 166
              +  C+ G P  V+  T+ CP         GG C     HFDM+  +F  +A R     
Sbjct  104  TGNRACS-GRPVTVVI-TDSCP---------GGVCLNEAAHFDMSGTAFGAMANRGMGDR 152
Query  167  --VAGIVPVQYRRVPCQRTGGVRFCLQG--NHYWLLLYVMNVGGAGDVSSLSVKTSGGGG 222
               AG++ +QY+RVPC+    V F +    N Y+L + V    G GD++++ +  + GGG
Sbjct  153  LRSAGVLKIQYKRVPCRFAMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGG 212
Query  223  AWIQAAHNWGITYQVFAALDN--SDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGS 280
             W    ++WG T+++ +      S  ++++LT+ S   + ++ ++ I   W  GL Y+ +
Sbjct  213  GWKAMQQSWGATWRLNSNTGKPLSPPFSIRLTSGS--GKVLVANNVIPSGWQAGLTYRST 270
Query  281  NNF 283
             N+
Sbjct  271  VNY 273

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 98.2 bits 386,  Expect = 3e-22
 Identities = 86/248 34%, Positives = 131/248 52%, Gaps = 33/248 13%
Query  16   LAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGAC 74
            LAVA  A +V  G       +  P P   T Y  + W    AT+YG P G G  D GGAC
Sbjct  10   LAVAVVAALVGGGSCGPP--KVPPGPNITTNYN-APWLPARATWYGQPYGSGSTDNGGAC 66
Query  75   GYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPP 134
            G + N  +  Y+   +  + P+F DG GCG CYE++C +   C+    +V IT  N  P 
Sbjct  67   G-IKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPI 125
Query  135  NWYLPNDDGGWCNPPRHHFDMAPPSFLKLA-------QRVAGIVPVQYRRVPCQRTGG-- 185
            + Y              HFD +  +F  +A        R AGI+ +Q+RRV C+  GG  
Sbjct  126  SAY--------------HFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQK 171
Query  186  VRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDN 243
            V F ++   N  +L + V  V   GDV  + ++ +G   AW     +WG  +++  A   
Sbjct  172  VTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLP-AWRPMKLSWGAIWRMDTATPL 230
Query  244  SDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY 284
               +++++TT S   +++I  D I   W+    Y  +  FY
Sbjct  231  KAPFSIRVTTESG--KSLIAKDVIPVNWMPDAIYVSNVQFY 269

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 98.1 bits 386,  Expect = 5e-22
 Identities = 85/228 37%, Positives = 128/228 56%, Gaps = 42/228 18%
Query  39   PAPGAVTPYKTSD-----WHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAAL 92
            P+PG  +   +S      W +  AT+YG P+G G DD GGACG+  N  +  +S  T+  
Sbjct  74   PSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGF-KNVNLPPFSAMTSCG 132
Query  93   STPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHH 152
            + PLF DG GCG CY++RCV  P C+    +V+IT  N  P + Y              H
Sbjct  133  NEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLY--------------H 178
Query  153  FDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTG-GVRFCL-QG-NHYWLLLYVM 202
            FD++  +F  +A+       R AGI+ +Q+RRVPCQ  G  V F + QG N  ++ + V 
Sbjct  179  FDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVE 238
Query  203  NVGGAGDVSSLSV---KTSGGG------GAWIQAAHNWGITYQVFAALDNSDGLTVKLTT 253
               G GDV  + +   + S GG      G W     +WG  +++         +++++T 
Sbjct  239  YENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITN 298
Query  254  YSTPQQTIIVSDAISPWWITGLCYQGSNNF 283
             S   +T+I    I   W     Y     F
Sbjct  299  ES--GKTLIADQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 5. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 97.5 bits 383,  Expect = 5e-22
 Identities = 81/218 37%, Positives = 118/218 54%, Gaps = 35/218 16%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y    W D  +T+YG P+G G  D GGACGY   D    ++  T   +TP+F
Sbjct  29   PGPNITAEYGDK-WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAP-FNGMTGCGNTPIF 86
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAP 157
             DG GCG C+E++C K   C+  + +V IT  N  P   Y              HFD++ 
Sbjct  87   KDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPY--------------HFDLSG 132
Query  158  PSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVGG 206
             +F  +A+       R AG + +Q+RRV C+   G +  F ++   N  +L + V  V G
Sbjct  133  HAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDG 192
Query  207  AGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-VS 264
             GDV ++ +K  G    WI+   +WG  +++    D  D LT  +T  Y+T   T   V 
Sbjct  193  DGDVVAVDIKEKGKD-KWIELKESWGAVWRI----DTPDKLTGPFTVRYTTEGGTKSEVE 247
Query  265  DAISPWWITGLCY 277
            D I   W     Y
Sbjct  248  DVIPEGWKADTSY 260

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 97.3 bits 382,  Expect = 6e-22
 Identities = 81/217 37%, Positives = 119/217 54%, Gaps = 34/217 15%
Query  49   TSDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCY 107
            T+DW    AT+YG P+G G DD GGACG+ + +   + S  T+  + PLF DG GCG CY
Sbjct  28   TNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSM-TSCGNEPLFQDGKGCGACY 86
Query  108  ELRCVKSPWCNPGSP-SVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ- 165
            ++RC  +P C+ G P +V+IT  N      Y P          R+HFD++  +F  +A+ 
Sbjct  87   QIRCTNNPSCS-GQPRTVIITDMN------YYPV--------ARYHFDLSGTAFGAMARP 131
Query  166  ------RVAGIVPVQYRRVPCQRTG-GVRFCLQG--NHYWLLLYVMNVGGAGDVSSLSVK 216
                  R AGI+ +Q+RRVPC   G  V F ++   N  +L + V      G V  L V 
Sbjct  132  GLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVM 191
Query  217  TSGGGG----AWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWI 272
             S   G     W     +WG  +++ A        ++++ + S   QT+I    I   W 
Sbjct  192  ESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESG--QTVIAHQVIPANWR 249
Query  273  TGLCYQGSNNF 283
                Y     F
Sbjct  250  ANTNYGSKVQF 260

