The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCVRRSKAGFRDSSIALNAGSCGYGSLA
ASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLS
AAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQ
GGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVVVTGGYDGKWVWADGE
VLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAG13596 Ory s 1 275 1874 386.5 5.5e-109
CAB37496 Ara t expansin 265 981 206.9 6.1e-55
AAF72986 Ory s 1 275 407 91.5 3.6e-20
AAF72983 Ory s 1 267 399 89.9 1.1e-19
AAF72984 Ory s 1 268 390 88.0 3.7e-19
P58738 Zea m 1 269 390 88.0 3.8e-19
AAF72991 Ory s 1 267 389 87.8 4.3e-19
CAA10520 Poa p a 263 385 87.0 7.4e-19
CAA81613 Phl p 1.0101 263 382 86.4 1.1e-18
CAA10140 Hol l 1 263 381 86.2 1.3e-18
CAB63699 Lol p 1.0103 263 380 86.0 1.5e-18
ACA23876 Pas n 1.0101 265 379 85.8 1.7e-18
CAA93121 Hol l 1.0102 248 374 84.8 3.2e-18
P43216 Hol l 1 265 373 84.6 4e-18
AAA63279 Lol p 1.0101 263 372 84.4 4.5e-18
A0A4D6G2J8 Uro m 1.0201 229 371 84.2 4.6e-18
P14946 Lol p 1 263 370 84.0 6e-18
AAF72989 Ory s 1 271 369 83.8 7.1e-18
P43213 Phl p 1 263 366 83.2 1e-17
AAA63278 Lol p 1.0102 252 364 82.8 1.3e-17
AAF72990 Ory s 1 269 362 82.4 1.9e-17
AAB61710 Ory s 1 261 360 82.0 2.4e-17
Q07154 Zea m 1 191 356 81.2 3.1e-17
Q41260 Pha a 1 269 353 80.6 6.5e-17
AAF72987 Ory s 1 275 351 80.2 8.8e-17
AAA50175 Gly m 2 277 350 80.0 1e-16
A0A4D6FZ45 Uro m 1.0101 262 345 79.0 1.9e-16
AAL14079 Cyn d 1.0203 262 345 79.0 1.9e-16
AAL14077 Cyn d 1.0202 262 345 79.0 1.9e-16
AAL14078 Cyn d 1 262 345 79.0 1.9e-16
AAF80379 Cyn d 1.0204 244 344 78.8 2.1e-16
QCX36431 Zoy m 1.0101 272 344 78.8 2.3e-16
AAK96255 Cyn d 1.0201 244 343 78.6 2.4e-16
O04701 Cyn d 1 246 340 78.0 3.7e-16
Q40638 Ory s 1 263 339 77.8 4.5e-16
AAF72985 Ory s 1 286 338 77.6 5.6e-16
ABC58726 Sor h 1.0101 239 320 74.0 5.8e-15
AAF72988 Ory s 1 327 311 72.2 2.7e-14
AAD10496 Tri a ps93 271 308 71.6 3.5e-14
BAA85432 Ory s 1 284 186 47.0 8.9e-07
AAP80171 Cyn d 15 112 142 38.1 0.00017
CAA10346 Cyn d 2 122 125 34.7 0.002
CAA10348 Poa p 2 122 125 34.7 0.002
CAA10345 Dac g 2 122 125 34.7 0.002
P43214 Phl p 2 122 125 34.7 0.002
P14948 Lol p 3 97 120 33.7 0.0032
2JNZ_A Phl p 3.0101 108 115 32.7 0.0071
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 386.5 bits 1874,  Expect = 5e-109
 Identities = 275/275 100%, Positives = 275/275 100%, Gaps = 0/275 0%
Query  1    MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCVRRSKAGFRDSSIALNAGSCGYGSLA 60
            MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCVRRSKAGFRDSSIALNAGSCGYGSLA
Sbjct  1    MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCVRRSKAGFRDSSIALNAGSCGYGSLA 60
Query  61   ASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLS 120
            ASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLS
Sbjct  61   ASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLS 120
Query  121  AAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQ 180
            AAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQ
Sbjct  121  AAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQ 180
Query  181  GGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVVVTGGYDGKWVWADGE 240
            GGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVVVTGGYDGKWVWADGE
Sbjct  181  GGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVVVTGGYDGKWVWADGE 240
Query  241  VLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK 275
            VLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK
Sbjct  241  VLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK 275

Sequence Alignment: 2. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 206.9 bits 981,  Expect = 6e-55
 Identities = 140/256 54%, Positives = 189/256 73%, Gaps = 6/256 2%
Query  16   LFFV-VVGMSASMVSGCDRCVRRSKAGFRDSSIALNAGSCGYGSLAASFNGGHLAAASPA 74
            LF++ VV + +S  + CDRC+  SKA +  S+ AL++G+C YGS+A  F  GH+AAA P+
Sbjct  6    LFLLSVVLLFSSSAAACDRCLHSSKAAYFSSASALSSGACAYGSMATGFFAGHIAAALPS 65
Query  75   LFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLSAAAYAAMARP--GM 132
            +++ G GCGACFQVRCK+  LCS+ G  V+VTD  + TN+TDLVLS+ A+ AMA+P  G 
Sbjct  66   IYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLNK-TNQTDLVLSSRAFRAMAKPVVGA 124
Query  133  AAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQGGQTDIVAVDVA 192
               L  +  VD+EY+RVPC+Y   + +++RVEE S+ P  L+I++LYQGGQT++VA+ +A
Sbjct  125  DRDLLKQGIVDIEYRRVPCDYG-NKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIA 183
Query  193  TVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
             VGSS+W +MTR +G  W T + P G LQFR VVT GYDGK VW+   VLP  W AG+ Y
Sbjct  184  QVGSSHWSYMTRSHGAVWVTDKVPNGALQFRFVVTAGYDGKMVWSQ-RVLPANWEAGKSY 242
Query  253  DAGVQIADVAQEGCYPCDTQEW 274
            DAGVQI D+AQEGC PCD + W
Sbjct  243  DAGVQITDIAQEGCDPCDDHIW 264

