The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI
NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA
DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE
ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS
EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB38044 Hel as 1 284 1725 399.8 5.9e-113
APG42675 Hal l 1.0101 284 1511 351.0 2.9e-98
AAG08987 Hal d 1 284 1494 347.1 4.2e-97
AVD53650 Sac g 1.0101 284 1324 308.4 1.9e-85
AAG08989 Mim n 1 284 1274 297.0 5.2e-82
AAG08988 Per v 1 284 1218 284.2 3.6e-78
M1H607 Por p 1.0101 284 1158 270.5 4.8e-74
BAA04557 Der f 10.0101 299 1157 270.3 5.9e-74
D3XNR9 Mac r 1.0101 284 1156 270.1 6.5e-74
AAC48288 Hom a 1.0102 284 1155 269.9 7.6e-74
AEX31649 Cho a 10.0101 284 1154 269.6 9e-74
ABU97466 Blo t 10.0101 284 1152 269.2 1.2e-73
M4M2H6 Mel l 1.0101 284 1152 269.2 1.2e-73
CBY17558 Pan b 1.0101 284 1148 268.3 2.3e-73
C0LU07 Pro c 1.0101 284 1148 268.3 2.3e-73
11893851 Pen a 1 284 1145 267.6 3.7e-73
EU410072 Lit v 1.0101 284 1145 267.6 3.7e-73
AAX37288 Pen m 1 284 1145 267.6 3.7e-73
AAT40866 Tyr p 10.0101 284 1143 267.1 5.1e-73
Q9NFZ4 Lep d 10 284 1136 265.5 1.5e-72
A7L5V2 Scy p 1.0101 284 1132 264.6 2.9e-72
O18416 Der p 10 284 1130 264.2 4e-72
O44119 Hom a 1.0101 284 1129 263.9 4.7e-72
AAK96889 Cra g 1 233 1126 263.3 5.8e-72
NP_001103782 Bomb m 3.0101 285 1123 262.6 1.2e-71
Q17H75 Aed a 10.0101 285 1119 261.6 2.3e-71
ACN32322 Asc l 3.0101 287 1116 261.0 3.7e-71
AAD19606 Per a 7.0102 284 1111 259.8 8e-71
Q9UB83 Per a 7 284 1109 259.4 1.1e-70
AAF72534 Bla g 7.0101 284 1106 258.7 1.8e-70
O61379 Pan s 1 274 1104 258.2 2.3e-70
Q9NAS5 Ani s 3 284 1102 257.8 3.3e-70
Q25456 Met e 1 274 1093 255.7 1.3e-69
CAA09938 Chi k 10 285 1093 255.7 1.4e-69
Q9N2R3 Cha f 1 264 1029 241.2 3.1e-65
CAC84590 Lep s 1 284 971 227.9 3.2e-61
AGM32377.1 Copt f 7.0101 256 969 227.5 3.9e-61
XP_026775428 Pan h 4.0201 284 963 226.1 1.1e-60
NP_001117128 Sal s 4.0101 284 941 221.1 3.7e-59
Q17H80 Aed a 10.0201 284 917 215.6 1.6e-57
XP_026781482 Pan h 4.0101 284 883 207.9 3.5e-55
QPB41107 Rap v 2.0101 859 226 57.9 1.5e-09
AAO73464 Der p 11 875 195 50.8 2e-07
AAM83103 Blo t 11 875 189 49.5 5.2e-07
AAK39511 Der f 11.0101 692 186 48.8 6.6e-07
AAF72796 Ani s 2 869 181 47.6 1.8e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 399.8 bits 1725,  Expect = 6e-113
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
            ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 2. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 351.0 bits 1511,  Expect = 3e-98
 Identities = 248/284 87%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKMLAMKMEKENA+DRAEQ EQKLRD E  K K+EEDLNNLQKK A LENDFD++
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            NEQL +A TKLE SEK+  E+E E +G  R+I LLEEDLER+EERLQ+ATE+LEEASKAA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESERGRKVLESRSLADDER+D LEAQLKEAKYIAEDAERK+DEAARKLAITEVDLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
            ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRA+
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            EAERTVSKLQKEVDRLEDELLAEKE+YKA SDELD TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 3. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 347.1 bits 1494,  Expect = 4e-97
 Identities = 245/284 86%, Positives = 262/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKMLAMKMEKENA+DRAEQ EQKLRD E  K K+EEDLNNLQKK A LENDFD++
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            NEQL +A  KLE SEK+  E+E E +G  R+I LLEEDLER+EERLQ+ATE+LEEASKAA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESERG +VLESRSLADDER+D LEAQLKEAKYIAEDAERK+DEAARKLAITEVDLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
            ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRA+
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            EAERTVSKLQKEVDRLEDELLAEKE+YKA SDELD TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 4. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 308.4 bits 1324,  Expect = 2e-85
 Identities = 215/284 75%, Positives = 245/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MD+IKKKM+AMKMEKENA DRAEQ+EQ+LRD E  K K+EEDL  LQKK + LEN+FD +
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            NE+  D   K E +EKK +E E E   L RRIQLLEED+ERSEERLQ+ATEKLEEASKAA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+ + A +ER D LE QL EAK IAE+A++K+DEAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
