The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT
STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY
LRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFPSDDAKCNALKNARLADVCISTSA
APVLLPAHSFTTEDDKNIHTFELIDGGVAATNPTLLALTHIRNEIIRQNPRFIGANLTES
KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDSHLSAL
FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES
IPGAPTNEAAIAKFAKLLSEERKLRQLK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAC27724 Hev b 7.01 388 2503 576.9 5.2e-166
CAA11042 Hev b 7.02 388 2454 565.8 1.2e-162
CAA11041 Hev b 7.02 388 2449 564.6 2.6e-162
AAA33819 Sola t 1 386 723 171.2 7.2e-44
CAA27588 Sola t 1 386 710 168.2 5.6e-43
CAA27571 Sola t 1 386 709 168.0 6.5e-43
CAA31575 Sola t 1 386 707 167.5 9e-43
P15476 Sola t 1 377 701 166.2 2.2e-42
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hev b 7.01 Sequence ID: AAC27724

 Score = 576.9 bits 2503,  Expect = 5e-166
 Identities = 388/388 100%, Positives = 388/388 100%, Gaps = 0/388 0%
Query  1    MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT 60
            MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT
Sbjct  1    MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT 60
Query  61   STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY 120
            STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY
Sbjct  61   STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY 120
Query  121  LRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFPSDDAKCNALKNARLADVCISTSA 180
            LRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFPSDDAKCNALKNARLADVCISTSA
Sbjct  121  LRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFPSDDAKCNALKNARLADVCISTSA 180
Query  181  APVLLPAHSFTTEDDKNIHTFELIDGGVAATNPTLLALTHIRNEIIRQNPRFIGANLTES 240
            APVLLPAHSFTTEDDKNIHTFELIDGGVAATNPTLLALTHIRNEIIRQNPRFIGANLTES
Sbjct  181  APVLLPAHSFTTEDDKNIHTFELIDGGVAATNPTLLALTHIRNEIIRQNPRFIGANLTES 240
Query  241  KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDSHLSAL 300
            KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDSHLSAL
Sbjct  241  KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDSHLSAL 300
Query  301  FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES 360
            FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES
Sbjct  301  FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES 360
Query  361  IPGAPTNEAAIAKFAKLLSEERKLRQLK 388
            IPGAPTNEAAIAKFAKLLSEERKLRQLK
Sbjct  361  IPGAPTNEAAIAKFAKLLSEERKLRQLK 388

Sequence Alignment: 2. Allergen Name: Hev b 7.02 Sequence ID: CAA11042

 Score = 565.8 bits 2454,  Expect = 1e-162
 Identities = 381/388 98%, Positives = 382/388 98%, Gaps = 0/388 0%
Query  1    MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT 60
            MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT
Sbjct  1    MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT 60
Query  61   STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY 120
            STGGLITTMLTAPNEDKKP+YQAKDIKDFYLENCPKIFPKESRD YDPIHSIGPIYDGEY
Sbjct  61   STGGLITTMLTAPNEDKKPIYQAKDIKDFYLENCPKIFPKESRDTYDPIHSIGPIYDGEY 120
Query  121  LRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFPSDDAKCNALKNARLADVCISTSA 180
            LRELCNNLLKDLTVKDT TDVIIP FDIKLLLPVIF SDDAKCNALKNARLADVCISTSA
Sbjct  121  LRELCNNLLKDLTVKDTLTDVIIPAFDIKLLLPVIFSSDDAKCNALKNARLADVCISTSA 180
Query  181  APVLLPAHSFTTEDDKNIHTFELIDGGVAATNPTLLALTHIRNEIIRQNPRFIGANLTES 240
            APVLLPAHSFTTEDDKNIHTFELIDGGVAA NPTLLALTHIRNEIIRQNPRFIGANLTES
Sbjct  181  APVLLPAHSFTTEDDKNIHTFELIDGGVAAANPTLLALTHIRNEIIRQNPRFIGANLTES 240
Query  241  KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDSHLSAL 300
            KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVD HLSAL
Sbjct  241  KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDFHLSAL 300
Query  301  FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES 360
            FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES
Sbjct  301  FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES 360
Query  361  IPGAPTNEAAIAKFAKLLSEERKLRQLK 388
            IPGAPTNEAAIAKFAKLLSEERKLRQLK
Sbjct  361  IPGAPTNEAAIAKFAKLLSEERKLRQLK 388