Sequence Alignment: 7. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 97.3 bits 382,  Expect = 6e-22
 Identities = 87/234 37%, Positives = 124/234 52%, Gaps = 37/234 15%
Query  24   VVTAGFTTDLYWQQQPAPGA-VTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDI 81
            V+ A F    Y   +  PG  +T      W D  +T+YG P+G G  D GGACGY   D 
Sbjct  12   VLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDK 71
Query  82   VSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPN 140
               +S  T   +TP+F  G GCG C+E++C K   C+ G P VV IT  N  P   Y   
Sbjct  72   PP-FSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACS-GEPVVVHITDDNEEPIAPY--- 126
Query  141  DDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCLQ-- 191
                       HFD++  +F  +A+       R AG + +Q+RRV C+   G +  ++  
Sbjct  127  -----------HFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVE 175
Query  192  --GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTV 249
               N  +L L V  V G GDV ++ +K  G    WI+   +WG  +++    D  D LT 
Sbjct  176  KGSNPNYLALLVKYVNGDGDVVAVDIKEKGKD-KWIELKESWGAIWRI----DTPDKLTG 230
Query  250  KLTT-YSTPQQTII-VSDAISPWWITGLCYQ 278
             +T  Y+T   T     D I   W     Y+
Sbjct  231  PFTVRYTTEGGTKTEAEDVIPEGWKADTSYE 261

Sequence Alignment: 8. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 96.3 bits 378,  Expect = 1e-21
 Identities = 81/226 35%, Positives = 121/226 53%, Gaps = 33/226 14%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P   T Y    W    AT+YG P+G G  D GGACG + N  +  YS  TA  + P+F
Sbjct  31   PGPNITTNYN-GKWLTARATWYGQPNGAGAPDNGGACG-IKNVNLPPYSGMTACGNVPIF 88
Query  98   ADGNGCGQCYELRCVKSPWCNPGSP-SVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMA 156
             DG GCG CYE+RC + P C+ G+P +V IT  N  P   Y              HFD++
Sbjct  89   KDGKGCGSCYEVRCKEKPECS-GNPVTVYITDMNYEPIAPY--------------HFDLS 133
Query  157  PPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL---QG-NHYWLLLYVMNVG 205
              +F  LA+       R  GI+ V++RRV C+   G +  +   +G N  +L + V  V 
Sbjct  134  GKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVA 193
Query  206  GAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSD 265
              GD+  + ++       W     +WG  +++  A      ++++LT+ S  +  +I  D
Sbjct  194  DDGDIVLMEIQDKLSA-EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKK--VIAKD 250
Query  266  AISPWWITGLCYQGSNNFY 284
             I   W     Y  +  FY
Sbjct  251  VIPANWRPDAVYTSNVQFY 269

Sequence Alignment: 9. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 96.1 bits 377,  Expect = 1e-21
 Identities = 86/249 34%, Positives = 129/249 51%, Gaps = 36/249 14%
Query  12   LAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMG-DDF 70
            LA  +AVA     + AG +     +  P P   T Y    W    AT+YG P+G G DD 
Sbjct  4    LAKIVAVAAVLAALVAGGSCG-PPKVPPGPNITTNYN-GKWLPAKATWYGQPNGAGPDDN 61
Query  71   GGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSP-SVVITGT 129
            GGACG + N  +  Y+  TA  + P+F DG GCG CYE+RC K P C+ G P +V IT  
Sbjct  62   GGACG-IKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNK-PECS-GQPVTVFITDM 118
Query  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
            N  P   Y              HFD++  +F  +A+       R  GI  +++RRV C+ 
Sbjct  119  NYEPIAPY--------------HFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKY 164
Query  183  TGGVRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
             GG +  ++     N  +L + V  V   GD+  + +K       W     +WG  +++ 
Sbjct  165  QGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEKSSD--WKPMKLSWGAIWRMD 222
Query  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNF 283
                    ++++LT+ S   + +I  D I   W     Y  +  F
Sbjct  223  TPKALVPPFSIRLTSES--GKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 10. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 96.1 bits 377,  Expect = 1e-21
 Identities = 92/248 37%, Positives = 135/248 54%, Gaps = 45/248 18%
Query  1    MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFY 60
            MASS  +  +++AA +AV   +     G       +  P P     Y   +W D  +T+Y
Sbjct  1    MASSSRSVLLLVAALFAVFLGS---AHGIA-----KVPPGPNITATYG-DEWLDAKSTWY 51
Query  61   GDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNP 119
            G P+G G  D GGACGY   D    +S  T   +TP+F DG GCG C+E++C K   C+ 
Sbjct  52   GKPTGAGPKDNGGACGYKDVDKPP-FSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCS- 109
Query  120  GSPSVV-ITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIV 171
            G P  V IT  N  P   Y              HFD++  +F  +A+       R AG +
Sbjct  110  GEPVTVHITDDNEEPIAPY--------------HFDLSGHAFGSMAKKGEEQKLRSAGEL 155
Query  172  PVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQA 227
             +++RRV C+   G +  F ++   N  +L L V  + G GDV ++ +K  G    WI+ 
Sbjct  156  ELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD-KWIEL 214
Query  228  AHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-VSDAISPWWITGLCYQ 278
              +WG  ++V    D  D LT  +T  Y+T   T     D I   W     Y+
Sbjct  215  KESWGAVWRV----DTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYE 263

Sequence Alignment: 11. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 95.8 bits 376,  Expect = 2e-21
 Identities = 88/236 37%, Positives = 127/236 53%, Gaps = 38/236 16%
Query  13   AAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFG 71
            +++L V  A   V  G    +  +  P P     Y    W D  +T+YG P+G G  D G
Sbjct  10   SSSLLVVAALLAVFVGSAQGIA-KVPPGPNITAEYGDK-WLDAKSTWYGKPTGAGPKDNG 67
Query  72   GACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSP-SVVITGTN 130
            GACGY   D    ++  T   +TP+F DG GCG C+EL+C K   C+ G P +V IT  N
Sbjct  68   GACGYKDVDKAP-FNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCS-GEPITVHITDDN 125
Query  131  LCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRT 183
              P   Y              HFD++  +F  +A+       R AG + +Q+RRV C+  
Sbjct  126  EEPIAPY--------------HFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYP 171
Query  184  GGVR--FCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFA 239
             G +  F ++   N  +L L V  V G GDV ++ +K  G    WI+   +WG  +++  
Sbjct  172  DGTKPTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKD-KWIELKESWGAIWRI-- 228
Query  240  ALDNSDGLTVKLTT-YSTPQQTII-VSDAISPWW 271
              D  D LT  +T  Y+T   T     D I   W
Sbjct  229  --DTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGW 260