            ARLEAAEAK+++LEE+L VVGNN+K+L++   +ASQREDSYEETIRDLTQRLKDAENRA+
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            EAERTVSKLQKEVDRLEDELLAEKERYKA SDELD TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 5. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 297.0 bits 1274,  Expect = 5e-82
 Identities = 205/284 72%, Positives = 242/284 85%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+++ENA D AEQ+EQKL+D E  K K+EE++N LQKK+   EN++D++
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            NEQL +ANTKLE SEK+  ++ES+  GLQRR+ LLEED ERSEE+L S TEKLEEASKAA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE RS + +ER+D LE QL+ AK +A DA+ KFDEAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             RLEAA+AK+LELEEEL VVG N+K+L++   +ASQREDSYEETIRDLT+ LKDAENRA+
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            EAER V KLQKEVDRLEDELLAEKERYKA SD+LD TFAE+AGY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 6. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 284.2 bits 1218,  Expect = 4e-78
 Identities = 198/284 69%, Positives = 238/284 83%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM+AMKMEK+NALDRAEQ+EQKLR+ E  K K+E+D N+L KK    END+D+ 
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            N QL D   K E +EK+  E E E   L R+I LLEE + ++EER+ +A+ KLEEASKAA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+ +  +DER+D LE QL EAK+IAE+A++K++EAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
            ARLEAAEAK+++LEE+L VVG N+K+L++   +ASQREDSYEETIRDLT RLKDAENRA+
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            EAERTVSKLQKEVDRLEDELL EKE+YKA SDELD+TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 7. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 270.5 bits 1158,  Expect = 5e-74
 Identities = 182/284 64%, Positives = 233/284 82%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK++A+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL ANT+LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+T+DELD  F+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 8. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 270.3 bits 1157,  Expect = 6e-74
 Identities = 186/284 65%, Positives = 227/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            M+AIKKKM AMK+EK+NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL  ANTKLE  EK     E + A L RRIQL+EEDLERSEERL+ AT KLEEAS++A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS+ D+ER+DGLE QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ SDELD TFAEL GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 9. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 270.1 bits 1156,  Expect = 7e-74
 Identities = 183/284 64%, Positives = 232/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+DS+
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL AN  LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 10. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 269.9 bits 1155,  Expect = 8e-74
 Identities = 182/284 64%, Positives = 232/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL ANT+LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 269.6 bits 1154,  Expect = 9e-74
 Identities = 185/284 65%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            M+AIKKKM AMK+EK+NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E +  ANTKLE  EK     E + A L RRIQL+EEDLERSEERL+ AT KLEEAS AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS+ D+ER+DGLE QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ SDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 12. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 269.2 bits 1152,  Expect = 1e-73
 Identities = 185/284 65%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            M+AIKKKM AMK+EK+NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L  ANTKLE  EK     E + A L RRIQL+EEDLERSEERL+ AT KLEEAS +A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS+ D+ER+DGLE+QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ SDELD TFAEL GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 13. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 269.2 bits 1152,  Expect = 1e-73
 Identities = 183/284 64%, Positives = 230/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K E+D+N LQKK+  LENDFD +
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL ANT     +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 268.3 bits 1148,  Expect = 2e-73