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 91.5 bits 407,  Expect = 4e-20
 Identities = 73/202 36%, Positives = 108/202 53%, Gaps = 15/202 7%
Query  52   GSCGYGSLAAS--FNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            G+CGY S      F+   +AA  P+LF+ G GCG+C+Q++C   + CS     VV+TD  
Sbjct  64   GACGYQSAVGQRPFSS-MIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITDSC 122
Query  110  RS----TNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEE 165
                       + +S  A+ AMA  GM  +LR+   + ++YKRVPC +A   N++ +V+ 
Sbjct  123  PGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAM--NVAFKVDA 180
Query  166  KSRPPRELSIRFLYQGGQTDIVAVDVATV-GSSNWKFMTRDYGPAWSTAQAPAGPLQ--F 222
             S P   L+I   Y  G  D+ AV +    G   WK M + +G  W        PL   F
Sbjct  181  GSNP-YYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPF 239
Query  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIA 259
             + +T G  GK + A+  V+P  W AG  Y + V  A
Sbjct  240  SIRLTSG-SGKVLVANN-VIPSGWQAGLTYRSTVNYA 274

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 89.9 bits 399,  Expect = 1e-19
 Identities = 71/200 35%, Positives = 107/200 53%, Gaps = 14/200 7%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD- 107
            N G+CGY  +  A F G +     P +F+ G GCG+CF+++C   + CS   A + VTD 
Sbjct  60   NGGACGYKDVDKAPFLGMNSCGNDP-IFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
Query  108  --EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEE 165
              E  +    DL  S  A+ AMA+ G   +LR    +D +++RV C+Y A   ++  +E 
Sbjct  119  NDEPIAAYHFDL--SGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIE- 175
Query  166  KSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFR 223
            K+  P  L++   Y  G  D+V V++   GS  WK +   +G  W   T +   GP+  R
Sbjct  176  KASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVR 235
Query  224  VVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            V   GG   K +  D   +P  W A  VY + VQ
Sbjct  236  VTTEGGE--KIIAEDA--IPDGWKADSVYKSNVQ 265

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 88.0 bits 390,  Expect = 4e-19
 Identities = 63/202 31%, Positives = 106/202 52%, Gaps = 9/202 4%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
            + G+CG+ +          +  +  +F+ G GCG+C+Q+RC +   CS     V++TD  
Sbjct  61   DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMN 120
Query  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                ++  + LS  A+ AMA+PG   QLR    +D+++KRVPC +  G  ++  VEE S 
Sbjct  121  YYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSN 179
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVV 226
            P   +++   Y+ G  D+V VD+    S +W  M   +G  W   + +    P+ +R+  
Sbjct  180  PVY-FAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRIT- 237
Query  227  TGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
                 GK + A  +V+P  W    VY + VQ
Sbjct  238  --NESGKQLVAS-QVIPANWAPMAVYRSFVQ 265

Sequence Alignment: 6. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 88.0 bits 390,  Expect = 4e-19
 Identities = 70/201 34%, Positives = 109/201 54%, Gaps = 12/201 5%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-- 107
            N G+CG  ++      G  A  +  +F+ G GCG+C++VRCK+   CS     V +TD  
Sbjct  62   NGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMN 121
Query  108  -EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
             E  +    DL  S  A+ ++A+PG+  ++R    +DVE++RV C+Y AG+ +   +E K
Sbjct  122  YEPIAPYHFDL--SGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIE-K 178
Query  167  SRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRV 224
               P  L++   Y     DIV +++    S+ WK M   +G  W   TA+A  GP+  R+
Sbjct  179  GCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRL 238
Query  225  VVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
                   GK V A  +V+P  W    VY + VQ
Sbjct  239  T---SESGKKVIAK-DVIPANWRPDAVYTSNVQ 267

Sequence Alignment: 7. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 87.8 bits 389,  Expect = 4e-19
 Identities = 67/203 33%, Positives = 106/203 52%, Gaps = 10/203 4%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD- 107
            N G+CGY  +  A F G +     P +F+ G GCG+CF+V+C   + CS     + +TD 
Sbjct  60   NGGACGYKDIDKAPFLGMNSCGNDP-IFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDM 118
Query  108  EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR    +D++++RV C+Y     ++  VE K 
Sbjct  119  NTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVE-KG 177
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
              P  +++   Y GG  D+V V++   GS  WK +   +G  W   T +   GP+ +RV 
Sbjct  178  SNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVT 237
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQI 258
                 D K V  D  V+P  W A  +Y + +Q+
Sbjct  238  TES--DQKLVAND--VIPDNWKANALYKSEIQV 266

Sequence Alignment: 8. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 87.0 bits 385,  Expect = 7e-19
 Identities = 66/197 33%, Positives = 104/197 52%, Gaps = 10/197 5%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            N G+CGY  +  A F+G      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  60   NGGACGYKDVDKAPFSGMTGCGNTP-IFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDD 118
Query  109  ARSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR+   ++++++RV CEY  G  ++  VE+ S
Sbjct  119  NEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGS 178
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
             P   L++   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  179  NPNY-LALLVKYVTGDGDVVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYT 237
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVY 252
              GG  G+   A+ +V+P  W A   Y
Sbjct  238  TEGGTKGE---AE-DVIPEGWKADTAY 260