Sequence Alignment: 12. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 95.6 bits 375,  Expect = 2e-21
 Identities = 83/218 38%, Positives = 119/218 54%, Gaps = 37/218 16%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y   +W D  +T+YG P+G G  D GGACGY   D    +S  T   +TP+F
Sbjct  14   PGPNITATYG-DEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPP-FSGMTGCGNTPIF 71
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPNDDGGWCNPPRHHFDMA 156
             DG GCG C+E++C K   C+ G P  V IT  N  P   Y              HFD++
Sbjct  72   KDGRGCGSCFEIKCSKPESCS-GEPVTVHITDDNEEPIAPY--------------HFDLS 116
Query  157  PPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVG 205
              +F  +A+       R AG + +++RRV C+   G +  F ++   N  +L L V  + 
Sbjct  117  GHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYID 176
Query  206  GAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-V 263
            G GDV ++ +K  G    WI+   +WG  ++V    D  D LT  +T  Y+T   T    
Sbjct  177  GDGDVVAVDIKEKGKD-KWIELKESWGAVWRV----DTPDKLTGPFTVRYTTEGGTKGEA 231
Query  264  SDAISPWWITGLCYQ 278
             D I   W     Y+
Sbjct  232  EDVIPEGWKADTAYE 246

Sequence Alignment: 13. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 95.2 bits 373,  Expect = 3e-21
 Identities = 80/218 36%, Positives = 117/218 53%, Gaps = 35/218 16%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y    W D  +T+YG P+G G  D GGACGY   D    ++  T   +TP+F
Sbjct  18   PGPNITAEYGDK-WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAP-FNGMTGCGNTPIF 75
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAP 157
             DG GCG C+E++C K   C+  + +V IT  N  P   Y              HFD++ 
Sbjct  76   KDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPY--------------HFDLSG 121
Query  158  PSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVGG 206
             +F  +A+       R AG + +Q+RRV C+     +  F ++   N  +L + V  V G
Sbjct  122  HAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDG 181
Query  207  AGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-VS 264
             GDV ++ +K  G    WI+   +WG  +++    D  D LT  +T  Y+T   T   V 
Sbjct  182  DGDVVAVDIKEKGKD-KWIELKESWGAVWRI----DTPDKLTGPFTVRYTTEGGTKSEVE 236
Query  265  DAISPWWITGLCY 277
            D I   W     Y
Sbjct  237  DVIPEGWKADTSY 249

Sequence Alignment: 14. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 94.9 bits 372,  Expect = 3e-21
 Identities = 82/218 37%, Positives = 118/218 54%, Gaps = 37/218 16%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y    W D  +T+YG P+G G  D GGACGY   D    +S  T   +TP+F
Sbjct  29   PGPNITATYG-DKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPP-FSGMTGCGNTPIF 86
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPNDDGGWCNPPRHHFDMA 156
              G GCG C+E++C K   C+ G P VV IT  N  P   Y              H+D++
Sbjct  87   KSGRGCGSCFEIKCTKPESCS-GEPIVVHITDDNEEPIAAY--------------HLDLS 131
Query  157  PPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCLQ----GNHYWLLLYVMNVG 205
              +F  +A+       R AG + +++RRV C+   G +  ++     N  +L L V  V 
Sbjct  132  GKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVD 191
Query  206  GAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-V 263
            G GDV ++ +K  G    WI+   +WG  ++V    D  D LT  +T  Y+T   T +  
Sbjct  192  GDGDVVAVDIKEKGKD-KWIELKESWGAVWRV----DTPDKLTGPFTVRYTTEGGTKVEA 246
Query  264  SDAISPWWITGLCYQ 278
             D I   W     Y+
Sbjct  247  EDVIPEGWKADTAYE 261

Sequence Alignment: 15. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 94.9 bits 372,  Expect = 3e-21
 Identities = 79/241 32%, Positives = 125/241 51%, Gaps = 35/241 14%
Query  16   LAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMG-DDFGGAC 74
            LA   AA +V+A   +    +  P P     Y    W +   T+YG P G G DD GGAC
Sbjct  8    LACVVAAAMVSA--VSCGPPKVPPGPNITAAYG-KQWLEARGTWYGKPKGAGPDDNGGAC 64
Query  75   GYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCP 133
            GY   D   +    +   + P+F DG GCG C+E++C K   C+   P ++ IT  N  P
Sbjct  65   GYKDIDKAPFLGMNSCG-NDPIFKDGKGCGSCFEVKCSKPEACSD-KPVIIHITDMNTEP 122
Query  134  PNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGV 186
               Y              HFD++  +F  +A+       R AGI+ +Q+RRV C+  G  
Sbjct  123  IAAY--------------HFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGET 168
Query  187  RFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALD 242
            +  ++     N  ++ + V  VGG GDV  + +K  G    W     +WG  +++     
Sbjct  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE-EWKPLNESWGAIWRIDTPKP 227
Query  243  NSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQ 278
                +++++TT S   Q ++ +D I   W     Y+
Sbjct  228  LKGPFSLRVTTES--DQKLVANDVIPDNWKANALYK 261

Sequence Alignment: 16. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 94.6 bits 371,  Expect = 4e-21
 Identities = 77/215 35%, Positives = 123/215 57%, Gaps = 37/215 17%
Query  50   SDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYE 108
            S W    AT+YG P+G G DD GGACG+ + +    +S+ T+  + P+F DG GCG CY+
Sbjct  42   SGWLPARATWYGAPTGAGPDDNGGACGFKNVNQYP-FSSMTSCGNEPIFKDGKGCGSCYQ 100
Query  109  LRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ--- 165
            +RC K P C+    +V+IT  N      Y P          R+HFD++  +F  +A+   
Sbjct  101  IRCNKDPSCSGNIETVIITDMN------YYPV--------ARYHFDLSGTAFGAMAKPGL 146
Query  166  ----RVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSV--- 215
                R +GI+ +Q+RRVPC   G  + F ++   N  ++ + V      GDV  + +   
Sbjct  147  NDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMES 206
Query  216  KTSGGG--GAWIQAAHNWGITYQVFAALDNSDGLTV--KLTTYSTPQQTIIVSDAISPWW 271
            K++ GG  G W     +WG  ++    LD++  L     L   S   +T++ ++ I   W
Sbjct  207  KSAYGGATGVWTPMRESWGSIWR----LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANW 262
Query  272  ITGLCYQGSNNF 283
                 Y+    F
Sbjct  263  SPNSNYRSIVQF 274