 Identities = 183/284 64%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE++  LQKK+  LEND+DS+
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL AN  LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 15. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 268.3 bits 1148,  Expect = 2e-73
 Identities = 181/284 63%, Positives = 230/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM A K+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL ANT+LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 16. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 267.6 bits 1145,  Expect = 4e-73
 Identities = 181/284 63%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL AN +L   +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 17. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 267.6 bits 1145,  Expect = 4e-73
 Identities = 181/284 63%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL AN +L   +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 18. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 267.6 bits 1145,  Expect = 4e-73
 Identities = 181/284 63%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E LL AN +L   +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 19. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 267.1 bits 1143,  Expect = 5e-73
 Identities = 182/284 64%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIK KM AMK+E++NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L  A TKLE  EK     E++ A L RRIQL+EEDLERSEERL+ AT KLEEAS +A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS+ D+ER+DGLE+QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+Y++ SDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 20. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 265.5 bits 1136,  Expect = 2e-72
 Identities = 182/284 64%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            M+AIK KM AMK+EK+NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L  ANTKLE  EK     E + A L RRIQL+EEDLERSE RL+ AT KLEEAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS+ D+ER++GLE+QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ SDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 21. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 264.6 bits 1132,  Expect = 3e-72
 Identities = 180/284 63%, Positives = 228/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE++   QKK   +EN++D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL  ANTKL+  EK     E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 22. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 264.2 bits 1130,  Expect = 4e-72
 Identities = 182/284 64%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            M+AIK KM AMK+EK+NA+DRAE  EQK RD      K EE++  LQKK   +EN++D +
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL  ANTKLE  EK     E + A L RRIQL+EEDLERSEERL+ AT KLEEAS++A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LE RS+ D+ER++GLE QLKEA+ +AEDA+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A QRE+++E+ IR +T +LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEV RLEDEL+ EKE+YK+ SDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 23. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 263.9 bits 1129,  Expect = 5e-72
 Identities = 180/284 63%, Positives = 228/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE++   +KK   +EN++D +
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL  ANTKLE  EK     E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 24. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 263.3 bits 1126,  Expect = 6e-72
 Identities = 186/228 81%, Positives = 204/228 89%, Gaps = 0/228 0%
Query  57   FDSINEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEA 116
            FD++NE+  +  TK+E +EK  +E E E   L RRIQLLEED+ERSEERLQ+ATEKLEEA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SKAADESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDL 176
            SKAADESER RKVLE+ + A +ER D LE QL EAK IAE+A++K+DEAARKLAITEVDL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 236
            ERAEARLEAAEAK+LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  NRASEAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            NRA+EAERTVSKLQKEVDRLEDELLAEKERYKA SDELD TFAELAGY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 25. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 262.6 bits 1123,  Expect = 1e-71
