The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE
DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY
HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA43636 Pha v 1 155 981 247.6 1.1e-67
CAA43637 Pha v 1 156 897 227.0 1.9e-61
P25985 Pha v 1 155 890 225.3 6e-61
Q2VU97 Vig r 1.0101 155 879 222.6 3.9e-60
CAA42646 Gly m 4 158 828 210.0 2.4e-56
AAQ91847 Ara h 8.0101 157 722 184.0 1.6e-48
AAD48405 Cor a 1.0401 161 556 143.2 3.1e-36
AAG40331 Cor a 1.0404 161 553 142.5 5.1e-36
CAA54696.1 Bet v 1.0301 160 550 141.8 8.5e-36
AAG40329 Cor a 1.0402 161 548 141.3 1.2e-35
AAG40330 Cor a 1.0403 161 545 140.5 2e-35
ACJ23864 Fag s 1.0101 160 536 138.3 9.2e-35
EF436550 Ara h 8.0201 153 529 136.7 2.8e-34
APD76154 Jug r 5.0101 160 527 136.1 4.2e-34
O50001 Pru ar 1 160 513 132.7 4.6e-33
B6CQS9 Pru du 1.0101 160 511 132.2 6.4e-33
CAD10374 Cas s 1 160 511 132.2 6.4e-33
O24248 Pru av 1 160 509 131.7 9.1e-33
Q2I6V8 Pru p 1.0101 160 508 131.5 1.1e-32
CAA96549 Cor a 1.0301 160 501 129.7 3.5e-32
Q39427 Bet v 1.0205 160 495 128.3 9.8e-32
Q256S7 Fra a 1 160 494 128.0 1.2e-31
Q3T923 Fra a 1 160 494 128.0 1.2e-31
CAA54481 Bet v 1.0202 160 492 127.5 1.6e-31
ABZ81046 Que a 1.0301 160 492 127.5 1.6e-31
P43186 Bet v 1.0204 160 492 127.5 1.6e-31
AAB01362 Mal d 1.0201 159 491 127.3 1.9e-31
AAD26548 Mal d 1.0204 159 491 127.3 1.9e-31
AAD26545 Mal d 1.0202 159 491 127.3 1.9e-31
P43184 Bet v 1.0203 160 491 127.3 1.9e-31
AAD26555 Mal d 1.0107 159 490 127.1 2.3e-31
CAA54421 Bet v 1.0201 160 490 127.0 2.3e-31
AAD13683 Mal d 1.0206 159 486 126.1 4.5e-31
Q256S2 Fra a 1 160 486 126.1 4.5e-31
AAK13030 Mal d 1.0207 159 485 125.8 5.3e-31
AAD26547 Mal d 1.0203 159 485 125.8 5.3e-31
Q256S6 Fra a 1 160 485 125.8 5.4e-31
AAD26546 Mal d 1.0103 159 484 125.6 6.3e-31
AAD26558 Mal d 1.0205 159 483 125.3 7.5e-31
CAA04828.1 Bet v 1.0206 159 483 125.3 7.5e-31
AAD29671 Mal d 1.0108 159 482 125.1 8.9e-31
ABZ81047 Que a 1.0401 160 481 124.8 1.1e-30
CAA96548 Cor a 1.0201 160 481 124.8 1.1e-30
AAD26552 Mal d 1.0104 159 480 124.6 1.2e-30
O65200 Pyr c 1 159 478 124.1 1.8e-30
CAA58646 Mal d 1.0101 159 477 123.9 2.1e-30
CAA07329.1 Bet v 1.0118 160 477 123.9 2.1e-30
CAD32318 Mal d 1.0208 158 476 123.6 2.4e-30
AAD26553 Mal d 1.0105 159 476 123.6 2.5e-30
AAD26554 Mal d 1.0106 159 476 123.6 2.5e-30
AUH28179 Que m 1.0101 160 476 123.6 2.5e-30
CAA88833 Mal d 1.0102 159 475 123.4 2.9e-30
Q256S4 Fra a 1 159 473 122.9 4.1e-30
CAB02160 Bet v 1.0113 160 472 122.6 4.9e-30
CAA96535 Mal d 1.0401 160 472 122.6 4.9e-30
AAK13029 Mal d 1.0109 159 471 122.4 5.8e-30
ACF75030.1 Bet v 1.0207 150 468 121.7 8.8e-30
CAB02217 Car b 1.0302 161 468 121.6 9.8e-30
AAO25113 Mal d 1.0304 159 465 120.9 1.6e-29
CAA54487 Bet v 1.0106 160 465 120.9 1.6e-29
CAA33887 Bet v 1.0101 160 465 120.9 1.6e-29
CAB02159 Bet v 1.0112 160 465 120.9 1.6e-29
CAA54483 Bet v 1.0103 160 464 120.7 1.9e-29
CAB02161 Bet v 1.0114 160 464 120.7 1.9e-29
NP_001275580 Sola l 4.0201 160 464 120.7 1.9e-29
CAB02156 Bet v 1.0109 160 464 120.7 1.9e-29
CAA54484 Bet v 1.0104 160 462 120.2 2.7e-29
AFN42528 Can s 5.0101 161 462 120.2 2.7e-29
CAB02216 Car b 1.0301 161 461 119.9 3.2e-29
CAA04827.1 Bet v 1.0116 159 459 119.4 4.4e-29
CAA96536 Mal d 1.0402 160 459 119.4 4.5e-29
AAB24432 Aln g 1 160 458 119.2 5.3e-29
ABZ81041 Car b 1.0110 160 456 118.7 7.5e-29
CAB02207 Car b 1.0104 160 456 118.7 7.5e-29
QOL10866 Que ac 1.0101 159 455 118.5 8.8e-29
CAA96537 Mal d 1.0403 160 455 118.5 8.9e-29
ABZ81043 Car b 1.0112 160 455 118.5 8.9e-29
ABZ81044 Car b 1.0113 160 455 118.5 8.9e-29
AAK13027 Mal d 1.0302 159 454 118.2 1e-28
CAA07323.1 Bet v 1.0117 160 454 118.2 1.1e-28
CAB02155 Bet v 1.0108 160 453 118.0 1.2e-28
CAB02213 Car b 1.0107 160 453 118.0 1.2e-28
CAA54482 Bet v 1.0102 160 452 117.7 1.5e-28
CAB02209 Car b 1.0106 160 452 117.7 1.5e-28
ABZ81045 Que a 1.0201 159 451 117.5 1.7e-28
AAK13028 Mal d 1.0303 159 451 117.5 1.7e-28
P38948 Aln g 1 159 451 117.5 1.7e-28
ABZ81040 Car b 1.0109 160 451 117.5 1.8e-28
CAB02206 Car b 1.0103 160 450 117.2 2.1e-28
ABZ81042 Car b 1.0111 160 450 117.2 2.1e-28
CAA54485 Bet v 1.0105 160 449 117.0 2.5e-28
CAA50325 Cor a 1.0103 160 449 117.0 2.5e-28
P38950 Car b 1 159 448 116.7 2.9e-28
CAB02157 Bet v 1.0110 160 448 116.7 2.9e-28
CAA96547 Bet v 1.0115 160 448 116.7 2.9e-28
CAA96534 Mal d 1.0301 159 447 116.5 3.4e-28
CAA54489 Bet v 1.0107 160 447 116.5 3.5e-28