Sequence Alignment: 9. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 86.4 bits 382,  Expect = 1e-18
 Identities = 64/206 31%, Positives = 107/206 51%, Gaps = 15/206 7%
Query  38   SKAGFRDSSIALNAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCS 97
            + AG +D     N G+CGY  +      G     +  +F+ G GCG+CF+++C   + CS
Sbjct  53   TAAGPKD-----NGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACS 107
Query  98   TAGAKVVVTDEARSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAG 156
                 V +TD+         + LS  A+ +MA+ G   +LR+   V+++++RV C+Y  G
Sbjct  108  GEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEG 167
Query  157  RNLSIRVEEKSRPPR-ELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STA 213
              ++  VE+ S P    L ++F+   G  D+VAVD+   G   W  +   +G  W   T 
Sbjct  168  TKVTFHVEKGSNPNYLALLVKFV--AGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTP 225
Query  214  QAPAGPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDA 254
            +   GP+  R    GG  G+      +V+P  W A   Y++
Sbjct  226  EVLKGPFTVRYTTEGGTKGE----AKDVIPEGWKADTAYES 262

Sequence Alignment: 10. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 86.2 bits 381,  Expect = 1e-18
 Identities = 64/200 32%, Positives = 101/200 50%, Gaps = 8/200 4%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            N G+CGY  +      G     +  +F+ G GCG+CF+++C   + CS     V +TD+ 
Sbjct  60   NGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDN 119
Query  110  RSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                    L LS  A+ AMA+ G   +LR+   ++++++RV CEY  G  ++  VE+ S 
Sbjct  120  EEPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSN 179
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVV 226
            P   L++   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R   
Sbjct  180  P-NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 238
Query  227  TGGYDGKWVWADGEVLPRRWTAGRVYDA 254
             GG     V A+ +V+P  W A   Y++
Sbjct  239  EGGTK---VEAE-DVIPEGWKADTAYES 262

Sequence Alignment: 11. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 86.0 bits 380,  Expect = 1e-18
 Identities = 65/199 32%, Positives = 101/199 50%, Gaps = 10/199 5%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            N G+CGY  +  A FNG      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  60   NGGACGYKDVDKAPFNGMTGCGNTP-IFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 118
Query  109  ARSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ +MA+ G   +LR+   ++++++RV C+Y  G   +  VE+ S
Sbjct  119  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKAS 178
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
             P   L+I   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  179  NP-NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYT 237
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254
              GG   +      +V+P  W A   Y A
Sbjct  238  TEGGTKSEVE----DVIPEGWKADTSYSA 262

Sequence Alignment: 12. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 85.8 bits 379,  Expect = 2e-18
 Identities = 70/198 35%, Positives = 110/198 55%, Gaps = 16/198 8%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-- 107
            N G+CG  ++      G  A  +P +F+ G GCG+C+++RC   + CS     V +TD  
Sbjct  61   NGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDMN 119
Query  108  -EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
             E  +    DL  S  A+ AMA+PG+  +LR     D+E++RV C+Y  G+ +   VE+ 
Sbjct  120  YEPIAPYHFDL--SGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKG 177
Query  167  SRPPR-ELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFR 223
            S P    + ++F+   G  DIV +++    SS+WK M   +G  W   T +A   P+  R
Sbjct  178  SNPNYLAMLVKFVADDG--DIVLMELKE-KSSDWKPMKLSWGAIWRMDTPKALVPPFSIR 234
Query  224  VVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +       GK V A  +V+P  W    VY++ VQ
Sbjct  235  LT---SESGKKVIAQ-DVIPVNWKPDTVYNSNVQ 264

Sequence Alignment: 13. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 84.8 bits 374,  Expect = 3e-18
 Identities = 62/200 31%, Positives = 101/200 50%, Gaps = 8/200 4%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            N G+CGY  +      G     +  +F+ G GCG+CF+++C   + CS     V +TD+ 
Sbjct  45   NGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDN 104
Query  110  RSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                    + LS  A+ +MA+ G   +LR+   ++++++RV C+Y  G   +  VE+ S 
Sbjct  105  EEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSN 164
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVV 226
            P   L++   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R   
Sbjct  165  P-NYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 223
Query  227  TGGYDGKWVWADGEVLPRRWTAGRVYDA 254
             GG  G+   A+ +V+P  W A   Y+A
Sbjct  224  EGGTKGE---AE-DVIPEGWKADTAYEA 247

Sequence Alignment: 14. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 84.6 bits 373,  Expect = 4e-18
 Identities = 62/200 31%, Positives = 101/200 50%, Gaps = 8/200 4%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            N G+CGY  +      G     +  +F+ G GCG+CF+++C   + CS     V +TD+ 
Sbjct  62   NGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDN 121
Query  110  RSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                    + LS  A+ +MA+ G   +LR+   ++++++RV C+Y  G   +  VE+ S 
Sbjct  122  EEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSN 181
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVV 226
            P   L++   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R   
Sbjct  182  P-NYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 240
Query  227  TGGYDGKWVWADGEVLPRRWTAGRVYDA 254
             GG  G+   A+ +V+P  W A   Y+A
Sbjct  241  EGGTKGE---AE-DVIPEGWKADTAYEA 264