 Identities = 180/281 64%, Positives = 220/281 78%, Gaps = 0/281 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NALDRA   EQ+ +D      K EE+   LQKK   +EN++D  
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L+  N KLE  EK     ESE A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSLAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281
             AER+V KLQKEVDRLEDEL+AEKE+YK   D+LD+ F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 26. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 261.6 bits 1119,  Expect = 2e-71
 Identities = 181/281 64%, Positives = 217/281 77%, Gaps = 0/281 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NALDRA   EQ+ RD      K EE+   LQKK   +END+D  
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L+  N KLE  EK     ESE A L RRIQLLEEDLERSEERL SAT KL EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+R+LAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R EA E KI+ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281
             AER+V KLQKEVDRLEDEL+ EKE+Y+   D+LD+ F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 261.0 bits 1116,  Expect = 4e-71
 Identities = 181/284 63%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NALDRA+  E+K+R       ++EE+L + QKK    END+D  
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L  AN+ LE  EKK  E E+E A L RR+ LLEE+LER+EERL+ ATEKLEEA+  A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKV+E+RS+ D+ER + +E+QLKEA+ +AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R EA E KI+ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKERYK+ S+ELD TF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 259.8 bits 1111,  Expect = 8e-71
 Identities = 178/283 62%, Positives = 221/283 78%, Gaps = 0/283 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA   EQ+ RD      K EE+  +LQKK   +END+D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL+  N KL+  +K     ESE A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LES+ LAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ LT RLK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAG 283
             AER+V KLQKEVDRLEDEL+ EKE+YK   D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 29. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 259.4 bits 1109,  Expect = 1e-70
 Identities = 178/284 62%, Positives = 221/284 77%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+D A   EQ+ RD      K EE+  +LQKK   +END+D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL+  N KL+  +K     ESE A L RRIQLLEEDLERSEERL +AT KL EAS+A 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LES+ LAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ LT RLK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK   D+LD TF ELAGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 30. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 258.7 bits 1106,  Expect = 2e-70
 Identities = 177/283 62%, Positives = 219/283 77%, Gaps = 0/283 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA   EQ+ RD      K EE+  +LQKK   +END+D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL+  N KL+  +K     ESE A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LES+ LAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ L  RLK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAG 283
             AER+V KLQKEVDRLEDEL+ EKE+YK   D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 31. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 258.2 bits 1104,  Expect = 2e-70
 Identities = 173/274 63%, Positives = 223/274 81%, Gaps = 0/274 0%
Query  11   MKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLLDANTK 70
            MK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D + E LL ANT+
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAADESERGRKVL 130
            LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AADESER RKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAEARLEAAEAKI 190
            E+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE R E  E+K 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQ 250
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            KEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 32. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 257.8 bits 1102,  Expect = 3e-70
 Identities = 178/284 62%, Positives = 222/284 78%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NALDRA+  E+K+R       ++EE+L + QKK    END+D  
