The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA
QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA
DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE
ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE
FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9NAS5 Ani s 3 284 1720 398.6 1.3e-112
ACN32322 Asc l 3.0101 287 1699 393.9 3.6e-111
AEX31649 Cho a 10.0101 284 1345 313.2 7e-87
BAA04557 Der f 10.0101 299 1345 313.1 7.5e-87
ABU97466 Blo t 10.0101 284 1340 312.0 1.5e-86
AAT40866 Tyr p 10.0101 284 1339 311.8 1.8e-86
A7L5V2 Scy p 1.0101 284 1332 310.2 5.5e-86
O44119 Hom a 1.0101 284 1324 308.4 1.9e-85
Q9NFZ4 Lep d 10 284 1319 307.2 4.3e-85
O18416 Der p 10 284 1317 306.8 5.8e-85
D3XNR9 Mac r 1.0101 284 1305 304.0 3.9e-84
AAC48288 Hom a 1.0102 284 1303 303.6 5.3e-84
CBY17558 Pan b 1.0101 284 1298 302.5 1.2e-83
EU410072 Lit v 1.0101 284 1296 302.0 1.6e-83
AAX37288 Pen m 1 284 1296 302.0 1.6e-83
11893851 Pen a 1 284 1296 302.0 1.6e-83
C0LU07 Pro c 1.0101 284 1291 300.9 3.6e-83
M1H607 Por p 1.0101 284 1290 300.6 4.2e-83
M4M2H6 Mel l 1.0101 284 1278 297.9 2.8e-82
O61379 Pan s 1 274 1239 289.0 1.3e-79
NP_001103782 Bomb m 3.0101 285 1239 289.0 1.3e-79
Q25456 Met e 1 274 1238 288.8 1.5e-79
AAF72534 Bla g 7.0101 284 1237 288.5 1.8e-79
AAD19606 Per a 7.0102 284 1234 287.9 2.9e-79
Q9UB83 Per a 7 284 1230 287.0 5.5e-79
Q17H75 Aed a 10.0101 285 1229 286.7 6.4e-79
Q9N2R3 Cha f 1 264 1215 283.6 5.3e-78
CAA09938 Chi k 10 285 1195 279.0 1.4e-76
APG42675 Hal l 1.0101 284 1114 260.5 5e-71
CAB38044 Hel as 1 284 1102 257.8 3.3e-70
AAG08987 Hal d 1 284 1101 257.5 3.9e-70
CAC84590 Lep s 1 284 1089 254.8 2.6e-69
AGM32377.1 Copt f 7.0101 256 1077 252.1 1.5e-68
AVD53650 Sac g 1.0101 284 1054 246.8 6.5e-67
Q17H80 Aed a 10.0201 284 1006 235.9 1.3e-63
NP_001117128 Sal s 4.0101 284 1003 235.2 2.1e-63
XP_026775428 Pan h 4.0201 284 1002 235.0 2.4e-63
AAG08988 Per v 1 284 1002 235.0 2.4e-63
AAG08989 Mim n 1 284 1001 234.8 2.8e-63
XP_026781482 Pan h 4.0101 284 936 219.9 8.1e-59
AAK96889 Cra g 1 233 908 213.6 5.3e-57
AAF72796 Ani s 2 869 218 56.1 5.3e-09
QPB41107 Rap v 2.0101 859 210 54.2 1.9e-08
AAK39511 Der f 11.0101 692 189 49.5 4.1e-07
AAO73464 Der p 11 875 186 48.8 8.4e-07
AAM83103 Blo t 11 875 166 44.2 2e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 398.6 bits 1720,  Expect = 1e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 2. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 393.9 bits 1699,  Expect = 4e-111
 Identities = 280/284 98%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QEDLS ANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLAT KLEEATHTA
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE GENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 3. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 313.2 bits 1345,  Expect = 7e-87
 Identities = 213/284 75%, Positives = 254/284 89%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            M+AIKKKMQAMK+EKDNA+DRA+ AE+K R    K E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE ++ AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+EERLK+ATAKLEEA+H A
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RK++E+RS  DEER + +E+QLKEA+M+AE+ADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++A+LKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 4. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 313.1 bits 1345,  Expect = 7e-87
 Identities = 213/284 75%, Positives = 255/284 89%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            M+AIKKKMQAMK+EKDNA+DRA+ AE+K R    + E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE LS AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+EERLK+ATAKLEEA+++A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RK++E+RS  DEER + +E+QLKEA+M+AE+ADRKYDEVARKL MVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++A+LKEAE RAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 5. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 312.0 bits 1340,  Expect = 2e-86
 Identities = 212/284 74%, Positives = 253/284 89%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            M+AIKKKMQAMK+EKDNA+DRA+ AE+K R    + E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L+ AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+EERLK+ATAKLEEA+H+A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RK++E+RS  DEER + +ESQLKEA+M+AE+ADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++ +LKEAE RAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSV+KLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 6. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 311.8 bits 1339,  Expect = 2e-86
 Identities = 211/284 74%, Positives = 255/284 89%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIK KMQAMK+E+DNA+DRA+ AE+K R    K E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE+L+ A + LEEKEK +Q AEA+VAALNRR+ L+EE+LER+EERLK+ATAKLEEA+H+A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RK++E+RS  DEER + +ESQLKEA+++AE+ADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++++LKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+Y+SIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 7. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 310.2 bits 1332,  Expect = 5e-86
 Identities = 212/284 74%, Positives = 251/284 88%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+R TQKKM Q EN+LD+A
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE LS AN+ L+EKEK +Q AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 8. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 308.4 bits 1324,  Expect = 2e-85