CAB02208 Car b 1.0105 160 447 116.5 3.5e-28
ADK39021 Ost c 1.0101 160 446 116.2 4.1e-28
CAB02158 Bet v 1.0111 160 445 116.0 4.9e-28
CAA50328 Cor a 1.0102 160 443 115.5 6.8e-28
CAB02215 Car b 1.0108 160 443 115.5 6.8e-28
CAA50327 Cor a 1.0101 160 442 115.3 8.1e-28
CAA47357 Car b 1.0102 159 437 114.0 1.9e-27
QGS84240 Que i 1.0101 159 436 113.8 2.2e-27
Q08407 Cor a 1 159 435 113.5 2.6e-27
CAA50326 Cor a 1.0104 160 432 112.8 4.4e-27
ABC41615.1 Bet v 1.0119 150 426 111.4 1.1e-26
P38949 Car b 1 159 425 111.1 1.4e-26
CAM31908 Act c 8.0101 159 418 109.4 4.8e-26
AHC08073 Sola l 4.0101 160 412 107.9 1.3e-25
CAM31909 Act d 8.0101 157 391 102.8 4.6e-24
Q0Z8U9 Rub i 1.0101 137 382 100.6 1.8e-23
CAA75803 Lyc e 4.0101 178 365 96.3 4.6e-22
AAL76932 Dau c 1.0201 154 338 89.8 3.7e-20
P92918 Api g 1.0201 159 334 88.8 7.7e-20
P49372 Api g 1 154 328 87.3 2e-19
AAB92255 Tar o RAP 157 319 85.1 9.7e-19
CAB03715 Dau c 1.0103 154 303 81.2 1.4e-17
CAB06416 Dau c 1.0105 154 299 80.2 2.8e-17
BAA13604 Dau c 1.0102 154 299 80.2 2.8e-17
AAB01092 Dau c 1.0101 168 297 79.6 4.5e-17
CAA67246 Pet c PR10 155 294 79.0 6.7e-17
CAB03716 Dau c 1.0104 154 289 77.7 1.6e-16
Q5ULZ4 Fra a 1.0101 100 223 61.8 6.2e-12
P85126 Que a 1.0101 50 171 49.5 1.6e-08
Q9ZWP8 Vig r 6.0101 155 171 48.8 8.2e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 247.6 bits 981,  Expect = 1e-67
 Identities = 155/155 100%, Positives = 155/155 100%, Gaps = 0/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE 60
            MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  61   DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY 120
            DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY
Sbjct  61   DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 2. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 227.0 bits 897,  Expect = 2e-61
 Identities = 139/155 89%, Positives = 147/155 94%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M VFTFEDQTTSPVAPATLYKA+ KDADTI PKA+ DSFKSVEIVEGNGGPGTIKKISFV
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            EDGETKFVLHKIE IDEANLGYSYSIVGG ALP+TAEKI+ DSKLSDGPNGGS++KLSI 
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YHSKGDAPPNEDELKAGKAKSD+LFK +EAYLLANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 3. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 225.3 bits 890,  Expect = 6e-61
 Identities = 138/153 90%, Positives = 146/153 95%, Gaps = 1/153 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFVED 61
            VFTFEDQTTSPVAPATLYKA+ KDADTI PKA+ DSFKSVEIVEGNGGPGTIKKISFVED
Sbjct  2    VFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVED 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
            GETKFVLHKIE IDEANLGYSYSIVGG ALP+TAEKI+ DSKLSDGPNGGS++KLSI YH
Sbjct  62   GETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            SKGDAPPNEDELKAGKAKSD+LFK +EAYLLANP
Sbjct  122  SKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 4. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 222.6 bits 879,  Expect = 4e-60
 Identities = 132/155 85%, Positives = 144/155 92%, Gaps = 0/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE 60
            MAVFTF+DQ TSPVAPATLY AL KDAD I+PKAV SF+SVEIVEGNGGPGTIKKISFVE
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVGSFQSVEIVEGNGGPGTIKKISFVE 60
Query  61   DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY 120
            DGETKFVLHKIE +DEANLGYSYSIVGG ALPDTAEKI+ID+K+SDG +GGS++KL+I Y
Sbjct  61   DGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTISY 120
Query  121  HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            H KGDAPPNEDELKAGKAKSDALFK +EAYLLANP
Sbjct  121  HGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 5. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 210.0 bits 828,  Expect = 2e-56
 Identities = 125/155 80%, Positives = 139/155 89%, Gaps = 0/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE 60
            M VFTFED+  SPVAPATLYKALV DAD ++PKA+DSFKSVE VEGNGGPGTIKKI+F+E
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLE 60
Query  61   DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY 120
            DGETKFVLHKIE IDEANLGYSYS+VGGAALPDTAEKI+ DSKL  GPNGGS  KL++KY
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
             +KGDA PN+DELK GKAK+DALFK IEAYLLA+P
Sbjct  121  ETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP 155