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L  AN+ LE  EKK  E E+E A L RR+ LLEE+LER+EERL+ AT KLEEA+  A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKV+E+RS+ D+ER + +E+QLKEA+ +AE+A+RK+DE ARKL + E DLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E  E KI+ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKERYK+ S+ELD TF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 33. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 255.7 bits 1093,  Expect = 1e-69
 Identities = 172/274 62%, Positives = 222/274 81%, Gaps = 0/274 0%
Query  11   MKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLLDANTK 70
            MK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D + E LL AN +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAADESERGRKVL 130
            L   +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AADESER RKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAEARLEAAEAKI 190
            E+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE R E  E+KI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQ 250
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
            KEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 34. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 255.7 bits 1093,  Expect = 1e-69
 Identities = 178/281 63%, Positives = 215/281 76%, Gaps = 0/281 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NALDRA   E + RD      K EE+   LQKK   +END+D  
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
              Q    N KLE  EK     ESE A L RRIQLL EDL+RSEERL SAT KL EAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LE+RSLAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R EA EAKI+ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281
             AER+V KLQKEVDRLEDEL++EKE+Y+   D+LD+ F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 35. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 241.2 bits 1029,  Expect = 3e-65
 Identities = 166/264 62%, Positives = 209/264 79%, Gaps = 0/264 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE++   QKK   +EN++D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL  ANTKL+  EK     E E A L RRIQL EEDLERSEERL +AT KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEK 264
             AER+V KLQKEVDRLEDEL+ EK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 36. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 227.9 bits 971,  Expect = 3e-61
 Identities = 158/284 55%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            M+AIKKKM AMK+EK+NA+D+A+ +E + RD     +K+ E++ +L+KK + +E DF + 
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             E L  AN  LE  EK     ESE A L R++Q++EE+LERSEERL +A  KL EAS AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DE+ R  KVLE+RS  D+ER+D L  QLKEA+ +AEDA+ K DE +RK+A  E DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R+++ ++KI+ELEEELKVVGN++KSLE+SE++A+QR + Y+  I+ LT +LK+AE RA 
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AE+ V KLQKEVDRLEDEL   K+RY+A +DE+D TFAEL+GY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 37. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 227.5 bits 969,  Expect = 4e-61
 Identities = 155/251 61%, Positives = 195/251 77%, Gaps = 0/251 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+N +DRA   EQ+ RD      K EE+  +LQKK   +END+D  
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
             EQL+  N KL+  +K     ESE A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESER RK+LES+ LAD+ER+D LE QLKEA+++AE+A++K+DE ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E+ E+KI+ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ LT RLK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQK 251
             AER+V KLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 38. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 226.1 bits 963,  Expect = 1e-60
 Identities = 158/281 56%, Positives = 211/281 75%, Gaps = 0/281 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM  +K++KENALDRAEQ E   +  E    ++E+DL  LQKK+   E+++D  
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            +E L DA  KLE SEKK A+ E++ A L RRIQL+EE+L+R++ERL +A +KLEEA KAA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESERG KV+E+R+L D+E+++  E QLKEAK+IAE+A+RK++E ARKL I E +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E +E K  ELEEELK V N +KSLE   ++ SQ+ED YEE I+ LT +LK+AE RA 
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281
             AERTV+KL+K +D LEDEL ++K +YKA S+ELD  + ++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDM 281