Sequence Alignment: 3. Allergen Name: Hev b 7.02 Sequence ID: CAA11041

 Score = 564.6 bits 2449,  Expect = 3e-162
 Identities = 381/388 98%, Positives = 381/388 98%, Gaps = 0/388 0%
Query  1    MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT 60
            MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT
Sbjct  1    MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT 60
Query  61   STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY 120
            STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY
Sbjct  61   STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY 120
Query  121  LRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFPSDDAKCNALKNARLADVCISTSA 180
            LRELCNNLLKDLTVKDT TDVIIPTFDIKLLLPVIF SDDAKCNALKNARLADVCISTSA
Sbjct  121  LRELCNNLLKDLTVKDTLTDVIIPTFDIKLLLPVIFSSDDAKCNALKNARLADVCISTSA 180
Query  181  APVLLPAHSFTTEDDKNIHTFELIDGGVAATNPTLLALTHIRNEIIRQNPRFIGANLTES 240
            APVLLPAHSFTTEDDKNIHTFELIDGG AATNPTLLALTHIRNEIIRQNPRFIGANLTES
Sbjct  181  APVLLPAHSFTTEDDKNIHTFELIDGGAAATNPTLLALTHIRNEIIRQNPRFIGANLTES 240
Query  241  KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDSHLSAL 300
            KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVD HLSAL
Sbjct  241  KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDFHLSAL 300
Query  301  FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTGRLES 360
            FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGT LLEKQESRINLDTGRLES
Sbjct  301  FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTRLLEKQESRINLDTGRLES 360
Query  361  IPGAPTNEAAIAKFAKLLSEERKLRQLK 388
            IPGA TNEAAI KFAKLLSEERKLRQLK
Sbjct  361  IPGASTNEAAITKFAKLLSEERKLRQLK 388

Sequence Alignment: 4. Allergen Name: Sola t 1 Sequence ID: AAA33819

 Score = 171.2 bits 723,  Expect = 7e-44
 Identities = 169/362 46%, Positives = 244/362 67%, Gaps = 33/362 9%
Query  1    MATGSTTLTQGKK-ITVLSIDGGGIRGIIPGIILASLESKLQDLDG-PDARIADYFDIIA 58
            +AT S+T  + ++ +TVLSIDGGGI+GIIP IIL  LE +LQ++D   DAR+ADYFD+I 
Sbjct  15   LATTSSTCAKLEEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIG 74
Query  59   GTSTGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDG 118
            GTSTGGL+T M+T PNE+ +P   AKDI  FY+E+ P IF      NY     IGP+YDG
Sbjct  75   GTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSG-SIIGPMYDG 127
Query  119  EYLRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFP-SDDAKCNALKNARLADVCIS 177
            +YL ++    L +  V    T+V I +FDIK   PVIF  S+ AK   L +A++ D+C S
Sbjct  128  KYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPEL-DAKMYDICYS 186
Query  178  TSAAPVLLPAHSFTTE-DDKNIHTFELIDGGVAAT-NPTLLALTHIRNEIIRQNPRFIGA 235
            T+AAP+ +P H F T   + +I+ F L+DGGVA   +P LL+L+ +   + +++P F   
Sbjct  187  TAAAPIYFPPHYFITHTSNGDIYEFNLVDGGVATVGDPALLSLS-VATRLAQEDPAFSSI 245
Query  236  NLTESKSRLVLSLGTG-KSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNA-SSDMV 293
               + K  L+LSLGTG  SE+ + Y A   +KW    W L      A+   +NA SS M 
Sbjct  246  KSLDYKQMLLLSLGTGTNSEFDKTYTAQEAAKWGPLRWML------AIQQMTNAASSYMT 299
Query  294  DSHLSALFKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINL 353
            D ++S +F++   ++ YLR+Q++ LTG  +    A+E N++ LV++G  LL+K  S+   
Sbjct  300  DYYISTVFQARHSQNNYLRVQENALTGTTTEMDDASEANMELLVQVGETLLKKPVSK--- 356
Query  354  DTGRLESIPGAPTNEAAIAKFAKLLSEERKLRQLK 388
            D+      P   T E A+ +FAKLLS+ +KLR  K
Sbjct  357  DS------P--ETYEEALKRFAKLLSDRKKLRANK 383