Sequence Alignment: 6. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 184.0 bits 722,  Expect = 2e-48
 Identities = 106/154 68%, Positives = 129/154 83%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE 60
            M VFTFED+ TS V PA LY A+ KDAD+I PK +D  KSVEIVEGNGGPGTIKK++ VE
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVE 59
Query  61   DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY 120
            DGETKF+LHK+E IDEAN  Y+YS+VGG ALP TAEKI+ ++KL +GPNGGS+ KL++KY
Sbjct  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
Query  121  HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            H+KGDA P+E+ELK GKAK + LF+ IE Y+LANP
Sbjct  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154

Sequence Alignment: 7. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 143.2 bits 556,  Expect = 3e-36
 Identities = 86/155 55%, Positives = 116/155 74%, Gaps = 2/155 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +ED+ TS + PA L+K++V DAD ++PK A   F S E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGG-SVVKLSI 118
            E  E K++ HK+EEID AN+ Y YSI+ G  L  T EKIS + K++  P+GG S++K++ 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            KYH+KG+A  NE+E+KAGK K+  LFK +EAYLLA+P
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 8. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 142.5 bits 553,  Expect = 5e-36
 Identities = 85/155 54%, Positives = 116/155 74%, Gaps = 2/155 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF++ED+ TS + PA L+K++V DAD ++PK A   F S E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGG-SVVKLSI 118
            E  E K++ HK+EEID AN+ Y YSI+ G  L  T EKI  + K++  P+GG S++K++ 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  KYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            KYH+KG+A  NE+E+KAGK K+  LFK +EAYLLA+P
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 9. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 141.8 bits 550,  Expect = 8e-36
 Identities = 82/155 52%, Positives = 113/155 72%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +ED+ TS +APA L+K++V DAD ++PK A ++  S E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K++ H+++EID AN+ Y YSI+ G  L DT EKIS + K+   P GGS++K++ K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD   NE+E+KAGK K   LFK +E YL+A+P
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHP 156

Sequence Alignment: 10. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 141.3 bits 548,  Expect = 1e-35
 Identities = 84/155 54%, Positives = 116/155 74%, Gaps = 2/155 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF++ED+ TS + PA L+K++V DAD ++PK A   F   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGG-SVVKLSI 118
            E  E K++ HK+EEID AN+ Y YSI+ G  L  T EKIS + K++  P+GG S++K++ 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            KYH+KG+A  +E+E+KAGK K+  LFK +EAYLLA+P
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 11. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 140.5 bits 545,  Expect = 2e-35
 Identities = 84/155 54%, Positives = 115/155 74%, Gaps = 2/155 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +ED+ TS + PA L+K++V DAD ++PK A   F   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGG-SVVKLSI 118
            E  E K++ HK+EEID AN+ Y YSI+ G  L  T EKIS + K++  P+GG S++K++ 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            KYH+KG+A  +E+E+KAGK K+  LFK +EAYLLA+P
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 12. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 138.3 bits 536,  Expect = 9e-35
 Identities = 80/155 51%, Positives = 116/155 74%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E +TT+ + PA L+KA+V DAD ++PK A  + KS EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+EID AN+ Y+ +++ G A+ +T EKI+ + KL   P+GGS++K + K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    ED++KAGK ++  +FK +EAYLLANP
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156

Sequence Alignment: 13. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 136.7 bits 529,  Expect = 3e-34
 Identities = 78/153 50%, Positives = 111/153 72%, Gaps = 1/153 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE 60
            M V TFE+++TSPV PA L+KA V D D + PK + + +S+EIVEGNGGPGT+KK++ VE
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPGTVKKVTAVE 60
Query  61   DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY 120
            DG+T +VLHKI+ IDEA   Y Y+I GG  + +  EK+S  +KL +  +GGS +K+S+ +
Sbjct  61   DGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKL-EAADGGSKIKVSVTF 119
Query  121  HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            H+KGDAP  ++  +  K KS  +FK IE Y+L+N
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 14. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 136.1 bits 527,  Expect = 4e-34
 Identities = 81/155 52%, Positives = 111/155 71%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E ++TS + PA L+KA+V DAD ++PK V  + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  + K+V H+ + IDEAN+ Y+YS++ G AL D  EKIS ++K+     GGS++K    
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YHSKGD    E+++K GK K+  LFK +E YLLA+P
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHP 156

Sequence Alignment: 15. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 132.7 bits 513,  Expect = 5e-33
 Identities = 77/155 49%, Positives = 110/155 70%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E + TS + P  L+KA++ DAD ++PK A  + K  EI+EG+GG GTIKK++F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+++ ID+ NL YSY+++ G AL D  E I+ D KL   P+GGS+VK +  
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+++KAGK K+  LFK++EAYLLANP
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANP 156

Sequence Alignment: 16. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 132.2 bits 511,  Expect = 6e-33
 Identities = 82/155 52%, Positives = 111/155 71%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M +FT+ D++TS + P  L+KALV +ADT++PK A  S KS EIVEG+GG GTIKKISF 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V H+I+ +D+ N+ Y+YS+V G AL D  EKIS + KL    +GGSV+K +  
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+++KAGK K+  LFK+IE YL+ANP
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANP 156

Sequence Alignment: 17. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 132.2 bits 511,  Expect = 6e-33
 Identities = 78/154 50%, Positives = 112/154 72%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT E++ TS + P  L+KA+V DAD ++PK A  + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  + K+V H+I+EID+AN+ Y YS++ G  + +  EKIS + K+   P+GGS++K + K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+    E+++ AGK K+  LFK +EAYLLA+
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAH 155

Sequence Alignment: 18. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 131.7 bits 509,  Expect = 9e-33
 Identities = 79/155 50%, Positives = 109/155 70%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E + TS + P  L+KA+V DAD +VPK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ ID+ N  YSY+++ G AL DT EKIS ++KL   P+GGS++K +  
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156

Sequence Alignment: 19. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 131.5 bits 508,  Expect = 1e-32
 Identities = 79/155 50%, Positives = 108/155 69%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E + TS + P  L+KA+V DAD +VPK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ ID+ N  YSY+++ G AL D  EKIS ++KL   P+GGS++K +  
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156