Sequence Alignment: 17. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 93.9 bits 368,  Expect = 6e-21
 Identities = 79/218 36%, Positives = 117/218 53%, Gaps = 35/218 16%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y    W D  +T+YG P+G G  D GGACGY + D    ++  T   +TP+F
Sbjct  29   PGPNITAEYGDK-WLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAP-FNGMTGCGNTPIF 86
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAP 157
             DG GCG C+E++C K   C+  + +V IT  N  P   Y              HFD++ 
Sbjct  87   KDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPY--------------HFDLSG 132
Query  158  PSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVGG 206
             +F  +A+       R AG + +Q+RRV C+     +  F ++   N  +L + V  V G
Sbjct  133  HAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDG 192
Query  207  AGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-VS 264
             GDV ++ +K  G    WI+   +WG  +++    D  D LT  +T  Y+T   T     
Sbjct  193  DGDVVAVDIKEKGKD-KWIELKESWGAVWRI----DTPDKLTGPFTVRYTTEGGTKSEFE 247
Query  265  DAISPWWITGLCY 277
            D I   W     Y
Sbjct  248  DVIPEGWKADTSY 260

Sequence Alignment: 18. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 93.9 bits 368,  Expect = 7e-21
 Identities = 75/208 36%, Positives = 119/208 57%, Gaps = 33/208 15%
Query  52   WHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELR 110
            W +  AT+YG P+G G  D GGACG+   +   +    T+  + PL+  G GCG CY +R
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGM-TSCGNQPLYKGGKGCGSCYRVR 101
Query  111  CVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ----- 165
            C ++P C+  + +V IT  N  P + Y              HFD++  +F +LA+     
Sbjct  102  CNRNPACSGNAQTVAITDMNYFPLSQY--------------HFDLSGIAFGRLAKPGRAD 147
Query  166  --RVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTSG- 219
              R AGI+ VQ+ RVPC+  G  V F ++   +  +L + V    G GDV+ + +K +G 
Sbjct  148  DLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGA 207
Query  220  GGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTY--STPQQTIIVSDAISPWWITGLCY 277
            GGG W     +WG  ++    LD++  L   ++    S   +T++  D I   W     Y
Sbjct  208  GGGRWTPMRESWGSVWR----LDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
Query  278  Q 278
            +
Sbjct  264  R 264

Sequence Alignment: 19. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 93.3 bits 365,  Expect = 9e-21
 Identities = 78/212 36%, Positives = 118/212 55%, Gaps = 34/212 16%
Query  52   WHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSL-YSTKTAALSTPLFADGNGCGQCYEL 109
            W D  AT+YG P+G G DD GGACGY   D+    +++  A  + P+F DG GCG CYE+
Sbjct  4    WLDAKATWYGKPTGAGPDDNGGACGY--KDVNKAPFNSMGACGNPPIFKDGLGCGSCYEI 61
Query  110  RCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ--- 165
            +C K   C+ G P +V IT  N  P   Y              HFD+A  +F  +A+   
Sbjct  62   KCDKPAECS-GEPVIVHITDQNYEPIAAY--------------HFDLAGTAFGAMAKKGE 106
Query  166  ----RVAGIVPVQYRRVPCQRTGGVRFCL---QG-NHYWLLLYVMNVGGAGDVSSLSVKT 217
                R AGI+ +Q+RRV C+     +  +   +G N  ++ L +    G GD+ ++ +K 
Sbjct  107  EEKLRKAGIIDMQFRRVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKE 166
Query  218  SGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCY 277
             G    +I   H+WG  +++ +       + V+LT  S    T++  DAI   W     Y
Sbjct  167  KGSE-EFIPLKHSWGAIWRIDSPKPIKGPIAVRLT--SEGGTTLVQDDAIPEGWKADTVY 223
Query  278  QGSNNF 283
                 F
Sbjct  224  TSKLQF 229

Sequence Alignment: 20. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 93.5 bits 366,  Expect = 9e-21
 Identities = 71/208 34%, Positives = 120/208 57%, Gaps = 33/208 15%
Query  51   DWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYEL 109
            +W    AT+YG P+G G DD GGACG+ + +    +S+ T+  + P+F DG GCG CY++
Sbjct  41   NWEVARATWYGAPTGAGPDDDGGACGFKNTNQYP-FSSMTSCGNEPIFKDGKGCGSCYQI 99
Query  110  RCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ---- 165
            RCV  P C+    +V+IT  N  P +              ++HFD++  +F  +A+    
Sbjct  100  RCVNHPACSGNPETVIITDMNYYPVS--------------KYHFDLSGTAFGAMAKPGQN 145
Query  166  ---RVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSVKTSG 219
               R AGI+ +Q++RVPC   G  V F ++   N  ++ + V    G GDV  + +  + 
Sbjct  146  DQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEAN 205
Query  220  GGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQ--QTIIVSDAISPWWITGLCY 277
               +W     +WG  ++    LD++  LT  ++   T +  + ++ S  I   W     Y
Sbjct  206  SQ-SWTPMRESWGSIWR----LDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVY 260
Query  278  Q 278
            +
Sbjct  261  R 261

Sequence Alignment: 21. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 93.0 bits 364,  Expect = 1e-20
 Identities = 82/224 36%, Positives = 127/224 56%, Gaps = 35/224 15%
Query  43   AVTPYKTSDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGN 101
            AV    TS W    AT+YG P+G G DD GGACG+ + +   + S+  A  + P+FA G 
Sbjct  31   AVARSYTSGWLPAKATWYGAPNGAGPDDNGGACGFKNVNQYPI-SSMGACGNEPIFAGGE 89
Query  102  GCGQCYELRCVKS--PWCNPGSPS-VVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPP 158
            GCG CYE++C  S  P C+ G P  +VIT  N      Y P          R+H+D++  
Sbjct  90   GCGMCYEIKCEYSNNPSCS-GQPRRIVITDMN------YYPV--------ARYHLDLSGT 134
Query  159  SFLKLAQ-------RVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAG 208
            +F  +A+       R AGI+ +Q+RRVPC   G  V F +Q   N  +L + V  V   G
Sbjct  135  AFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPGMKVTFHVQRGSNPNYLAVLVEYVNVDG 194
Query  209  DVSSLSVKTSGGG---GAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSD 265
             V  + +  +  G   G W     +WG  +++         +++++T  S   +T++ ++
Sbjct  195  TVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRIT--SDTGKTLVANN 252
Query  266  AISPWWITGLCYQGSNNFY 284
            AI  +W     Y  +  FY
Sbjct  253  AIPAYWQQDHAYWSNLQFY 271