Sequence Alignment: 39. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 221.1 bits 941,  Expect = 4e-59
 Identities = 154/281 54%, Positives = 208/281 74%, Gaps = 0/281 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM  +K++KENALDRAE  E   +  E    ++E+DL  LQKK+   E+++D  
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
            +E L DA  KLE +EK   + E++ A L RRIQL+EE+L+R++ERL +A  KLEEA KAA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DESERG KV+E+R+  D+E+++  + QLKEAK+IAE+A+RK++E ARKL I E DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R E +E K  ELEEELK V NN+KSLE   ++ SQ+ED YEE I+ LT +LK+AE RA 
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281
             AER+V+KL+K +D LEDEL A+K +YKA S+ELD+ + ++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281

Sequence Alignment: 40. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 215.6 bits 917,  Expect = 2e-57
 Identities = 149/284 52%, Positives = 204/284 71%, Gaps = 0/284 0%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
            MDAIKKKM AMK+EK+NA D+A+  E + ++     +K+ E++  L K++  +  D +  
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
               L  AN  LE  EK     E+  A L R++Q +EEDLE+SEER  +A  KL EA+++A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
            DE+ R  KVLE+RS  D+ER+D L  QLKEA+ +AEDA+ K DE +RKLA  E +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
             R+++ EAKI+ELEEELKVVGN++KSLE+SE +A+QR + ++  ++ LT +LK+AE RA 
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284
             AE+ V KLQKEVDRLED+L+ EK++YKA  D+LDSTFAEL GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 207.9 bits 883,  Expect = 4e-55
 Identities = 149/279 53%, Positives = 205/279 73%, Gaps = 4/279 1%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVE--QKLRDCECNKNKVEEDLNNLQKKFAILENDFD 58
            M+AIKKKM  +K +KENA+DRAEQ E  +K+ + +C   ++E++L  LQKK+   E++ D
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCK--QLEDELLGLQKKLKGTEDEVD 58
Query  59   SINEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASK 118
              +E L DA  KLE SEKK  + E E A L RRIQL+EE+L+R++ RL +A +KLEEA K
Sbjct  59   KYSEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEK 118
Query  119  AADESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLER 178
             ADESERG KV+E+R++ D+E+++  E QLKEAK IAED++RK+DE ARKL + E +LER
Sbjct  119  QADESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELER 178
Query  179  AEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENR 238
            AE R E +E K  +LEEELK V N +KSLE   ++ S +ED YEE I  L ++LK+AE R
Sbjct  179  AEERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETR 238
Query  239  ASEAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281
            A  AE+TVSKL+K +D LEDEL  +K + KA  +ELD+ + ++
Sbjct  239  AEFAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDM 281

Sequence Alignment: 42. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 57.9 bits 226,  Expect = 1e-09
 Identities = 91/255 35%, Positives = 142/255 55%, Gaps = 50/255 19%
Query  7    KMLAMKMEKENALDRAEQVE-QKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLL 65
            K LA+KME+   L R  QV   +L D  C + +V+   ++L+K    L N+   I  +L 
Sbjct  297  KELALKMEEMEDLKRRMQVRITELEDT-CEQLRVKN--SSLEKAKTKLANEIKEITIELE 353
Query  66   DANTKLEASEKKNAEIESETAGLQRRIQ--------------LLEEDLER---SEERLQS 108
            +    ++   K+N ++E+E AGLQRRI+              LLE+D+++   S   L  
Sbjct  354  NTQIIVQDLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTE 413
Query  109  ATEKLEEASKA-ADESERGRKVLE--SRSLADDERL--------DGLEAQLKEAKYIAED 157
              + L+  +K  +D+       L+  +R LAD  +L        D L A LK+ +    D
Sbjct  414  RNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRD 473
Query  158  AERKFDEAARKLAITEVDLE-RAEARLEAAE------AK-ILELEEELKVVGNNMKSLEI 209
            AE K+  A   L   ++D+E R   + E  E      A+ I EL+  L  V    K+   
Sbjct  474  AEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKT--- 530
Query  210  SEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQKEVDRLEDELLAEKERYKA 269
               E S+ +  +E  IR+L   L +A    SE  + +  LQ+ V  LE  LL E+ R   
Sbjct  531  ---EISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELET-LLEEERR--- 583
Query  270  TSDEL 274
             SD+L
Sbjct  584  VSDDL 588
 Score = 48.3 bits 184,  Expect = 1e-06
 Identities = 57/255 22%, Positives = 118/255 46%, Gaps = 15/255 5%
Query  16   ENALD-RAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLLDANTKLEAS 74