Sequence Alignment: 20. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 129.7 bits 501,  Expect = 4e-32
 Identities = 76/154 49%, Positives = 109/154 70%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS + PA L+K +V D+D ++PK A  + KS+EI+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     ++ +K+EEID+AN+ Y YS++ G AL D  EKI+ + K+   P+GGS++K   K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+ GD    ++++KAGK K+  LFK +E YLLA+
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 21. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 128.3 bits 495,  Expect = 1e-31
 Identities = 76/154 49%, Positives = 110/154 71%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D ++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D AN+ YSYS++ G AL DT EKI  + KL   P+GGS++K+S K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +KA K K++AL++ +E+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAH 155

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 128.0 bits 494,  Expect = 1e-31
 Identities = 76/155 49%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+T+E++ TS +    L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V HKI  ID+ N  YSYS++ G AL D  EKI  ++KL   P+GG+++K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 23. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 128.0 bits 494,  Expect = 1e-31
 Identities = 77/155 49%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+T+E++ TS +    L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V HKI  ID+ N  YSYS++ G AL D  EKI  ++KL   P+GG+V+K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 24. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 127.5 bits 492,  Expect = 2e-31
 Identities = 75/154 48%, Positives = 110/154 71%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ + DT++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D AN+ YSYS++ G AL DT EKI  + K+   P+GGS++K+S K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +KA K K +AL++ +E+YLLA+
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 25. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 127.5 bits 492,  Expect = 2e-31
 Identities = 73/155 47%, Positives = 109/155 70%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E +  S + PA L+KA+V D+D ++PK V  ++KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K   H+I+ ID  N+ YS+S++ G AL D  E +S ++K+   P+GGS+VK + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y++KGD    ++ ++ GK K+  +FK +EAYL+A+P
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHP 156

Sequence Alignment: 26. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 127.5 bits 492,  Expect = 2e-31
 Identities = 75/154 48%, Positives = 109/154 70%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D ++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D AN+ YSYS++ G AL DT EKI  + K+   P+GGS++K+S K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +KA K K +AL++ +E+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 27. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 127.3 bits 491,  Expect = 2e-31
 Identities = 76/154 49%, Positives = 108/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 28. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 127.3 bits 491,  Expect = 2e-31
 Identities = 76/154 49%, Positives = 108/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLM-ASGSGSIIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 29. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 127.3 bits 491,  Expect = 2e-31
 Identities = 76/154 49%, Positives = 108/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 30. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 127.3 bits 491,  Expect = 2e-31
 Identities = 75/154 48%, Positives = 110/154 71%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ + DT++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D AN+ YSYS++ G AL DT EKI  + K+   P+GGS++K+S K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +KA K K +AL++ +E+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 31. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 127.1 bits 490,  Expect = 2e-31
 Identities = 77/154 50%, Positives = 111/154 72%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +KAGKAK+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHP 155

Sequence Alignment: 32. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 127.0 bits 490,  Expect = 2e-31
 Identities = 75/154 48%, Positives = 110/154 71%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ + DT++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D AN+ YSYS++ G AL DT EKI  + K+   P+GGS++K+S K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +KA K K +AL++ +E+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 33. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 126.1 bits 486,  Expect = 4e-31
 Identities = 75/154 48%, Positives = 107/154 69%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+K +V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 126.1 bits 486,  Expect = 5e-31
 Identities = 75/155 48%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+T+E++ TS +    L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V HKI  ID+ N  YSYS++ G AL +  EKI  ++KL   P+GG+++K + K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHP 156

Sequence Alignment: 35. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 125.8 bits 485,  Expect = 5e-31
 Identities = 75/154 48%, Positives = 107/154 69%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGT KKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 36. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 125.8 bits 485,  Expect = 5e-31
 Identities = 75/154 48%, Positives = 108/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE++L  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHP 155

Sequence Alignment: 37. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 125.8 bits 485,  Expect = 5e-31
 Identities = 75/155 48%, Positives = 105/155 67%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M  +T+E++ TS +    L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V HKI  ID+ N  YSYS++ G AL D  EKI  ++KL   P+GG+++K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 38. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 125.6 bits 484,  Expect = 6e-31
 Identities = 76/154 49%, Positives = 110/154 71%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 39. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 125.3 bits 483,  Expect = 7e-31
 Identities = 75/154 48%, Positives = 107/154 69%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ + AGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 40. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 125.3 bits 483,  Expect = 7e-31
 Identities = 74/152 48%, Positives = 107/152 70%, Gaps = 1/152 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
            VF +E +TTS +  A L+KA++ D D ++PK A  +  SVE +EGNGGPGTIKKI+F E 
Sbjct  2    VFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
               K+V  +++E+D AN+ YSYS++ G AL DT EKI  + KL   P+GGS++K+S KYH
Sbjct  62   SPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKYH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +KGD     + +KA K K + L++ +E+YLLA+
Sbjct  122  TKGDHEMKAEHMKAIKEKGETLLRAVESYLLAH 154

Sequence Alignment: 41. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 125.1 bits 482,  Expect = 9e-31
 Identities = 76/154 49%, Positives = 110/154 71%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 42. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 124.8 bits 481,  Expect = 1e-30
 Identities = 73/155 47%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT E Q TS +APA L+KAL  D+D ++ K +  + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K   H+I+ ID  N+ YS+S++ G AL D  E +S ++K+   P+GGS+ K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y++KGD    ++ ++ GK K+  +FK +EAYL+A+P
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHP 156

Sequence Alignment: 43. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 124.8 bits 481,  Expect = 1e-30
 Identities = 71/154 46%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E ++TS +  A L+KA++ D + ++PK A  +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  ++EE+D  N+ YSY+++ G  + D  EKI  + K+   P+GGS++K+S K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD   + + +K GK K + LF+ +EAYLLA+
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAH 155

Sequence Alignment: 44. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 124.6 bits 480,  Expect = 1e-30
 Identities = 76/154 49%, Positives = 109/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 45. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 124.1 bits 478,  Expect = 2e-30
 Identities = 74/154 48%, Positives = 109/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M ++TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+++ IDEA+  Y+Y+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 46. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 123.9 bits 477,  Expect = 2e-30
 Identities = 75/154 48%, Positives = 109/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +K GK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 47. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 123.9 bits 477,  Expect = 2e-30
 Identities = 73/154 47%, Positives = 108/154 70%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D ++PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + KL   P+GGS++++S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +KA K K +AL++ +E+YLLA+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 48. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 123.6 bits 476,  Expect = 2e-30
 Identities = 74/152 48%, Positives = 107/152 70%, Gaps = 2/152 1%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
            V+T+E++ TS + P  L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F E 
Sbjct  2    VYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
             +  +V HKI+ +DEAN  Y+Y+++ G AL DT EK+S ++KL      GS++K    YH
Sbjct  62   SQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHYH 120
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            +KGD    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHP 154