Sequence Alignment: 22. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 92.5 bits 362,  Expect = 2e-20
 Identities = 78/218 35%, Positives = 116/218 53%, Gaps = 35/218 16%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y    W D  +T+YG P+G G  D GGACGY + D    ++  T   +TP+F
Sbjct  29   PGPNITAEYGDK-WLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAP-FNGMTGCGNTPIF 86
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAP 157
             DG GCG C+E++C K   C+  + +V IT  N  P   Y              HFD++ 
Sbjct  87   KDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPY--------------HFDLSG 132
Query  158  PSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVGG 206
             +F  +A+       R AG + +Q+RRV C+     +  F ++   N  +L + V  V G
Sbjct  133  HAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDG 192
Query  207  AGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-VS 264
             GDV ++ +K  G    W +   +WG  +++    D  D LT  +T  Y+T   T     
Sbjct  193  DGDVVAVDIKEKGKD-KWTELKESWGAVWRI----DTPDKLTGPFTVRYTTEGGTKSEFE 247
Query  265  DAISPWWITGLCY 277
            D I   W     Y
Sbjct  248  DVIPEGWKADTSY 260

Sequence Alignment: 23. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 91.8 bits 359,  Expect = 3e-20
 Identities = 80/246 32%, Positives = 121/246 49%, Gaps = 36/246 14%
Query  11   FLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMGD-D 69
            +L A + VA     V+ G       +  P P   T Y    W +  AT+YG P G G  D
Sbjct  6    LLLACVVVAAMVSAVSCGPP-----KVPPGPNITTSYG-DKWLEAKATWYGAPKGAGPKD 59
Query  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
             GGACGY   D   +    +   + P+F DG GCG C+E++C K   C+     + +T  
Sbjct  60   NGGACGYKDVDKAPFLGMNSCG-NDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
Query  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
            N  P   Y              HFD++  +F  +A+       R AGI+  Q+RRV C+ 
Sbjct  119  NDEPIAAY--------------HFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKY 164
Query  183  TGGVRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
                +  ++     N  +L L V  V G GDV  + +K  G    W     +WG  +++ 
Sbjct  165  PADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE-EWKALKESWGAIWRID 223
Query  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGS 280
                    ++V++TT    +  II  DAI   W     Y+ +
Sbjct  224  TPKPLKGPFSVRVTTEGGEK--IIAEDAIPDGWKADSVYKSN 263

Sequence Alignment: 24. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 91.4 bits 357,  Expect = 4e-20
 Identities = 82/217 37%, Positives = 116/217 53%, Gaps = 37/217 17%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y    W D  +T+YG P+G G  D GGACGY   D    +S  T   +TP+F
Sbjct  29   PGPNITATYGDK-WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAP-FSGMTGCGNTPIF 86
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPNDDGGWCNPPRHHFDMA 156
              G GCG C+E++C K   C+ G P +V IT  N  P   Y              HFD++
Sbjct  87   KSGRGCGSCFEIKCTKPESCS-GEPVLVHITDDNEEPIAAY--------------HFDLS 131
Query  157  PPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCLQ----GNHYWLLLYVMNVG 205
              +F  +A+       R AG + +++RRV C+   G +  ++     N  +L L V  V 
Sbjct  132  GKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVT 191
Query  206  GAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-V 263
            G GDV ++ +K  G    WI+   +WG  ++V    D  D LT  +T  Y+T   T    
Sbjct  192  GDGDVVAVDIKEKGKD-KWIELKESWGSIWRV----DTPDKLTGPFTVRYTTEGGTKGEA 246
Query  264  SDAISPWWITGLCY 277
             D I   W     Y
Sbjct  247  EDVIPEGWKADTAY 260

Sequence Alignment: 25. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 90.6 bits 354,  Expect = 6e-20
 Identities = 79/220 35%, Positives = 112/220 50%, Gaps = 33/220 15%
Query  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
            P P     Y    W D  +T+YG P+  G  D GGACGY   D    +S  T   +TP+F
Sbjct  29   PGPNITATYG-DKWLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPP-FSGMTGCGNTPIF 86
Query  98   ADGNGCGQCYELRCVKSPWCNPGSPSVV-ITGTNLCPPNWYLPNDDGGWCNPPRHHFDMA 156
              G GCG C+E++C K   C+ G P VV IT  N  P   Y              HFD++
Sbjct  87   KSGRGCGSCFEIKCTKPEACS-GEPVVVHITDDNEEPIAAY--------------HFDLS 131
Query  157  PPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCLQ----GNHYWLLLYVMNVG 205
              +F  +A+       R AG V +Q+RRV C+   G +  ++     N  +L L V  V 
Sbjct  132  GIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVA 191
Query  206  GAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSD 265
            G GDV ++ +K  G    WI    +WG  +++         +TV+ TT    +      D
Sbjct  192  GDGDVVAVDIKEKGKD-KWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGE--AKD 248
Query  266  AISPWWITGLCYQ 278
             I   W     Y+
Sbjct  249  VIPEGWKADTAYE 261