            +N L+ R  ++E  L      + + E+ +  L  +   L+   DS++EQ    + ++E S
Sbjct  28   QNRLESRIRELEDALDSERDGRVRAEKMVAELNFRVDQLQ---DSLDEQGTSTSAQMEIS 84
Query  75   EKKNAEIESETAGLQRRIQLLEEDLERSEERLQSA-TEKLEEASKAADESERGRKVLESR 133
            +K+    ESE   L++ ++L    +E +E  ++    E + + S   D   + +  +E  
Sbjct  85   KKR----ESEIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRVEKE 140
Query  134  SLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLA--ITEVD-LERAEARLEAAEAKI 190
                   LDGL  QL+         E + D A R  +   ++VD L R  + L + ++++
Sbjct  141  KQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLKSRL 200
Query  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQ 250
             +   +L+   + ++ L+ +     +     + +  DL ++L D   +    +  +S LQ
Sbjct  201  TQENFDLQ---HQVQELDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNLSALQ 257
Query  251  KEVDRLEDELLAEKERYKATSDELDSTFAE 280
             + D L   L  E E      ++L    A+
Sbjct  258  ADYDNLNVRLEEEAETSTNLRNQLSKVNAD 287

Sequence Alignment: 43. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 50.8 bits 195,  Expect = 2e-07
 Identities = 64/257 24%, Positives = 135/257 52%, Gaps = 24/257 9%
Query  6    KKMLAMKMEKENALDRAEQVEQK---LRDCECNKNKVEEDLNNLQKKFAI----LENDFD 58
            +K LA K E+  AL +  Q+E +   +R  E  + K++ ++  L+KK+      LE  +D
Sbjct  497  EKRLAQKDEEIEALRKQYQIEIEQLNMRLAEA-EAKLKTEIARLKKKYQAQITELELSLD 555
Query  59   SINEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASK 118
            + N+  +D    ++    +  E+++    ++R++Q   + L  ++ R Q+   +LEE   
Sbjct  556  AANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRI 615
Query  119  AADESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLER 178
            A +++ R ++  E        R++    +L         A+ K++    +++  + D + 
Sbjct  616  ALEQASRAKRQAEQLHEEAVVRVN----ELTTINVNLASAKSKLES---EFSALQADYDE 668
Query  179  AEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQR----EDSYEETIRDLTQRLKD 234
                L  ++ ++ +L  ELK    + K L I EQE   +    + S E+ +R L  R+++
Sbjct  669  VHKELRISDERVQKLTIELK----STKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEE 724
Query  235  AENRA-SEAERTVSKLQKEVDRLEDELLAEKERYKATSDEL 274
             E  A +  +R ++KL+  +  +E E+  E+ R+  T   L
Sbjct  725  VEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKML 765
 Score = 50.8 bits 195,  Expect = 2e-07
 Identities = 63/267 23%, Positives = 129/267 48%, Gaps = 20/267 7%
Query  4    IKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQ 63
            ++K +  + ME E   + A ++ QK    +   +++++ L+ LQK     + +      +
Sbjct  98   LRKLLEDVHMESE---ETAHHLRQKH---QAAVHEMQDQLDQLQKAKNKSDKEKQKFQAE 151
Query  64   LLDANTKLEASEKKNAEIESETAGLQRRIQLLE---EDLERSEERLQSATEKLEEASKAA 120
            +++  ++LE + K+          L+  ++ L    E++ R+   L S  ++L +     
Sbjct  152  VFELLSQLETANKEKLTALKSVEKLEYTVHELNIKIEEINRTVIELTSHKQRLTQ----- 206
Query  121  DESERGRKVLESRSLADDERL--DGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLER 178
            + +E  ++V E +   D+       +  QL++ ++  E+ ERK           EV+LE 
Sbjct  207  ENTELIKEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELES 266
Query  179  AEARLEAAEAKILELEEEL-KVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAEN 237
             + +L+      LELE +L K  G+        E E     D  EE  R + Q++ + E 
Sbjct  267  LKVQLDDESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 326
Query  238  RASEAERTVSKLQKEVDRLEDE---LLAEKERYKATSDELDSTFAEL 281
            +        S L+K+  RL+ E   L+ + E+  A + +L+   A+L
Sbjct  327  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQL 373

Sequence Alignment: 44. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 49.5 bits 189,  Expect = 5e-07
 Identities = 75/252 29%, Positives = 143/252 56%, Gaps = 42/252 16%
Query  11   MKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLLDANTK 70
            ++ E E  L+   Q+ +   D    K+K E +L   Q     +E     + +++ +   +
Sbjct  271  LEEESEARLELERQLTKANGDAASWKSKYEAEL---QAHVDEVEELRRKMAQKISEYGEQ 327
Query  71   LEASEKKNAEIESETAGLQRRIQLLEEDLERS-------EERLQSATE-------KLEEA 116
            LEA   K + +E + A LQ  +++L  DLE++       E+R+    +       KLEE 
Sbjct  328  LEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEV 387
Query  117  SKAADESERGR--KVLESRSLADD-ERL-DGLEAQLKEAKYIAED---AERKFDEAARKL 169
            S   +++++    K+ + + L  + E+L D  EA  +E K +A+D   A+ ++++A R++
Sbjct  388  SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRI 447