 Identities = 212/284 74%, Positives = 250/284 88%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+R T+KKM Q EN+LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE LS AN+ LEEKEK +Q AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 307.2 bits 1319,  Expect = 4e-85
 Identities = 209/284 73%, Positives = 251/284 88%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            M+AIK KMQAMK+EKDNA+DRA+ AE+K R    + E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L+ AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+E RLK+AT+KLEEA+++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RK++E+RS  DEER   +ESQLKEA+M+AE+ADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++YE+QIR ++ +LKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 10. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 306.8 bits 1317,  Expect = 6e-85
 Identities = 209/284 73%, Positives = 251/284 88%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            M+AIK KMQAMK+EKDNA+DRA+ AE+K R    + E+ EEE+R  QKK+ Q EN+LD+ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE LS AN+ LEEKEK +Q AE +VAALNRR+ L+EE+LER+EERLK+ATAKLEEA+++A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RK++E+RS  DEER   +E+QLKEA+M+AE+ADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE+++E+QIR ++ +LKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEV RLEDELVHEKE+YKSIS+ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 11. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 304.0 bits 1305,  Expect = 4e-84
 Identities = 208/284 73%, Positives = 247/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN +LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 12. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 303.6 bits 1303,  Expect = 5e-84
 Identities = 208/284 73%, Positives = 247/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN+ LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 302.5 bits 1298,  Expect = 1e-83
 Identities = 208/284 73%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++  ++ E+ EEE+   QKK+ Q ENDLD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN +LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 302.0 bits 1296,  Expect = 2e-83
 Identities = 207/284 72%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN  L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 15. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 302.0 bits 1296,  Expect = 2e-83
 Identities = 207/284 72%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN  L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 16. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 302.0 bits 1296,  Expect = 2e-83
 Identities = 207/284 72%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN  L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 17. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 300.9 bits 1291,  Expect = 4e-83
 Identities = 205/284 72%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQA K+EKDNA+DRAD  E++ ++   + E+ EEE+ + QK+M + ENDLD+ 
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN+ LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 18. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 300.6 bits 1290,  Expect = 4e-83
 Identities = 205/284 72%, Positives = 245/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKD+A+DRAD  E++ ++   + E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN+ LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKS ++ELDQ F ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 19. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 297.9 bits 1278,  Expect = 3e-82
 Identities = 204/284 71%, Positives = 245/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ E+++   QKK+ Q END+D+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L  AN+N  EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 20. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 289.0 bits 1239,  Expect = 1e-79
 Identities = 197/274 71%, Positives = 236/274 86%, Gaps = 0/274 0%
Query  11   MKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSTANSN 70
            MK+EKDNA+DRAD  E++ ++   + E+ EEE+ + QK+M Q ENDLD+ QE L  AN+ 
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTADESERVRKVM 130
            LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ ADESER+RKV+
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAEERAETGENKI 190
            ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAEERAETGE+K 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            KEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 21. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 289.0 bits 1239,  Expect = 1e-79
 Identities = 201/281 71%, Positives = 234/281 83%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNALDRA   E++ +    + E+ EEE R  QKK+   EN+LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L   N  LEEKEK +Q AE+EVAALNRR+ LLEE+LER+EERL  ATAKL EA++ A
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RKV+ENRS+ DEER + +E+QLKEA+ LAEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE+ Y+ QI+T++ RLKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281
            FAERSVQKLQKEVDRLEDELV EKE+YK I ++LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 22. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 288.8 bits 1238,  Expect = 1e-79
 Identities = 197/274 71%, Positives = 237/274 86%, Gaps = 0/274 0%