Sequence Alignment: 5. Allergen Name: Sola t 1 Sequence ID: CAA27588

 Score = 168.2 bits 710,  Expect = 6e-43
 Identities = 165/360 45%, Positives = 234/360 65%, Gaps = 32/360 8%
Query  3    TGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDG-PDARIADYFDIIAGTS 61
            T ST  T G+ +TVLSIDGGGI+GIIP IIL  LE +LQ++D   DAR+ADYFD+I GTS
Sbjct  18   TSSTCATLGEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTS 77
Query  62   TGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSI-GPIYDGEY 120
            TGGL+T M+T PNE+ +P   AKDI  FY+E+ P IF      NY    SI GP YDG+Y
Sbjct  78   TGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSG--SIFGPRYDGKY 129
Query  121  LRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFPSDDAKCNALKNARLADVCISTSA 180
            L ++    L +  V    T+V I +FDIK   PVIF   +   +   +A++ D+C ST+A
Sbjct  130  LLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAESPQLDAKMYDICYSTAA 189
Query  181  APVLLPAHSFTTEDDKNI-HTFELIDGGVAAT-NPTLLALTHIRNEIIRQNPRFIGANLT 238
            AP+ +P H F T       + F L+DG VA   +P LL+L+ +   + + +P F      
Sbjct  190  APIYFPPHHFVTHTSNGATYEFNLVDGAVATVGDPALLSLS-VATRLAQDDPAFSSIKSL 248
Query  239  ESKSRLVLSLGTG-KSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNA-SSDMVDSH 296
            + K  L+LSLGTG  SE+ + Y A+  +KW    W L      A+   +NA SS M D +
Sbjct  249  DYKQMLLLSLGTGTNSEFDKTYTAEEAAKWGPLRWML------AIQQMTNAASSYMTDYY 302
Query  297  LSALFKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLDTG 356
            +S +F++   ++ YLR+Q++ LTG  +    A+E N++ LV++G  LL+K  S+   D+ 
Sbjct  303  ISTVFQARHSQNNYLRVQENALTGTTTEMDDASEANMELLVQVGETLLKKPVSK---DS- 358
Query  357  RLESIPGAPTNEAAIAKFAKLLSEERKLRQLK 388
                 P   T E A+ +FAKLLS+ +KLR  K
Sbjct  359  -----P--ETYEEALKRFAKLLSDRKKLRANK 383

Sequence Alignment: 6. Allergen Name: Sola t 1 Sequence ID: CAA27571

 Score = 168.0 bits 709,  Expect = 7e-43
 Identities = 170/363 46%, Positives = 242/363 66%, Gaps = 31/363 8%
Query  1    MATGSTTL-TQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDG-PDARIADYFDIIA 58
            +AT S+T+ T G+ +TVLSIDGGGI+GIIP  IL  LE +LQ++D   DAR+ADYFD+I 
Sbjct  15   LATTSSTFATLGEMVTVLSIDGGGIKGIIPATILEFLEGQLQEVDNNTDARLADYFDVIG 74
Query  59   GTSTGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDG 118
            GTSTGGL+T M+T PNE  +P   AKDI  FY+E+ PKIF  +S  +       GP YDG
Sbjct  75   GTSTGGLLTAMITTPNETNRPFAAAKDIVPFYFEHGPKIF--QSSGSI-----FGPKYDG 127
Query  119  EYLRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFP-SDDAKCNALKNARLADVCIS 177
            +YL ++    L +  V    T+V I +FDIK   PVIF  S+ AK   L +A++ D+C S
Sbjct  128  KYLMQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPEL-DAKMYDICYS 186
Query  178  TSAAPVLLPAHSFTTE-DDKNIHTFELIDGGVAATN-PTLLALTHIRNEIIRQNPRFIGA 235
            T+AAP ++P H F T   + + + F L+DG VA  + P LL+++ +  ++ + +P+F   
Sbjct  187  TAAAPTFFPPHYFATNTSNGDKYEFNLVDGAVATVDDPALLSIS-VATKLAQVDPKFASI 245
Query  236  NLTESKSRLVLSLGTGK-SEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVD 294
                 K  L+LSLGTG  SE+ + Y A+ T+KW    W L         + S ASS M D
Sbjct  246  KSLNYKQMLLLSLGTGTTSEFDKTYTAEETAKWGTARWMLVIQK-----MTSAASSYMTD 300
Query  295  SHLSALFKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINLD 354
             +LS  F++LD ++ YLR+Q++ LTG  +    A+E N+Q LV++G +LL+K  S+ N  
Sbjct  301  YYLSTAFQALDSQNNYLRVQENALTGTTTELDDASEANMQLLVQVGEDLLKKSVSKDN-- 358
Query  355  TGRLESIPGAPTNEAAIAKFAKLLSEERKLRQLK 388
                   P   T E A+ +FAKLLS+ +KLR  K
Sbjct  359  -------P--ETYEEALKRFAKLLSDRKKLRANK 383