Sequence Alignment: 26. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 88.5 bits 345,  Expect = 3e-19
 Identities = 87/255 34%, Positives = 135/255 52%, Gaps = 42/255 16%
Query  3    SSWNNPAIFLAAALAVA--TAAQVVTAGFTTDLY---WQQQPAPGAVTPYKTSDWHDGSA 57
            SS    A+FL+  LAV    AA         D+    W    +  AV  Y    W    A
Sbjct  5    SSLAAAAVFLSL-LAVGHCAAADFNATDADADFAGNGWDFNSSDAAV--YW-GPWTKARA 60
Query  58   TFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPW 116
            T+YG P+G G DD GGACG+   +   + S  T+  + PLF DG GCG CY++RC K   
Sbjct  61   TWYGQPNGAGPDDNGGACGFKHTNQYPFMSM-TSCGNQPLFKDGKGCGSCYKIRCTKDQS 119
Query  117  CNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAG 169
            C+  S +V+IT  N      Y P        P   HFD++  +F +LA+       R +G
Sbjct  120  CSGRSETVIITDMN------YYP------VAP--FHFDLSGTAFGRLAKPGLNDKLRHSG 165
Query  170  IVPVQYRRVPCQRTG---GVRFCLQGNHYWLLLYVMNVGGAGDVSSLSV---KTSGGG-- 221
            I+ +++ RVPC+  G   G       N  ++ + V    G GDV  + +   KT+ G   
Sbjct  166  IIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPT 225
Query  222  GAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQ 278
            G W     +WG  +++         +++++   S   +T++ ++ I   W     Y+
Sbjct  226  GKWTPMRESWGSIWRLDTNHRLQAPFSIRIRNES--GKTLVANNVIPANWRPNTFYR 280

Sequence Alignment: 27. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 87.8 bits 342,  Expect = 5e-19
 Identities = 71/220 32%, Positives = 120/220 54%, Gaps = 26/220 11%
Query  49   TSDWHDGSATFYGDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFAD-GNGCGQCY 107
            +SDW    AT+YG  +G G + GGACGY  N +     +   +  +PL  D G GCG CY
Sbjct  45   SSDWSPAVATWYGPANGDGSE-GGACGY-GNAVGQPPFSSLISAGSPLIYDSGKGCGSCY 102
Query  108  ELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLA--- 164
            E++C  +  C+ G+P  V+  T+ C           G  +  ++HFD++  +F  +A   
Sbjct  103  EVKCTGNSACS-GNPVKVVI-TDEC----------AGCGSDAQYHFDLSGNAFGAMAISG 150
Query  165  ----QRVAGIVPVQYRRVPCQRTG-GVRFCLQG--NHYWLLLYVMNVGGAGDVSSLSVKT 217
                 R AG + +Q+RR+ C   G  + F +    N+ ++   V    G GD++ + +K 
Sbjct  151  QDENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKE 210
Query  218  SGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCY 277
            +   G+W    ++WG  ++          +++KLTT  + Q TI+ ++ I   W  G  Y
Sbjct  211  ALDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQ-TIVANNVIPAGWTPGQTY 269
Query  278  QGSNNF 283
            +   NF
Sbjct  270  RSIVNF 275

Sequence Alignment: 28. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 86.2 bits 335,  Expect = 1e-18
 Identities = 81/249 32%, Positives = 129/249 51%, Gaps = 36/249 14%
Query  12   LAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DD 69
            + A +AV  A+ V   G    +    +P P     Y    W D  ATFYG DP G   DD
Sbjct  1    MLAVVAVVLASMV--GGALCAM--GDKPGPNITATYG-DKWLDAKATFYGSDPRGAAPDD 55
Query  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
             GGACGY   D    + + T   + P+F DG GCG CYE++C +   C+ G P V+I  T
Sbjct  56   HGGACGYKDVDKAP-FDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECS-GEP-VLIKIT 112
Query  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
                        D  + +   +HFD++  +F  +A+       R AG + +Q+RRV C+ 
Sbjct  113  ------------DKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEY 160
Query  183  TGGVRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
                +  ++     N  +L L V    G G++ S+ +K S G   ++   ++WG  +++ 
Sbjct  161  PSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK-SKGSDEFLPMKQSWGAIWRID 219
Query  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNF 283
                    +T++LT+ S  +  +   D I   W     Y+    F
Sbjct  220  PPKPLKGPFTIRLTSESGGH--VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 29. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 86.2 bits 335,  Expect = 1e-18
 Identities = 81/249 32%, Positives = 129/249 51%, Gaps = 36/249 14%
Query  12   LAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DD 69
            + A +AV  A+ V   G    +    +P P     Y    W D  ATFYG DP G   DD
Sbjct  1    MLAVVAVVLASMV--GGALCAM--GDKPGPNITATYG-DKWLDAKATFYGSDPRGAAPDD 55
Query  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
             GGACGY   D    + + T   + P+F DG GCG CYE++C +   C+ G P V+I  T
Sbjct  56   HGGACGYKDVDKAP-FDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECS-GEP-VLIKIT 112
Query  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
                        D  + +   +HFD++  +F  +A+       R AG + +Q+RRV C+ 
Sbjct  113  ------------DKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEY 160
Query  183  TGGVRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
                +  ++     N  +L L V    G G++ S+ +K S G   ++   ++WG  +++ 
Sbjct  161  PSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK-SKGSDEFLPMKQSWGAIWRID 219
Query  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNF 283
                    +T++LT+ S  +  +   D I   W     Y+    F
Sbjct  220  PPKPLKGPFTIRLTSESGGH--VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 30. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 84.5 bits 328,  Expect = 5e-18
 Identities = 77/241 31%, Positives = 127/241 52%, Gaps = 36/241 14%
Query  14   AALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DDFG 71
            AA+AV  +A V +A          +P P     Y   +W+D  ATFYG +P G   DD G
Sbjct  13   AAVAVLLSAMVGSALCEIG----DKPGPNITATYNE-EWQDAKATFYGSNPRGAAPDDDG 67
Query  72   GACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNL 131
            GACGY + D   ++   T   + P+F DG GCG C+E++C +   C+     + IT    
Sbjct  68   GACGYKNVDKAPFFGM-TGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRIT---- 122
Query  132  CPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTG 184
                      D  + +   +HFD++  +F  +A+       R AG + +Q+RRV C+   
Sbjct  123  ----------DKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPS 172
Query  185  GVRFCL---QG-NHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAA 240
              +  +   +G N  +L L V    G GD+ ++ +K  G    ++    +WG  +++   
Sbjct  173  KTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSD-EFLPMKPSWGAIWRIDPK 231
Query  241  LDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCY 277
                  +TV+LT+ S  +  ++  D I   W     Y
Sbjct  232  KPLKGPFTVRLTSESGAK--LVQEDVIPADWKPNTAY 266