Sequence Alignment: 15. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 84.4 bits 372,  Expect = 5e-18
 Identities = 63/199 31%, Positives = 101/199 50%, Gaps = 10/199 5%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            N G+CGY ++  A FNG      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  60   NGGACGYKNVDKAPFNGMTGCGNTP-IFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 118
Query  109  ARSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ +MA+ G    +R+   ++++++RV C+Y      +  VE+ S
Sbjct  119  NEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKAS 178
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
             P   L+I   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  179  NP-NYLAILVKYVDGDGDVVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYT 237
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254
              GG   ++     +V+P  W A   Y A
Sbjct  238  TEGGTKSEFE----DVIPEGWKADTSYSA 262

Sequence Alignment: 16. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 84.2 bits 371,  Expect = 5e-18
 Identities = 63/202 31%, Positives = 104/202 51%, Gaps = 10/202 4%
Query  50   NAGSCGYGSLA-ASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            N G+CGY  +  A FN    A  +P +F+ G+GCG+C++++C     CS     V +TD+
Sbjct  23   NGGACGYKDVNKAPFNS-MGACGNPPIFKDGLGCGSCYEIKCDKPAECSGEPVIVHITDQ 81
Query  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + L+  A+ AMA+ G   +LR    +D++++RV C+Y A   ++  VE K 
Sbjct  82   NYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRVKCKYPANTKIAFHVE-KG 140
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
              P  +++   Y  G  DIVAVD+   GS  +  +   +G  W   + +   GP+  R+ 
Sbjct  141  CNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAIWRIDSPKPIKGPIAVRLT 200
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
              GG          + +P  W A  VY + +Q
Sbjct  201  SEGGT----TLVQDDAIPEGWKADTVYTSKLQ 228

Sequence Alignment: 17. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 84.0 bits 370,  Expect = 6e-18
 Identities = 63/199 31%, Positives = 101/199 50%, Gaps = 10/199 5%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            N G+CGY ++  A FNG      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  60   NGGACGYKNVDKAPFNGMTGCGNTP-IFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 118
Query  109  ARSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ +MA+ G    +R+   ++++++RV C+Y      +  VE+ S
Sbjct  119  NEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKAS 178
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
             P   L+I   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  179  NP-NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYT 237
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254
              GG   ++     +V+P  W A   Y A
Sbjct  238  TEGGTKSEFE----DVIPEGWKADTSYSA 262

Sequence Alignment: 18. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 83.8 bits 369,  Expect = 7e-18
 Identities = 67/204 32%, Positives = 103/204 50%, Gaps = 11/204 5%
Query  48   ALNAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD 107
            A N G+CG+  +      G  +  +  L++GG GCG+C++VRC     CS     V +TD
Sbjct  60   ADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITD 119
Query  108  EAR-STNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
                  ++  + LS  A+  +A+PG A  LR    +DV++ RVPCE+  G  +   VEE 
Sbjct  120  MNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEG 178
Query  167  SRPPRELSIRFLYQGGQTDIVAVDV--ATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
            S P   L++   Y+ G  D+  VD+  A  G   W  M   +G  W   + +    P+  
Sbjct  179  SSPVY-LAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSI 237
Query  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            R+       GK + A  +V+P  WT    Y + VQ
Sbjct  238  RIRSD---SGKTLVAP-DVIPLNWTPNTFYRSFVQ 268

Sequence Alignment: 19. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 83.2 bits 366,  Expect = 1e-17
 Identities = 61/200 30%, Positives = 101/200 50%, Gaps = 8/200 4%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            N G+CGY  +      G     +  +F+ G GCG+CF+++C   + CS     V +TD+ 
Sbjct  60   NGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDN 119
Query  110  RSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                    + LS  A+ AMA+ G   +LR+   ++++++RV C+Y  G  ++  VE+ S 
Sbjct  120  EEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSN 179
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVV 226
            P   L++   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R   
Sbjct  180  P-NYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTT 238
Query  227  TGGYDGKWVWADGEVLPRRWTAGRVYDA 254
             GG   +   A+ +V+P  W A   Y++
Sbjct  239  EGGTKTE---AE-DVIPEGWKADTSYES 262

Sequence Alignment: 20. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 82.8 bits 364,  Expect = 1e-17
 Identities = 63/199 31%, Positives = 99/199 49%, Gaps = 10/199 5%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            N G+CGY  +  A FNG      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  49   NGGACGYKDVDKAPFNGMTGCGNTP-IFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDD 107
Query  109  ARSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ +MA+ G    +R+   ++++++RV C+Y      +  VE+ S
Sbjct  108  NEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGS 167
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
             P   L+I   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  168  NP-NYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYT 226
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254
              GG   +      +V+P  W A   Y A
Sbjct  227  TEGGTKSEVE----DVIPEGWKADTSYSA 251

Sequence Alignment: 21. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 82.4 bits 362,  Expect = 2e-17
 Identities = 63/200 31%, Positives = 106/200 53%, Gaps = 14/200 7%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-- 107
            N G+CG  ++      G ++  +  +F+ G GCG+C++V+C+    CS     V +TD  
Sbjct  62   NGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMN 121
Query  108  -EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
             E  S    D+  S  A+ AMA PG   +LR    +D++++RV C+Y  G+ ++  VE+ 
Sbjct  122  YEPISAYHFDF--SGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKG 179
Query  167  SRPPR-ELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFR 223
            S P    + ++F+   G  D++ +D+   G   W+ M   +G  W   TA     P+  R
Sbjct  180  SNPNYLAVLVKFVADDG--DVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIR 237
Query  224  VVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            V       GK + A  +V+P  W    +Y + VQ
Sbjct  238  VTTES---GKSLIAK-DVIPVNWMPDAIYVSNVQ 267