Sequence Alignment: 7. Allergen Name: Sola t 1 Sequence ID: CAA31575

 Score = 167.5 bits 707,  Expect = 9e-43
 Identities = 165/362 45%, Positives = 240/362 66%, Gaps = 33/362 9%
Query  1    MATGSTTLTQGKK-ITVLSIDGGGIRGIIPGIILASLESKLQDLDG-PDARIADYFDIIA 58
            +AT S+T  + ++ +TVLSIDGGGI+GIIP IIL  LE +LQ++D   DAR+ADYFD+I 
Sbjct  15   LATTSSTCAKLEEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIG 74
Query  59   GTSTGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDG 118
            GTSTGGL+T M+T PNE+ +P   AKDI  FY+E+ P IF      NY     +GP+YDG
Sbjct  75   GTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYSG-SILGPMYDG 127
Query  119  EYLRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFP-SDDAKCNALKNARLADVCIS 177
            +YL ++    L +  V    T+V I +FDIK   PVIF  S+ AK   L +A++ D+C S
Sbjct  128  KYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPEL-DAKMYDICYS 186
Query  178  TSAAPVLLPAHSFTTEDDKNI-HTFELIDGGVAAT-NPTLLALTHIRNEIIRQNPRFIGA 235
            T+AAP+ +P H F T       + F L+DG VA   +P LL+L+ +   + +++P F   
Sbjct  187  TAAAPIYFPPHHFVTHTSNGARYEFNLVDGAVATVGDPALLSLS-VATRLAQEDPAFSSI 245
Query  236  NLTESKSRLVLSLGTG-KSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNA-SSDMV 293
               + K  L+LSLGTG  SE+ + Y A+  +KW    W L      A+   +NA SS M 
Sbjct  246  KSLDYKQMLLLSLGTGTNSEFDKTYTAEEAAKWGPLRWML------AIQQMTNAASSYMT 299
Query  294  DSHLSALFKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRINL 353
            D ++S +F++   ++ YLR+Q++ L G  +    A+E N++ LV++G  LL+K  S+   
Sbjct  300  DYYISTVFQARHSQNNYLRVQENALNGTTTEMDDASEANMELLVQVGETLLKKPVSK--- 356
Query  354  DTGRLESIPGAPTNEAAIAKFAKLLSEERKLRQLK 388
            D+      P   T E A+ +FAKLLS+ +KLR  K
Sbjct  357  DS------P--ETYEEALKRFAKLLSDRKKLRANK 383

Sequence Alignment: 8. Allergen Name: Sola t 1 Sequence ID: P15476

 Score = 166.2 bits 701,  Expect = 2e-42
 Identities = 168/361 46%, Positives = 241/361 66%, Gaps = 35/361 9%
Query  1    MATGSTTLTQGKK-ITVLSIDGGGIRGIIPGIILASLESKLQDLDG-PDARIADYFDIIA 58
            +AT S+T  + ++ +TVLSIDGGGI+GIIP IIL  LE +LQ++D   DAR+ADYFD+I 
Sbjct  6    LATTSSTCAKLEEMVTVLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIG 65
Query  59   GTSTGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSI-GPIYD 117
            GTSTGGL+T M+T PNE+ +P   AKDI  FY+E+ P IF      NY    SI GP YD
Sbjct  66   GTSTGGLLTAMITTPNENNRPFAAAKDIVPFYFEHGPHIF------NYS--GSIFGPRYD 117
Query  118  GEYLRELCNNLLKDLTVKDTSTDVIIPTFDIKLLLPVIFP-SDDAKCNALKNARLADVCI 176
            G+YL ++    L +  V    T+V I +FDIK   PVIF  S+ AK   L +A++ D+C 
Sbjct  118  GKYLLQVLQEKLGETRVHQALTEVAISSFDIKTNKPVIFTKSNLAKSPEL-DAKMYDICY 176
Query  177  STSAAPVLLPAHSFTTEDDKNI-HTFELIDGGVAAT-NPTLLALTHIRNEIIRQNPRFIG 234
            S +AAP+ +P H F T       + F L+DGGVA   +P LL+L+ +   + +++P F  
Sbjct  177  SIAAAPIYFPPHHFVTHTSNGATYEFNLVDGGVATVGDPALLSLS-VATRLAQEDPAFSS 235
Query  235  ANLTESKSRLVLSLGTG-KSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNA-SSDM 292
                + K  L+LSLGTG  SE+ + Y A+  +KW    W L      A+  ++NA SS M
Sbjct  236  IKSLDYKQMLLLSLGTGTNSEFDKTYTAEEAAKWGPLRWML------AIQQLTNAASSYM 289
Query  293  VDSHLSALFKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTELLEKQESRIN 352
             D ++S +F++   ++ YLR+Q++ LTG  +    A+E N++ LV++G  LL+K  S+  
Sbjct  290  TDYYISTVFQARHSQNNYLRVQENALTGTTTEMDDASEANMELLVQVGETLLKKPVSK-- 347
Query  353  LDTGRLESIPGAPTNEAAIAKFAKLLSEERKLRQLK 388
             D+      P   T E A+ +FAKLLS  +KLR  K
Sbjct  348  -DS------P--ETYEEALKRFAKLLSNRKKLRANK 374

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.