Sequence Alignment: 49. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 123.6 bits 476,  Expect = 2e-30
 Identities = 76/154 49%, Positives = 109/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 50. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 123.6 bits 476,  Expect = 2e-30
 Identities = 75/154 48%, Positives = 109/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT E IS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 51. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 123.6 bits 476,  Expect = 2e-30
 Identities = 70/155 45%, Positives = 107/155 69%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M V  +E +  S + PA L+KA+V D+D ++PK V  ++KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K   H+I+ ID  N+ +S+S++ G AL D  E +S ++K+   P+GGS+VK + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y++KGD    ++ ++ GK K+  +FK +EAYL+A+P
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHP 156

Sequence Alignment: 52. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 123.4 bits 475,  Expect = 3e-30
 Identities = 75/154 48%, Positives = 107/154 69%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH KG+    E+ +K GK K   LFK+IE+YL  +P
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHP 155

Sequence Alignment: 53. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 122.9 bits 473,  Expect = 4e-30
 Identities = 75/154 48%, Positives = 105/154 68%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V+T+E++ TS +    L+KA+V DAD ++PK A  + K  EI+EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V HKI  ID+ N  YSYS++ G AL D  EKI  ++KL   P+G +++K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155

Sequence Alignment: 54. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 122.6 bits 472,  Expect = 5e-30
 Identities = 72/154 46%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D +VPK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GGS++K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 55. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 122.6 bits 472,  Expect = 5e-30
 Identities = 71/154 46%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +    L+KA++ D D ++PK A  + KS EI+EG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V +++  ID+ N+ YSYS++ G  L D  EKI+ ++KL   P+GGS++K +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD    E+ +KAGK K+  LFK++EAYLLA+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 56. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 122.4 bits 471,  Expect = 6e-30
 Identities = 75/154 48%, Positives = 108/154 70%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M V TFE++ TS + P+ L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KG+    E+ +K GK K+  LFK+IE+YL  +P
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 57. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 121.7 bits 468,  Expect = 9e-30
 Identities = 71/149 47%, Positives = 105/149 70%, Gaps = 1/149 0%
Query  4    FTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVEDG 62
            F +E +TTS +  A L+KA++ + D ++PK A  +  SVE +EGNGGPGTIKKI+F E  
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  63   ETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHS 122
              K+V  +++E+D AN+ YSYS++ G AL DT EKI  + K+   P+GGS++K+S KYH+
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDAPPNEDELKAGKAKSDALFKVIEAYLL 152
            KGD     + +KA K K +AL++ +E+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 58. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 121.6 bits 468,  Expect = 1e-29
 Identities = 70/154 45%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D + ++PK A  +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  ++EE+D  N+ YSY+++ G  + D  EKI  + K+   P+GGS++K++ K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +K GK + + L+K +EAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 59. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 120.9 bits 465,  Expect = 2e-29
 Identities = 75/154 48%, Positives = 106/154 68%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E + TS + PA L+ A+V DAD ++PK A  + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ +T EKIS ++KL      GSV+K +  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YLL +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHP 155

Sequence Alignment: 60. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 120.9 bits 465,  Expect = 2e-29
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E + TS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YSYS++ G  + DT EKIS + K+   PNGGS++K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 61. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 120.9 bits 465,  Expect = 2e-29
 Identities = 71/154 46%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GGS++K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 62. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 120.9 bits 465,  Expect = 2e-29
 Identities = 71/154 46%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GGS++K+S K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 63. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 120.7 bits 464,  Expect = 2e-29
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E + TS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YSYS++ G  + DT EKIS + K+   PNGGS++K++ K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 64. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 120.7 bits 464,  Expect = 2e-29
 Identities = 71/154 46%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GGS++K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAH 155

Sequence Alignment: 65. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 120.7 bits 464,  Expect = 2e-29
 Identities = 75/155 48%, Positives = 103/155 66%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
            M V TF  ++T+ +AP  L+K LV D D++VPK +    KS+EIVEG+GG G+IK+++FV
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E G  K++ HKI  ID+ NL   YS++ G  L D  E I+ D K+    +GG V K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD   +E+E   GK K+  LFK IEAYLLANP
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156

Sequence Alignment: 66. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 120.7 bits 464,  Expect = 2e-29
 Identities = 71/154 46%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GGS++K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 67. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 120.2 bits 462,  Expect = 3e-29
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E + TS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YSYS++ G  + DT EKIS + K+   PNGGS++K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 68. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 120.2 bits 462,  Expect = 3e-29
 Identities = 78/155 50%, Positives = 110/155 70%, Gaps = 2/155 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E + TS +APA L+KA+V D D +VPK A  + + VEI+EGNGG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALP-DTAEKISIDSKLSDGPNGGSVVKLSI 118
            +    K+V HKIE ID+ +L YSYSI+ G AL  +  EKI+ +SKL    +GG+V+K   
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  KYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            KY+S GDA  NE+++K G+ ++  ++K +EAYL  +P
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHP 157

Sequence Alignment: 69. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 119.9 bits 461,  Expect = 3e-29
 Identities = 69/154 44%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D + ++PK    +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  ++EE+D  N+ YSY+++ G  + D  EKI  + K+   P+GGS++K++ K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     + +K GK + + L+K +EAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 70. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 119.4 bits 459,  Expect = 4e-29
 Identities = 71/152 46%, Positives = 105/152 69%, Gaps = 1/152 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
            VF +E + TS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF E 
Sbjct  2    VFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
               K+V  +++E+D AN+ YSYS++ G  + DT EKIS + K+   P+GGS++K+S KYH
Sbjct  62   IPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKYH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +KGD     +++KA K   + L++ +E+YLLA+
Sbjct  122  TKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 154