Sequence Alignment: 31. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 83.3 bits 323,  Expect = 1e-17
 Identities = 80/249 32%, Positives = 127/249 51%, Gaps = 36/249 14%
Query  12   LAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DD 69
            + A +AV  A+ V   G    +    +P P     Y    W D  ATFYG DP G   DD
Sbjct  1    MLAVVAVVLASMV--GGALCAM--GDKPGPNITATYG-DKWLDAKATFYGSDPRGAAPDD 55
Query  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
             GGACGY   D    +   T   + P+F DG  CG CYE++C +   C+ G P V+I  T
Sbjct  56   HGGACGYKDVDKAP-FDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECS-GEP-VLIKIT 112
Query  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
                        D  + +   +HFD++  +F  +A+       R AG + +Q+RRV C+ 
Sbjct  113  ------------DKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEY 160
Query  183  TGGVRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
                +  ++     N  +L L V    G G++ S+ +K S G   ++   ++WG  +++ 
Sbjct  161  PSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK-SKGSDEFLPMKQSWGAIWRID 219
Query  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNF 283
                    +T++LT+ S  +  +   D I   W     Y+    F
Sbjct  220  PPKPLKGPFTIRLTSESGGH--VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 32. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 82.2 bits 318,  Expect = 2e-17
 Identities = 72/216 33%, Positives = 116/216 53%, Gaps = 29/216 13%
Query  44   VTPYKTSDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSL-YSTKTAALSTPLFADGN 101
            +T    SDW +  AT+YG P+G G DD GGACGY   D+    +++  A  + P+F DG 
Sbjct  10   ITETYGSDWLERKATWYGKPTGAGPDDNGGACGY--KDVNKAPFNSMGACGNLPIFKDGL 67
Query  102  GCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFL 161
             CG C+E++C K         +VV+  T++             +     +HFD+A  +F 
Sbjct  68   -CGSCFEIKCDKPKPAECSGEAVVVHITDM------------NYEQIAAYHFDLAGHAFG 114
Query  162  KLAQR-------VAGIVPVQYRRVPCQRTGGVRFCLQ--GNHYWLLLYVMNVGGAGDVSS 212
             +A++        AGI+ +++RRV C+    V F ++   N  +L L V  V G GD+  
Sbjct  115  AMAKKGQEEKLAKAGIIDMKFRRVKCKYGEKVTFHVEKGSNPNYLALLVKYVDGDGDIVG 174
Query  213  LSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWI 272
            + +K  GG  A+    H+WG  ++  +       +TV++TT    +      D I   W 
Sbjct  175  VDIKEKGGD-AYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTA--YDDVIPEGWK 231
Query  273  TGLCY 277
                Y
Sbjct  232  ADTTY 236

Sequence Alignment: 33. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 81.4 bits 315,  Expect = 4e-17
 Identities = 80/249 32%, Positives = 126/249 50%, Gaps = 36/249 14%
Query  12   LAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DD 69
            + AA+AV  A+ V  A          +P P     Y    W D  ATFYG DP G   DD
Sbjct  1    MLAAVAVVLASMVGGAWCAMG----DKPGPNITATYG-DKWLDAKATFYGSDPRGAAPDD 55
Query  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
             GGACGY   D    +   T   + P+F DG GCG CYE++C +   C+ G P V+I  T
Sbjct  56   HGGACGYKDVDKAP-FDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECS-GEP-VLIKIT 112
Query  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQR 182
                        D  + +   +HFD++  +F  +A+       R AG + +Q+RRV C+ 
Sbjct  113  ------------DKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEY 160
Query  183  TGGVRFCL---QGNH-YWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVF 238
                +  +   +G+   +L L V    G G++  + +K  G    ++    +WG  +++ 
Sbjct  161  PSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD-VFLPMKLSWGAIWRMD 219
Query  239  AALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWITGLCYQGSNNF 283
                    +T++LT+ S  +  +   D I   W     Y+    F
Sbjct  220  PPKPLKGPFTIRLTSESGGH--VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 34. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 80.1 bits 309,  Expect = 9e-17
 Identities = 71/227 31%, Positives = 116/227 51%, Gaps = 32/227 14%
Query  38   QPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTP 95
            +P P     Y  S W +  ATFYG +P G   DD GGACGY   D    +   TA  + P
Sbjct  5    KPGPNITATYG-SKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPP-FDGMTACGNEP 62
Query  96   LFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDM 155
            +F DG GC  CYE++C K P    G P V++  T            D  + +   +HFD+
Sbjct  63   IFKDGLGCRACYEIKC-KEPVECSGEP-VLVKIT------------DKNYEHIAAYHFDL 108
Query  156  APPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCLQ----GNHYWLLLYVMNV 204
            +  +F  +A+       R AG + +Q+RRV C+   G +  ++     N ++L L V   
Sbjct  109  SGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYA 168
Query  205  GGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVS 264
             G G++ ++ +K       +I    +WG  +++         ++++LT+    +  ++  
Sbjct  169  AGDGNIVAVDIKPRDSD-EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAH--LVQD 225
Query  265  DAISPWWITGLCYQGSNNF 283
            D I   W     Y     F
Sbjct  226  DVIPANWKPDTVYTSKLQF 244