Sequence Alignment: 22. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 82.0 bits 360,  Expect = 2e-17
 Identities = 68/202 33%, Positives = 102/202 50%, Gaps = 14/202 6%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
            N G+CG+ +          +  +  LF+ G GCGAC+Q+RC +   CS     V++TD  
Sbjct  50   NGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMN 109
Query  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                 R  + LS  A+ AMARPG+  QLR    +D++++RVPC Y  G  ++  VE  S 
Sbjct  110  YYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSN 168
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSN-----WKFMTRDYGPAW--STAQAPAGPLQ 221
            P   L++   +      +V +DV     S      W  M R +G  W     +   GP  
Sbjct  169  PVY-LAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXS 227
Query  222  FRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +R+V      G+ V A  +V+P  W A   Y + VQ
Sbjct  228  LRMV---SESGQTVIAH-QVIPANWRANTNYGSKVQ 259

Sequence Alignment: 23. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 81.2 bits 356,  Expect = 3e-17
 Identities = 64/181 35%, Positives = 103/181 56%, Gaps = 14/181 7%
Query  69   AAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD---EARSTNRTDLVLSAAAYA 125
            A  +  +F+ G GCG+C++VRCK+   CS     V +TD   E  +    DL  S  A+ 
Sbjct  3    ACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDL--SGKAFG 60
Query  126  AMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSRPPR-ELSIRFLYQGGQT 184
            ++A+PG+  +LR    +DVE++RV C+Y AG+ +   +E+   P    + ++F+   G  
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDG-- 118
Query  185  DIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVVTGGYDGKWVWADGEVL 242
            DIV +++    S+ WK M   +G  W   TA+A  GP+  R+       GK V A  +++
Sbjct  119  DIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLT---SESGKKVIAK-DII 174
Query  243  PRRWTAGRVYDAGVQ 257
            P  W    VY + VQ
Sbjct  175  PANWRPDAVYTSNVQ 189

Sequence Alignment: 24. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 80.6 bits 353,  Expect = 7e-17
 Identities = 63/198 31%, Positives = 101/198 51%, Gaps = 11/198 5%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            N G+CGY  +  A FNG      +P +F+ G GCG+CF+++C   + CS     V +TD+
Sbjct  66   NGGACGYKDVDKAPFNGMTGCGNTP-IFKDGRGCGSCFELKCSKPESCSGEPITVHITDD 124
Query  109  ARSTNRT-DLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ +MA+ G    +R    ++++++RV C+Y  G   +  VE+ S
Sbjct  125  NEEPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGS 184
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVV 225
             P   L++   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R  
Sbjct  185  NP-NYLALLVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYT 243
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254
              GG   ++     +V+P  W A   +DA
Sbjct  244  TEGGTKAEFE----DVIPEGWKAD-THDA 267

Sequence Alignment: 25. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 80.2 bits 351,  Expect = 9e-17
 Identities = 63/204 30%, Positives = 108/204 52%, Gaps = 15/204 7%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
            N G+CG+ ++         +  +  +F+ G GCG+C+Q+RC     CS     V++TD  
Sbjct  63   NGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMN 122
Query  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                 R  + LS  A+ AMA+PG+  +LR    +D++++RVPC Y  G  ++  VEE S 
Sbjct  123  YYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSN 181
Query  169  PPRELSIRFLYQGGQTDIVAVDV-----ATVGSSN-WKFMTRDYGPAW--STAQAPAGPL 220
            P   +++   Y+    D+V VD+     A  G++  W  M   +G  W   + +    P+
Sbjct  182  PVY-FAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF 240
Query  221  QFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIA 259
             +R+    G   K + A+  V+P  W+    Y + VQ +
Sbjct  241  SLRIRSDSG---KTLVANN-VIPANWSPNSNYRSIVQFS 275

Sequence Alignment: 26. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 80.0 bits 350,  Expect = 1e-16
 Identities = 64/202 31%, Positives = 110/202 54%, Gaps = 14/202 6%
Query  52   GSCGYGSLAAS--FNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            G+CGYG+      F+   ++A SP ++  G GCG+C++V+C     CS    KVV+TDE 
Sbjct  67   GACGYGNAVGQPPFSS-LISAGSPLIYDSGKGCGSCYEVKCTGNSACSGNPVKVVITDEC 125
Query  110  R---STNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
                S  +  + LS  A+ AMA  G    LR    ++++++R+ C Y  GR+++  V+  
Sbjct  126  AGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQHRRIECNYP-GRSIAFHVDSG 184
Query  167  SRPPRELSIRFLYQGGQTDIVAVDVA-TVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FR 223
            S      ++   Y+ G  D+  V++   + S +W  M + +G  W   +    PL+  F 
Sbjct  185  SNQEYFATL-VEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDK--GSPLRAPFS 241
Query  224  VVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIA 259
            + +T    G+ + A+  V+P  WT G+ Y + V  A
Sbjct  242  IKLTTLESGQTIVANN-VIPAGWTPGQTYRSIVNFA 276