Sequence Alignment: 71. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 119.4 bits 459,  Expect = 4e-29
 Identities = 69/154 44%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E + TS +    L+KA++ D D ++PK A  + KS +I+EG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V +++  ID+ N+ YSYS++ G  L D  EKI+ ++KL   P+GGS++K +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD    E+ +KAGK K+  LFK++EAYLLA+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 72. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 119.2 bits 458,  Expect = 5e-29
 Identities = 68/154 44%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+KA++ D D ++PK A ++  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YS+S++ G A+ D  EK+  + K+   P+GGS++K+S K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +++K  K K+  L+K +E+YLLA+
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 155

Sequence Alignment: 73. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 118.7 bits 456,  Expect = 7e-29
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGSVVK+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 74. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 118.7 bits 456,  Expect = 7e-29
 Identities = 69/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 75. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 118.5 bits 455,  Expect = 9e-29
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
            M V+ +E Q TS + PA L+KA+V D+D ++ K +  + KS EI+EGNGGPGTIKK +F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  + K+  H+I+ +D  N  YS+S++ G AL D A  IS + K+   P+GGS++K + K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y++KG     E++++A   K   LFK +EAYLLA+P
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHP 155

Sequence Alignment: 76. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 118.5 bits 455,  Expect = 9e-29
 Identities = 69/154 44%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E + TS +    L+KA++ D D ++PK A  + KS EI+EG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  +  +V +++  ID+ N+ YSYS++ G  L D  EKI+ ++KL   P+GGS++K +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            Y +KGD    E+ +KAGK K+  LFK++EAYLLA+
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 77. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 118.5 bits 455,  Expect = 9e-29
 Identities = 69/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 78. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 118.5 bits 455,  Expect = 9e-29
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ YSY+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 79. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 118.2 bits 454,  Expect = 1e-28
 Identities = 74/151 49%, Positives = 104/151 68%, Gaps = 2/151 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E + TS + PA L+ A+V DAD ++PK A  + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ +T EKIS ++KL      GSV+K +  
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLL 152
            YH+KGD    E+ +KAGK K+  LFK+IE YLL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 80. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 118.2 bits 454,  Expect = 1e-28
 Identities = 70/154 45%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG V+K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 81. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 118.0 bits 453,  Expect = 1e-28
 Identities = 70/154 45%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG V+K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 82. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 118.0 bits 453,  Expect = 1e-28
 Identities = 68/154 44%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ +SY+++ G  L D  EK+S++ K+   P GGS++K+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 83. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 117.7 bits 452,  Expect = 1e-28
 Identities = 70/154 45%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D +VPK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG V+K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 84. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 117.7 bits 452,  Expect = 1e-28
 Identities = 69/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 85. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 117.5 bits 451,  Expect = 2e-28
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT E Q TS +APA L+KAL  D+D ++ K +  + KS EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  + K+  H+I+ +D  N  YS+S++ G AL    E +S + K    P+GGS++K + K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y++KGD    E++++A   K+  L+K +EAYL+A+P
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHP 155

Sequence Alignment: 86. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 117.5 bits 451,  Expect = 2e-28
 Identities = 76/151 50%, Positives = 103/151 68%, Gaps = 2/151 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VFT+E + TS + PA LY A+V DAD ++PK A  + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V HKI+ +D+ N+ Y YS++ G A+ +T EKIS ++KL      GSV+K    
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSISH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLL 152
            YH+KGD    E+ +KAGK K+  LFK+IE YLL
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 87. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 117.5 bits 451,  Expect = 2e-28
 Identities = 67/152 44%, Positives = 106/152 69%, Gaps = 1/152 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
            VF +E +T S +  A L+KA++ D D ++PK A ++  SVE +EGNGGPGTIKKI+F E 
Sbjct  2    VFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
               K+V  +++E+D  N+ YS+S++ G A+ D  EK+  + K+   P+GGS++K+S K+H
Sbjct  62   SPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +KGD   N +++K  K K+  L+K +E+YLLA+
Sbjct  122  TKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 154

Sequence Alignment: 88. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 117.5 bits 451,  Expect = 2e-28
 Identities = 68/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS++K+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 89. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 117.2 bits 450,  Expect = 2e-28
 Identities = 68/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +++K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 117.2 bits 450,  Expect = 2e-28
 Identities = 68/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +++K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 91. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 117.0 bits 449,  Expect = 2e-28
 Identities = 68/154 44%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ + D ++PK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG V+K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 92. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 117.0 bits 449,  Expect = 2e-28
 Identities = 68/154 44%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+K+ V D D ++PK A  +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS++K+S K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 93. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 116.7 bits 448,  Expect = 3e-28
 Identities = 68/152 44%, Positives = 103/152 67%, Gaps = 1/152 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFVED 61
            VF +E +TTS +  A L+KA++ D + ++PK    +  SVE VEGNGGPGTIKKI+F E 
Sbjct  2    VFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
               K+V  ++EEID  N+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K+H
Sbjct  62   SPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +KG    N +E+K  K  ++ L++ +E+YLLA+
Sbjct  122  AKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 94. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 116.7 bits 448,  Expect = 3e-28
 Identities = 69/154 44%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + D  EKIS + K+   P+GG V+K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 95. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 116.7 bits 448,  Expect = 3e-28
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+   N+ YSYS++ G  + DT EKIS + K+   P+G S++K+S K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 96. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 116.5 bits 447,  Expect = 3e-28
 Identities = 73/153 47%, Positives = 104/153 67%, Gaps = 2/153 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E + TS + PA L+ A+V DAD ++PK A  + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ +T EKIS ++KL      GSV+K +  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+K D    E+ +KAGK K+  LFK+IE YLLA+
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154