Sequence Alignment: 35. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 79.8 bits 308,  Expect = 1e-16
 Identities = 72/227 31%, Positives = 116/227 51%, Gaps = 32/227 14%
Query  38   QPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTP 95
            +P P     Y    W D  ATFYG DP G   DD GGACGY   D    +   T   + P
Sbjct  5    KPGPNITATYGDK-WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAP-FDGMTGCGNEP 62
Query  96   LFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDM 155
            +F DG  CG CYE++C +   C+ G P V+I  T            D  + +   +HFD+
Sbjct  63   IFKDGLACGSCYEIKCKEPAECS-GEP-VLIKIT------------DKNYEHIAAYHFDL 108
Query  156  APPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL---QGNH-YWLLLYVMNV 204
            +  +F  +A+       R AG + +Q+RRV C+     +  +   +G+   +L L V   
Sbjct  109  SGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYA 168
Query  205  GGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVS 264
             G G++  + +K  G    ++   ++WG  +++         +T++LT+ S  +  +   
Sbjct  169  AGDGNIVGVDIKPKGSD-EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH--VEQD 225
Query  265  DAISPWWITGLCYQGSNNF 283
            D I   W     Y+    F
Sbjct  226  DVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 36. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 79.1 bits 305,  Expect = 2e-16
 Identities = 72/227 31%, Positives = 116/227 51%, Gaps = 32/227 14%
Query  38   QPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTP 95
            +P P     Y    W D  ATFYG DP G   DD GGACGY   D    +   T   + P
Sbjct  5    KPGPNITATYGDK-WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAP-FDGMTGCGNEP 62
Query  96   LFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDM 155
            +F DG  CG CYE++C +   C+ G P V+I  T            D  + +   +HFD+
Sbjct  63   IFKDGLACGSCYEIKCKEPAECS-GEP-VLIKIT------------DKNYEHIAAYHFDL 108
Query  156  APPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL---QGNH-YWLLLYVMNV 204
            +  +F  +A+       R AG + +Q+RRV C+     +  +   +G+   +L L V   
Sbjct  109  SGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYA 168
Query  205  GGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVS 264
             G G++  + +K  G    ++   ++WG  +++         +T++LT+ S  +  +   
Sbjct  169  AGDGNIVGVDIKPKGSD-EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGH--VEQD 225
Query  265  DAISPWWITGLCYQGSNNF 283
            D I   W     Y+    F
Sbjct  226  DVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 37. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 69.1 bits 262,  Expect = 1e-13
 Identities = 59/178 33%, Positives = 96/178 53%, Gaps = 30/178 16%
Query  89   TAALSTPLFADGNGCGQCYELRCVKSPWCNPGSP-SVVITGTNLCPPNWYLPNDDGGWCN 147
            TA  + P+F DG GCG CYE+RC + P C+ G+P +V IT  N  P   Y          
Sbjct  2    TACGNVPIFKDGKGCGSCYEVRCKEKPECS-GNPVTVFITDMNYEPIAPY---------- 50
Query  148  PPRHHFDMAPPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL---QG-NHYW 196
                HFD++  +F  LA+       R  GI+ V++RRV C+   G +  +   +G N  +
Sbjct  51   ----HFDLSGKAFGSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNY 106
Query  197  LLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYST 256
            + + V  V   GD+  + ++       W     +WG  +++  A      ++++LT+ S 
Sbjct  107  VAVLVKFVADDGDIVLMEIQDKLSA-EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESG 165
Query  257  PQQTIIVSDAISPWWITGLCYQGSNNFY 284
              + +I  D I   W     Y  +  FY
Sbjct  166  --KKVIAKDIIPANWRPDAVYTSNVQFY 191

Sequence Alignment: 38. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 59.0 bits 220,  Expect = 2e-10
 Identities = 69/233 29%, Positives = 108/233 46%, Gaps = 33/233 14%
Query  11   FLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTSDWHDGSATFYGDPSGMGD-D 69
            +L A + VA       AG     + +  P P   T Y    W +        P  +   D
Sbjct  6    LLLACVVVAAMVSPSPAG-----HPKVPPGPNITTSYG-DKWLEARPPGMVRPRVLAPKD 59
Query  70   FGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGT 129
             GGACGY   D   +    +   + P+F DG GCG C+E++C K   C+     + +T  
Sbjct  60   NGGACGYKDVDKAPFLGMNSCG-NDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
Query  130  NLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ----RVAGIVPVQYRRVPCQRTGG 185
            N  P   Y              HFD++  +  K  +    R AGI+  Q+RRV C+    
Sbjct  119  NDEPIAAY--------------HFDLSGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPAD 164
Query  186  VRFCLQ----GNHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAAL 241
             +  ++     N  +L L V  V G GDV  + +K  G    W     +WG  +++    
Sbjct  165  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE-EWKALKESWGAIWRIDTPK 223
Query  242  DNSDGLTVKLTTYSTPQQTIIVSDAI 267
                 ++V++TT    + +    DAI
Sbjct  224  PLKGPFSVRVTTEGARRSS--AEDAI 247

Sequence Alignment: 39. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 55.2 bits 204,  Expect = 3e-09
 Identities = 55/208 26%, Positives = 93/208 44%, Gaps = 25/208 12%
Query  53   HDGSATFYGDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCV 112
            H   A ++   S +     GAC Y S     +++   AA    ++ DG+GCG C+++RC 
Sbjct  27   HSSKAAYFSSASALSS---GACAYGSM-ATGFFAGHIAAALPSIYKDGSGCGACFQVRCK 82
Query  113  KSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQR---VAG 169
                C+    +V++T  N          +        R    MA P  +  A R     G
Sbjct  83   NPTLCSSKGTTVIVTDLN--------KTNQTDLVLSSRAFRAMAKP--VVGADRDLLKQG 132
Query  170  IVPVQYRRVPCQ---RTGGVRFCLQG-NHYWLLLYVMNVGGAGDVSSLSVKTSGGGGAWI 225
            IV ++YRRVPC    +   VR      N  +L + ++  GG  +V ++ +   G    W 
Sbjct  133  IVDIEYRRVPCDYGNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSH-WS 191
Query  226  QAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPW-WITGLCY 277
                + G  + V   + N   L  ++   +     ++ S  + P  W  G  Y
Sbjct  192  YMTRSHGAVW-VTDKVPNG-ALQFRFVVTAGYDGKMVWSQRVLPANWEAGKSY 242

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 50.9 bits 186,  Expect = 6e-08
 Identities = 50/196 25%, Positives = 79/196 40%, Gaps = 15/196 7%
Query  72   GACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNL 131
            G+CGY  +   S+     AA S  LF  G GCG C+++RC     C+     VV+T    
Sbjct  52   GSCGY-GSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEAR 110
Query  132  CPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQRVAGIVPVQYRRVPCQRTGGVRFCLQ 191
                  L      +    R      P    +L  R A  V V+Y+RVPC+   G  + ++
Sbjct  111  STNRTDLVLSAAAYAAMAR------PGMAAQLRTRRA--VDVEYKRVPCEYAAGRNLSIR 162
Query  192  GNH-----YWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDG 246
                      L +  +  GG  D+ ++ V T G    W     ++G  +    A      
Sbjct  163  VEEKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSN-WKFMTRDYGPAWSTAQAPAGPLQ 221
Query  247  LTVKLTTYSTPQQTIIVSDAISPWWITGLCY 277
            + V +T     +      + +   W  G  Y
Sbjct  222  FRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.