Sequence Alignment: 27. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 79.0 bits 345,  Expect = 2e-16
 Identities = 62/202 30%, Positives = 105/202 51%, Gaps = 10/202 4%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            + G+CGY  +  A F+        P +F+ G+GCG+C++++CK+   CS     + +TD+
Sbjct  56   HGGACGYKDVDKAPFDSMTGCGNEP-IFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK 114
Query  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  115  NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVE-KG 173
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
              P  L++   Y  G  +IV+VD+ + GS  +  M + +G  W     P  PL+  F + 
Sbjct  174  SNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRI--DPPKPLKGPFTIR 231
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +T    G     D  V+P  W    VY + +Q
Sbjct  232  LTSESGGHVEQED--VIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 28. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 79.0 bits 345,  Expect = 2e-16
 Identities = 62/202 30%, Positives = 105/202 51%, Gaps = 10/202 4%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            + G+CGY  +  A F+        P +F+ G+GCG+C++++CK+   CS     + +TD+
Sbjct  56   HGGACGYKDVDKAPFDSMTGCGNEP-IFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK 114
Query  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  115  NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVE-KG 173
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
              P  L++   Y  G  +IV+VD+ + GS  +  M + +G  W     P  PL+  F + 
Sbjct  174  SNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRI--DPPKPLKGPFTIR 231
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +T    G     D  V+P  W    VY + +Q
Sbjct  232  LTSESGGHVEQED--VIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 29. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 79.0 bits 345,  Expect = 2e-16
 Identities = 62/202 30%, Positives = 105/202 51%, Gaps = 10/202 4%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            + G+CGY  +  A F+G       P +F+ G+ CG+C++++CK+   CS     + +TD+
Sbjct  56   HGGACGYKDVDKAPFDGMTGCGNEP-IFKDGLACGSCYEIKCKEPAECSGEPVLIKITDK 114
Query  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  115  NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVE-KG 173
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
              P  L++   Y  G  +IV+VD+ + GS  +  M + +G  W     P  PL+  F + 
Sbjct  174  SNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRI--DPPKPLKGPFTIR 231
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +T    G     D  V+P  W    VY + +Q
Sbjct  232  LTSESGGHVEQED--VIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 30. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 79.0 bits 345,  Expect = 2e-16
 Identities = 63/202 31%, Positives = 103/202 50%, Gaps = 10/202 4%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            + G+CGY  +  A F+G       P +F+ G+GCG+C++++CK+   CS     + +TD+
Sbjct  56   HGGACGYKDVDKAPFDGMTGCGNEP-IFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDK 114
Query  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  115  NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVE-KG 173
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
              P  L++   Y  G  +IV VD+   GS  +  M   +G  W     P  PL+  F + 
Sbjct  174  SSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWR--MDPPKPLKGPFTIR 231
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +T    G     D  V+P  W    VY + +Q
Sbjct  232  LTSESGGHVEQED--VIPEDWKPDTVYKSKIQ 261

Sequence Alignment: 31. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 78.8 bits 344,  Expect = 2e-16
 Identities = 63/202 31%, Positives = 105/202 51%, Gaps = 10/202 4%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            + G+CGY  +  A F+G       P +F+ G+ CG+C++++CK+   CS     + +TD+
Sbjct  38   HGGACGYKDVDKAPFDGMTGCGNEP-IFKDGLACGSCYEIKCKEPAECSGEPVLIKITDK 96
Query  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  97   NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVE-KG 155
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
              P  L++   Y  G  +IV VD+   GS  +  M + +G  W     P  PL+  F + 
Sbjct  156  SSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWR--MDPPKPLKGPFTIR 213
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +T    G  V  D +V+P  W    VY + +Q
Sbjct  214  LTSESGGH-VEQD-DVIPEDWKPDTVYKSKIQ 243

Sequence Alignment: 32. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 78.8 bits 344,  Expect = 2e-16
 Identities = 62/203 30%, Positives = 101/203 49%, Gaps = 8/203 3%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            + G+CGY ++  +   G     +  +F+ G+GCG+CF+++CK+   CS     + +TD+ 
Sbjct  66   DGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKN 125
Query  110  -RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                    + LS  A+ +MA+ G    LR    + ++++RV CEY +   ++  VE K  
Sbjct  126  YEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVE-KGC 184
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVVV 226
                L++   Y  G  DIVAVD+   GS  +  M   +G  W     P  PL+  F V +
Sbjct  185  NDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRI--DPKKPLKGPFTVRL 242
Query  227  TGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            T     K V  D  V+P  W     Y + +Q
Sbjct  243  TSESGAKLVQED--VIPADWKPNTAYTSNLQ 271

Sequence Alignment: 33. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 78.6 bits 343,  Expect = 2e-16
 Identities = 63/202 31%, Positives = 105/202 51%, Gaps = 10/202 4%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
            + G+CGY  +  A F+G       P +F+ G+ CG+C++++CK+   CS     + +TD+
Sbjct  38   HGGACGYKDVDKAPFDGMTGCGNEP-IFKDGLACGSCYEIKCKEPAECSGEPVLIKITDK 96
Query  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  97   NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVE-KG 155
Query  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
              P  L++   Y  G  +IV VD+   GS  +  M + +G  W     P  PL+  F + 
Sbjct  156  SSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRI--DPPKPLKGPFTIR 213
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
            +T    G  V  D +V+P  W    VY + +Q
Sbjct  214  LTSESGGH-VEQD-DVIPEDWKPDTVYKSKIQ 243