Sequence Alignment: 97. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 116.5 bits 447,  Expect = 3e-28
 Identities = 68/154 44%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E + TS +  A ++KA++ D D +VPK A  +  SVE +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG V+K+S K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 98. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 116.5 bits 447,  Expect = 3e-28
 Identities = 68/154 44%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +++K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 99. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 116.2 bits 446,  Expect = 4e-28
 Identities = 67/154 43%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +   VE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS++K+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 100. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 116.0 bits 445,  Expect = 5e-28
 Identities = 69/154 44%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
                 K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG V+K+S K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            YH+KG+     +++KA K   + L++ +E+YLLA+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 101. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 115.5 bits 443,  Expect = 7e-28
 Identities = 67/154 43%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS++K+S K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 102. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 115.5 bits 443,  Expect = 7e-28
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    KFV  +++E+D AN+ +SY+++ G  L D  EK+S++  +   P GGS++K+S K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 103. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 115.3 bits 442,  Expect = 8e-28
 Identities = 67/154 43%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS++K+S K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 104. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 114.0 bits 437,  Expect = 2e-27
 Identities = 67/152 44%, Positives = 101/152 66%, Gaps = 1/152 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
            VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F E 
Sbjct  2    VFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
               KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K+H
Sbjct  62   SPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +KG    N +E+K  K  ++ L++ +E+YLLA+
Sbjct  122  AKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 105. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 113.8 bits 436,  Expect = 2e-27
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            M V T E Q TS + PA L+KA+V D+D ++PK +  + KS+E +EGNGGPGTIKKI+F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  + K+  H+I+ +D  N  YS+S++ G AL D    +S + K+   P+GGS+ K + K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y++KGD    E++++A   K   L K +EAYLLA+P
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHP 155

Sequence Alignment: 106. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 113.5 bits 435,  Expect = 3e-27
 Identities = 66/152 43%, Positives = 100/152 65%, Gaps = 1/152 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
            VF +E +T S +  A L+K+ V D D ++PK A  +  SVE VEGNGGPGTIK I+F E 
Sbjct  2    VFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
               K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS++K+S K+H
Sbjct  62   SRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  122  AKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 107. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 112.8 bits 432,  Expect = 4e-27
 Identities = 66/154 42%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
            M VF +E +T S ++ A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS +K+S K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 108. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 111.4 bits 426,  Expect = 1e-26
 Identities = 64/149 42%, Positives = 101/149 67%, Gaps = 1/149 0%
Query  4    FTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVEDG 62
            F +E +TTS +  A L+KA++ D D + PK A  +  SV+ +EGNGGPGTIKKI+F E  
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  63   ETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHS 122
              K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + K+   P+GG ++K+S KYH+
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDAPPNEDELKAGKAKSDALFKVIEAYLL 152
            KG+     +++KA K   + L++ +E+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 109. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 111.1 bits 425,  Expect = 1e-26
 Identities = 66/152 43%, Positives = 100/152 65%, Gaps = 1/152 0%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVED 61
            VF +E +T S +  A L+K+ V D D ++PK A     SVE V GNGGPGTIK I+F E 
Sbjct  2    VFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEG 61
Query  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
               KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS+VK+S K+H
Sbjct  62   IPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFH 121
Query  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +KG    N +++K  K  ++ L++ +E+YLLA+
Sbjct  122  AKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 110. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 109.4 bits 418,  Expect = 5e-26
 Identities = 69/155 44%, Positives = 101/155 65%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
            M V T++ +  S V P  LYKA++ D DT+VPK +  + K V+I+EG+G  GTIK+++F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K V ++++ ID+ NL YSY+I+ G  L +  E IS   K+   P+GGS+ K    
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y +KGD   +E+E+K GK K+  +FK +EAYLLANP
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 111. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 107.9 bits 412,  Expect = 1e-25
 Identities = 66/155 42%, Positives = 99/155 63%, Gaps = 1/155 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSF-KSVEIVEGNGGPGTIKKISFV 59
            M V T+  ++T+ ++P  L+KALV D D +VPK +    K+ E +EG+GG G+IK+++FV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E G  K++ HKI  ID+ NL   YS++ G  L +  E I+ D K+    NGG V K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            YH+KGD   +E+E   G+ +   + K +EAYLLANP
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156