Query  170  AITEVDLERAEAR---LEAA--EAKILELEEELK---VVGNNMKSLEISEQEASQREDSY 221
               E++++R E     L AA  EA+ L  +EE K   +     ++    E+  +Q+E+  
Sbjct  448  HEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEI 507
Query  222  EETIRDLTQRLKDAENRASEAERTVSKLQKEVDRLEDELLAEKERYKATSDELD 275
            E   +     ++    R +EAE   +KL+ EV RL       K++Y+A   EL+
Sbjct  508  EALRKQYQIEIEQLNMRLAEAE---AKLKTEVARL-------KKKYQAQITELE 551

Sequence Alignment: 45. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 48.8 bits 186,  Expect = 7e-07
 Identities = 64/256 25%, Positives = 138/256 53%, Gaps = 25/256 9%
Query  6    KKMLAMKMEKENALDRAEQVEQK---LRDCECNKNKVEEDLNNLQKKFAI----LENDFD 58
            +K LA K E+  AL +  Q+E +   +R  E  + K++ ++  L+KK+      LE  +D
Sbjct  411  EKRLAQKDEEIEALRKQYQIEIEQLNMRLAEA-EAKLKTEIARLKKKYQAQITELELSLD 469
Query  59   SINEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASK 118
            + N+  +D    ++    +  E+++    ++R++Q   + L  ++ R Q+   +LEE   
Sbjct  470  AANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRI 529
Query  119  AADESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLER 178
            A +++ R ++  E        R++    +L         A+ K++    +++  + D + 
Sbjct  530  ALEQANRAKRQAEQLHEEAVVRVN----ELTTINVNLASAKSKLES---EFSALQADYDE 582
Query  179  AEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQR----EDSYEETIRDLTQRLKD 234
                L  ++ ++ +L  ELK    + K L I EQE   +    + S E+ +R L  R+++
Sbjct  583  VHKELRISDERVQKLTIELK----STKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEE 638
Query  235  AENRA-SEAERTVSKLQKEVDRLEDELLAEKERYKATSDEL 274
             E  A +  +R ++KL+  +  +E E+  E+ R+ A +D++
Sbjct  639  VEANALAGGKRVIAKLESRIRDVEIEVEEERRRH-AETDKM 678
 Score = 48.8 bits 186,  Expect = 7e-07
 Identities = 77/268 28%, Positives = 137/268 51%, Gaps = 32/268 11%
Query  4    IKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVE--EDLNNLQ----KKFAILENDF 57
            +++K  A   E ++ LD+ ++ + K  D E  K + E  E L  L+    +K+  L+N  
Sbjct  30   LRQKHQAAIQEMQDQLDQLQKAKNK-SDKEKQKFQAEVFELLAQLETANKEKLTALKN-V 87
Query  58   DSINEQLLDANTKLEASEKKNAEIESETAGL-QRRIQLLEE------DLERSEERLQSAT 110
            + +   + + N K+E   +   E+ S    L Q   +L++E       L+ +        
Sbjct  88   EKLEYTVHELNIKIEEINRTVIELTSHKQRLSQENTELIKEVHEVKLQLDNANHLKTQIA 147
Query  111  EKLEEASKAADESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFD----EAA 166
            ++LE+     +E ER R  LE+ +   +  L+ L+ QL E      + ER++     +AA
Sbjct  148  QQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEARLELERQLTKANGDAA 207
Query  167  RKLAITEVDL-----ERAEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSY 221
               +  E +L     E  E R + A+ KI E EE+L+ + N   SLE   ++ S+ +   
Sbjct  208  SWKSKYEAELQAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLE---KQKSRLQSEV 263
Query  222  EETIRDLTQRLKDAENRASEAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281
            E  I DL +    A   A + E+ V++L+K    L+++L       +    EL    AEL
Sbjct  264  EVLIMDLEK----ATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVKIAEL 319

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 47.6 bits 181,  Expect = 2e-06
 Identities = 73/262 27%, Positives = 148/262 56%, Gaps = 35/262 13%
Query  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEE-------DLNNLQKKFAIL 53
            ++ ++KKM+  + E E   ++ E + QK+   E  K +++        DL   Q   AIL
Sbjct  312  VEDLRKKMMQKQAEYE---EQIEIMLQKVSQLEKAKARLQSEVEVLIVDLEKAQNTIAIL 368
Query  54   ENDFDSINEQLLDANTKLEAS----EKKNAEIESETAGLQRRIQLLEEDLERSEERLQSA 109
            E   + + +Q+L+  ++++      E    E  +  A LQ+  QL E+ +E+ +E L   
Sbjct  369  ERAKEQLEKQVLEMKSRIDELLVELEAAQREARAALAELQKMKQLYEKAVEQ-KEALARE 427
Query  110  TEKLEEASKAADES--ERGRKV----LESRSLADDERLDGLEAQLKEAKYIAEDAERKFD 163
             +KL++    A+E+  +  RK+    LE+  LA + R   L+  LKE++    DAE +  
Sbjct  428  NKKLQDDLHEANEALADANRKLHELDLENARLAGEIR--DLQVALKESEAARRDAEARAQ 485
Query  164  EAARKLAITEVDLERAEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQRED---- 219
             A  +L    +++ER   RL+  E ++  L + ++   + + +  +++ EA  + +    
Sbjct  486  RALAELQQVRIEMER---RLQEKEEEMEALRKSMQFEIDRLTA-ALADAEARMKAEIARL 541
Query  220  --SYEETIRDLTQRLKDAENRAS-EAERTVSKLQKEVDRLEDELLAEKERYKATSDE 273
               Y+  I +L   + D  NRA+ EA++T+ K  +++ +L+  L   + + + T D+
Sbjct  542  RKKYQAEIAELEMTV-DNLNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLDQ 597

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.