Sequence Alignment: 34. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 78.0 bits 340,  Expect = 4e-16
 Identities = 61/203 30%, Positives = 101/203 49%, Gaps = 8/203 3%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
            + G+CGY  +      G  A  +  +F+ G+GC AC++++CK+   CS     V +TD+ 
Sbjct  38   HGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKN 97
Query  110  -RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                    + LS  A+ AMA+ G   +LR    + ++++RV C+Y +G  ++  +E K  
Sbjct  98   YEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITFHIE-KGS 156
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWST-AQAP-AGPLQFRVVV 226
                L++   Y  G  +IVAVD+    S  +  M   +G  W    + P  GP+  R+  
Sbjct  157  NDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTS 216
Query  227  TGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
             GG     V  D  V+P  W    VY + +Q
Sbjct  217  EGG--AHLVQDD--VIPANWKPDTVYTSKLQ 243

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 77.8 bits 339,  Expect = 5e-16
 Identities = 59/172 34%, Positives = 92/172 53%, Gaps = 13/172 7%
Query  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD- 107
            N G+CGY  +  A F G +     P +F+ G GCG+CF+++C   + CS   A + VTD 
Sbjct  60   NGGACGYKDVDKAPFLGMNSCGNDP-IFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDM 118
Query  108  --EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEE 165
              E  +    DL     +  AMA+ G   +LR    +D +++RV C+Y A   ++  +E+
Sbjct  119  NDEPIAAYHFDL-----SGLAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEK 173
Query  166  KSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFR 223
             S P   L++   Y  G  D+V V++   GS  WK +   +G  W   T +   GP+  R
Sbjct  174  ASNPNY-LALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVR 232
Query  224  VVVTG 228
            V   G
Sbjct  233  VTTEG 237

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 77.6 bits 338,  Expect = 6e-16
 Identities = 61/202 30%, Positives = 101/202 50%, Gaps = 15/202 7%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
            N G+CG+            +  +  LF+ G GCG+C+++RC   + CS     V++TD  
Sbjct  74   NGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMN 133
Query  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                    + LS  A+  +A+PG+  +LR    +D+E+ RVPCE+  G  +   VEE S 
Sbjct  134  YYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFP-GLKIGFHVEEYSN 192
Query  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSN------WKFMTRDYGPAW--STAQAPAGPL 220
            P   +++   Y+ G  D+V VD+    +++      W  M   +G  W   T +    P+
Sbjct  193  PVY-FAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAPF 251
Query  221  QFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
              R+       GK + A+  V+P  W     Y + VQ
Sbjct  252  SIRI---RNESGKTLVANN-VIPANWRPNTFYRSFVQ 284

Sequence Alignment: 37. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 74.0 bits 320,  Expect = 6e-15
 Identities = 64/198 32%, Positives = 101/198 51%, Gaps = 11/198 5%
Query  50   NAGSCGYGSLA-ASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVV--T 106
            N G+CGY  +  A FN        P +F+ G+ CG+CF+++C   K    +G  VVV  T
Sbjct  37   NGGACGYKDVNKAPFNSMGACGNLP-IFKDGL-CGSCFEIKCDKPKPAECSGEAVVVHIT 94
Query  107  D-EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEE 165
            D          + L+  A+ AMA+ G   +L     +D++++RV C+Y  G  ++  VE+
Sbjct  95   DMNYEQIAAYHFDLAGHAFGAMAKKGQEEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEK 152
Query  166  KSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQFRVV 225
             S P   L++   Y  G  DIV VD+   G   ++ +   +G  W    +P  P++F V 
Sbjct  153  GSNP-NYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKHSWGAIWRK-DSP-DPIKFPVT 209
Query  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDA 254
            V    +G    A  +V+P  W A   Y A
Sbjct  210  VQITTEGGTKTAYDDVIPEGWKADTTYTA 238

Sequence Alignment: 38. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 72.2 bits 311,  Expect = 3e-14
 Identities = 65/202 32%, Positives = 107/202 52%, Gaps = 19/202 9%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
            N G+CG+ ++         +  +  LF+ G GCG+C+Q+RC     CS     V++TD  
Sbjct  111  NGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMN 170
Query  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
                +   + LS  A+ AMA+     +LR    +D++++RVPC+Y  G  ++  VE+ S 
Sbjct  171  YYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYP-GLTVTFHVEQGSN 229
Query  169  PPRELSIRFLYQGGQTDIVAVDVA----TVGSSN------WKFMTRDYGPAW--STAQAP 216
            P   ++I   Y+ G  D+V VD+     + G  +      W  M   +G  W   T +  
Sbjct  230  PVY-MAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPL 288
Query  217  AGPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
             GP+ +R+       GK + AD +V+P  W    VY + VQ
Sbjct  289  QGPFSLRIT---NESGKTLIAD-QVIPADWQPNTVYSSIVQ 325

Sequence Alignment: 39. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 71.6 bits 308,  Expect = 3e-14
 Identities = 57/202 28%, Positives = 103/202 50%, Gaps = 15/202 7%
Query  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCK--DGKLCSTAGAKVVVTD 107
            N G+CG+ ++         A  +  +F GG GCG C++++C+  +   CS    ++V+TD
Sbjct  59   NGGACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITD 118
Query  108  -EARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
                   R  L LS  A+ +MA+ G+  +LR    +D++++RVPC +  G  ++  V+  
Sbjct  119  MNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFP-GMKVTFHVQRG 177
Query  167  SRPPRELSIRFLYQGGQTDIVAVDVATV--G--SSNWKFMTRDYGPAW--STAQAPAGPL 220
            S P   L++   Y      +V +++     G  +  W+ M R +G  W   T +   GP+
Sbjct  178  SNP-NYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDTNRPVQGPF 236
Query  221  QFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257
              R+       GK + A+  + P  W     Y + +Q
Sbjct  237  SIRITSD---TGKTLVANNAI-PAYWQQDHAYWSNLQ 269