Sequence Alignment: 112. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 102.8 bits 391,  Expect = 5e-24
 Identities = 67/154 43%, Positives = 98/154 63%, Gaps = 2/154 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
            M   T++ +  S ++   ++KA+V D DTI+PKA+  +   V+ +EG+GG GTIK  +F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E    K V H+I+ +D+ N+ YSYSI+ G AL D  E IS   K+   P+GG + K    
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            Y  K DA  +E+E+KAGK ++  +FK +EAYLLANP
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 100.6 bits 382,  Expect = 2e-23
 Identities = 65/135 48%, Positives = 90/135 66%, Gaps = 2/135 1%
Query  11   TSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFVEDGETKFVLH 69
            TS + P  L+KA+V DAD ++PK A  + KSVEI+EG+GG GT+KKI + E  E  +V H
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  70   KIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAPPN 129
            KI+ +D+ N+ YSYSI  G AL D  EKIS + KL      GS++K +  YH KG A   
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLV-ASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EDELKAGKAKSDALFKV 146
            E+++K GK ++  LFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 96.3 bits 365,  Expect = 5e-22
 Identities = 58/145 40%, Positives = 91/145 62%, Gaps = 1/145 0%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSF-KSVEIVEGNGGPGTIKKISFV 59
            M V T+  ++T+ ++P  L+KALV D D +VPK +    K+ E +EG+GG G+IK+++FV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E G  K++ HKI  ID+ NL   YS++ G  L +  E I+ D K+    NGG V K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHSKGDAPPNEDELKAGKAKSDALFK 145
            YH+KGD   +E+E   G+ ++   F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 115. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 89.8 bits 338,  Expect = 4e-20
 Identities = 59/153 38%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSF-KSVEIVEGNGGPGTIKKISFV 59
            M V   E +  S V+   +Y+ ++ D DT+ PK +  + KSVEI+EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            E  E   + +K++ ID+A LGY+Y+ +GG  L +  E + ++  +    +GG +VK +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESV-VNQFVVVPTDGGCIVKNTTI 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            Y++KGDA   ED++K    KS   FK +EAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 88.8 bits 334,  Expect = 8e-20
 Identities = 57/145 39%, Positives = 91/145 62%, Gaps = 2/145 1%
Query  9    QTTSPVAPATLYKALVKDADTIVPKAVDSF-KSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            +  S V+   +Y+ ++ D DT+ PK +  + KSVEI+EG+GG GT+K + + E  E   +
Sbjct  9    EAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTM 68
Query  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAP 127
             +K++ ID+A L Y+Y+ +GG  L D  E + ++  +    +GG +VK +  Y++KGDA 
Sbjct  69   KQKVDVIDKAGLAYTYTTIGGDILVDVLESV-VNEFVVVPTDGGCIVKNTTIYNTKGDAV 127
Query  128  PNEDELKAGKAKSDALFKVIEAYLLAN 154
              ED++K    KS   FK +EAYLLAN
Sbjct  128  LPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 87.3 bits 328,  Expect = 2e-19
 Identities = 57/153 37%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
            M V T   + TS V+   +++ +V D DT++PKA   ++KSVEI +G+GGPGT+K I++ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            + G    +  +I+ +++  L + YS++ G  L    E I     L    +GGS+ K +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
            +H+KGDA   E+ +K    ++ ALFK +EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 85.1 bits 319,  Expect = 1e-18
 Identities = 58/153 37%, Positives = 90/153 58%, Gaps = 3/153 1%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
            MAV  FE   TS ++P+ ++KA+V D DTI PKA  +++KS++ +EG+GG GTIK I++ 
Sbjct  1    MAVAEFE--ITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
            +        HK++ ID  N+  SY+I  G  L    E  +   K+    +GGSV K S+ 
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155
            +  KGDA   ++ +   K      FK IE Y++++P
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 119. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 81.2 bits 303,  Expect = 1e-17
 Identities = 51/145 35%, Positives = 86/145 59%, Gaps = 2/145 1%
Query  9    QTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +V D DT++PKA   ++KSVE V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITTM 67
Query  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAP 127
              + + +++  L Y  +++ G  L    E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   TVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
Query  128  PNEDELKAGKAKSDALFKVIEAYLLAN 154
              E+ +K   A++ ALFK IEAYL+AN
Sbjct  128  VPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 80.2 bits 299,  Expect = 3e-17
 Identities = 54/143 37%, Positives = 90/143 62%, Gaps = 6/143 4%
Query  9    QTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +V D DT++PKA   ++KSVE V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLPEGSPITSM 67
Query  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGP--NGGSVVKLSIKYHSKGD 125
              + + +++  L Y  +++ G  L    E  SI++ L   P  +GGS+ K +  +H+KGD
Sbjct  68   TVRTDAVNKEALTYDSTVIDGDILLGFIE--SIETHLVVVPTADGGSITKTTAIFHTKGD 125
Query  126  APPNEDELKAGKAKSDALFKVIEAYLLAN 154
            A   E+ +K   A++ ALFK IEAYL+AN
Sbjct  126  AVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 80.2 bits 299,  Expect = 3e-17
 Identities = 50/145 34%, Positives = 87/145 60%, Gaps = 2/145 1%
Query  9    QTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +V D DT++PKA   ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
Query  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAP 127
              + + +++  L Y  +++ G  L +  E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
Query  128  PNEDELKAGKAKSDALFKVIEAYLLAN 154
              E+ +K   A++ ALFK IEAYL+AN
Sbjct  128  VPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 79.6 bits 297,  Expect = 5e-17
 Identities = 50/145 34%, Positives = 87/145 60%, Gaps = 2/145 1%
Query  9    QTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +V D DT++PKA   ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  23   EITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 81
Query  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAP 127
              + + +++  L Y  +++ G  L +  E I     +    +GGS+ K +  +H+KGDA 
Sbjct  82   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 141
Query  128  PNEDELKAGKAKSDALFKVIEAYLLAN 154
              E+ +K   A++ ALFK IEAYL+AN
Sbjct  142  VPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 123. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 79.0 bits 294,  Expect = 7e-17
 Identities = 58/152 38%, Positives = 93/152 61%, Gaps = 5/152 3%
Query  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
            M V   E   TS V  A L+KAL  D DT++P+ +  + K  EI+EG+GG GT+K +++ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGP--NGGSVVKLS 117
            +    K + +KI+ ID+  + +SYSI+ G  L    +  SI++ LS  P  +GG     +
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYID--SINNHLSFVPTADGGCTATST 118
Query  118  IKYHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154
              +++KGDA   E+ +K    +++ +FK +EAYLLAN
Sbjct  119  AVFNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 124. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 77.7 bits 289,  Expect = 2e-16
 Identities = 52/143 36%, Positives = 89/143 62%, Gaps = 6/143 4%
Query  9    QTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +V D DT++PKA   ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
Query  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGP--NGGSVVKLSIKYHSKGD 125
              + + +++  L Y  +++ G  L    E  SI++ L   P  +GGS+ K +  +H+KGD
Sbjct  68   TVRTDAVNKEALTYDSTVIDGDILLGFIE--SIETHLVVVPTADGGSITKTTAIFHTKGD 125
Query  126  APPNEDELKAGKAKSDALFKVIEAYLLAN 154
            A   E+ +K    ++ ALFK IEAYL+AN
Sbjct  126  AVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 61.8 bits 223,  Expect = 6e-12
 Identities = 35/75 46%, Positives = 48/75 64%, Gaps = 0/75 0%
Query  81   YSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAPPNEDELKAGKAKS 140
            Y Y  V G AL DT EKI  ++KL   P+  +++K + KYH+KGD    E+ +KAGK K+
Sbjct  22   YGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  DALFKVIEAYLLANP 155
              LFK+IE YL  +P
Sbjct  82   AHLFKLIEGYLKDHP 96

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 49.5 bits 171,  Expect = 2e-08
 Identities = 27/48 56%, Positives = 35/48 72%, Gaps = 1/48 2%
Query  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGP 50
            VFT E Q TS +APA L+KAL  D+D ++ K +  + KS EI+EGNGGP
Sbjct  2    VFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 48.8 bits 171,  Expect = 8e-08
 Identities = 41/143 28%, Positives = 67/143 46%, Gaps = 6/143 4%
Query  6    FEDQTTSPVAPATLYKALVKDADTIVPKAVDSF-KSVEIVEGNGGPGTIKKISFVEDGET 64
            F  QT   V    L+  L KD  T+VPK +    K V+++EG+GG GTI   +F+ +   
Sbjct  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
Query  65   KFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKG 124
             +   +I E DE++      ++ G  L           KLS+     ++V + I Y    
Sbjct  65   SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS 124
Query  125  DAPPNEDELKAGKAKSDAL--FKVIEAYL 151
            D    E+++   K     L  ++ +E YL
Sbjct  125  DI---EEKVTPTKTSQSTLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.