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 47.0 bits 186,  Expect = 9e-07
 Identities = 51/196 26%, Positives = 79/196 40%, Gaps = 15/196 7%
Query  52   GSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEAR 110
            G+CGY S    S+     AA S  LF  G GCG C+++RC     C+     VV+T    
Sbjct  72   GACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNL 131
Query  111  STNRTDLVLSAAAYAAMAR------PGMAAQLRTRRA--VDVEYKRVPCEYAAGRNLSIR 162
                  L      +    R      P    +L  R A  V V+Y+RVPC+   G  + ++
Sbjct  132  CPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQRVAGIVPVQYRRVPCQRTGGVRFCLQ 191
Query  163  VEEKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSN-WKFMTRDYGPAWSTAQAPAGPLQ 221
                      L +  +  GG  D+ ++ V T G    W     ++G  +    A      
Sbjct  192  GNH-----YWLLLYVMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDG 246
Query  222  FRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            + V +T     +      + +   W  G  Y
Sbjct  247  LTVKLTTYSTPQQTIIVSDAISPWWITGLCY 277

Sequence Alignment: 41. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 38.1 bits 142,  Expect = 0.0002
 Identities = 34/85 40%, Positives = 44/85 51%, Gaps = 10/85 11%
Query  158  NLSIRVEEKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPA 217
            N+   VEE S P   LSI+        +I  VDV   G+ N   MT+  G +W+  +   
Sbjct  21   NIIFHVEESS-PKFALSIK----DSAKEITQVDVREHGADNMDPMTKS-GDSWTIDKPLK 74
Query  218  GPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            GPL  R+   GG  G  V  D  V+P  W AG  Y
Sbjct  75   GPLNIRLRAEGG--GSRVQDD--VIPENWKAGTDY 105

Sequence Alignment: 42. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 34.7 bits 125,  Expect = 0.002
 Identities = 29/81 35%, Positives = 46/81 56%, Gaps = 10/81 12%
Query  165  EKSRPPRELSIRFLYQGGQTDIVA-VDVATVGSSNWKFMTRDYGPAWS-TAQAP-AGPLQ 221
            EK    + L++   Y+G   D +A V++   GS  W  MT+  G  W+  ++ P  GP+ 
Sbjct  35   EKGSNEKHLAVLVKYEG---DTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLKGPFN 91
Query  222  FRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            FR +   G   K V+ D  V+P ++T G  Y
Sbjct  92   FRFLTEKGM--KNVFDD--VVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 34.7 bits 125,  Expect = 0.002
 Identities = 29/81 35%, Positives = 46/81 56%, Gaps = 10/81 12%
Query  165  EKSRPPRELSIRFLYQGGQTDIVA-VDVATVGSSNWKFMTRDYGPAWS-TAQAP-AGPLQ 221
            EK    + L++   Y+G   D +A V++   GS  W  MT+  G  W+  ++ P  GP+ 
Sbjct  35   EKGSNEKHLAVLVKYEG---DTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFN 91
Query  222  FRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            FR +   G   K V+ D  V+P ++T G  Y
Sbjct  92   FRFLTEKGM--KNVFDD--VVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 34.7 bits 125,  Expect = 0.002
 Identities = 29/81 35%, Positives = 46/81 56%, Gaps = 10/81 12%
Query  165  EKSRPPRELSIRFLYQGGQTDIVA-VDVATVGSSNWKFMTRDYGPAWS-TAQAP-AGPLQ 221
            EK    + L++   Y+G   D +A V++   GS  W  MT+  G  W+  ++ P  GP+ 
Sbjct  35   EKGSNEKHLAVLVKYEG---DTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFN 91
Query  222  FRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            FR +   G   K V+ D  V+P ++T G  Y
Sbjct  92   FRFLTEKGM--KNVFDD--VVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 34.7 bits 125,  Expect = 0.002
 Identities = 29/81 35%, Positives = 46/81 56%, Gaps = 10/81 12%
Query  165  EKSRPPRELSIRFLYQGGQTDIVA-VDVATVGSSNWKFMTRDYGPAWS-TAQAP-AGPLQ 221
            EK    + L++   Y+G   D +A V++   GS  W  MT+  G  W+  ++ P  GP+ 
Sbjct  35   EKGSNEKHLAVLVKYEG---DTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFN 91
Query  222  FRVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            FR +   G   K V+ D  V+P ++T G  Y
Sbjct  92   FRFLTEKGM--KNVFDD--VVPEKYTIGATY 118

Sequence Alignment: 46. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 33.7 bits 120,  Expect = 0.003
 Identities = 27/83 32%, Positives = 42/83 50%, Gaps = 7/83 8%
Query  165  EKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
            EK    + L +   Y      +  V++   GS  W+ MT+  G  W   +A+   GP+ F
Sbjct  8    EKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPLTGPMNF 66
Query  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            R +  GG   K V+   EV+P  +T G+ Y
Sbjct  67   RFLSKGGM--KNVF--DEVIPTAFTVGKTY 92

Sequence Alignment: 47. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 32.7 bits 115,  Expect = 0.007
 Identities = 22/83 26%, Positives = 42/83 50%, Gaps = 7/83 8%
Query  165  EKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
            +K   P++L +   Y      +  V++   GS  W+ +T+  G  W   +++   GP+ F
Sbjct  20   QKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVGPFNF 78
Query  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252
            R +  GG    +     EV+P  ++ G+ Y
Sbjct  79   RFMSKGGMRNVF----DEVIPTAFSIGKTY 104

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.