Query  11   MKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSTANSN 70
            MK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ QE L  AN+ 
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTADESERVRKVM 130
            L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ ADESER+RKV+
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAEERAETGENKI 190
            ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAEERAETGE+KI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            KEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 23. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 288.5 bits 1237,  Expect = 2e-79
 Identities = 198/283 69%, Positives = 237/283 83%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRA   E++ R    + E+ EEE R  QKK+ Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L   N+ L+EK+K +Q AE+EVAALNRR+ LLEE+LER+EERL  ATAKL EA++ A
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RK++E++ + DEER + +E+QLKEA+ +AEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA  RE+ Y++QI+T++ RLKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSG 283
            FAERSVQKLQKEVDRLEDELVHEKE+YK I ++LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 24. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 287.9 bits 1234,  Expect = 3e-79
 Identities = 197/283 69%, Positives = 237/283 83%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRA   E++ R    + E+ EEE R  QKK+ Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L   N+ L+EK+K +Q AE+EVAALNRR+ LLEE+LER+EERL  ATAKL EA++ A
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RK++E++ + DEER + +E+QLKEA+ +AEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA  RE+ Y++QI+T++ RLKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSG 283
            FAERSVQKLQKEVDRLEDELVHEKE+YK I ++LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 25. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 287.0 bits 1230,  Expect = 5e-79
 Identities = 196/284 69%, Positives = 237/284 83%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+D A   E++ R    + E+ EEE R  QKK+ Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L   N+ L+EK+K +Q AE+EVAALNRR+ LLEE+LER+EERL  ATAKL EA++  
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RK++E++ + DEER + +E+QLKEA+ +AEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA  RE+ Y++QI+T++ RLKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            FAERSVQKLQKEVDRLEDELVHEKE+YK I ++LD TF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 26. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 286.7 bits 1229,  Expect = 6e-79
 Identities = 200/281 71%, Positives = 232/281 82%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNALDRA   E++ R    + E+ EEE R  QKK+   ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE L   N+ LEEKEK +Q AE+EVAALNRR+ LLEE+LER+EERL  ATAKL EA+  A
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RKV+ENR++ DEER + +E+QLKEA+ +AEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE GE KIVELEEELRVVGNNLKSLEVSEEKA QRE+ Y+ QI+T++ RLKEAE RAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281
            FAERSVQKLQKEVDRLEDELV EKE+Y+ I ++LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 283.6 bits 1215,  Expect = 5e-78
 Identities = 195/264 73%, Positives = 231/264 87%, Gaps = 0/264 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ EEE+R TQKKM Q EN+LD+A
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            QE LS AN+ L+EKEK +Q AE EVAALNRR+ L EE+LER+EERL  AT KL EA++ A
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEK 264
            FAERSVQKLQKEVDRLEDELV+EK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 28. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 279.0 bits 1195,  Expect = 1e-76
 Identities = 196/281 69%, Positives = 227/281 80%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNALDRA   E + R    + E+ EEE R  QKK+   ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            Q   +  N  LE KEK +Q AE+EVAALNRR+ LL E+L+R+EERL  ATAKL EA+  A
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RK++ENRS+ DEER + +E+QLKEA+ LAEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE GE KIVELEEELRVVGNNLKSLEVSEEKA QRE+ Y+ QI+T++ RLKEAE RAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281
            FAERSVQKLQKEVDRLEDELV EKE+Y+ I ++LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 29. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 260.5 bits 1114,  Expect = 5e-71
 Identities = 177/284 62%, Positives = 225/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKM AMK+EK+NA+DRA+  E+K+R   ++  +IEE+L + QKK    END+D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L  A + LE  EK+V E E EV+   R++TLLEE+LER EERL+ AT +LEEA+  A
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RKV+E+RS+ D+ER + +E+QLKEA+ +AE+A+RKYDE ARKL + E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
             R E  E KI+ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+IS+ELDQTF EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 30. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 257.8 bits 1102,  Expect = 3e-70
 Identities = 178/284 62%, Positives = 222/284 78%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKM AMK+EK+NALDRA+  E+K+R       ++EE+L + QKK    END+D  
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L  AN+ LE  EKK  E E+E A L RR+ LLEE+LER+EERL+ AT KLEEA+  A
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RKV+E+RS+ D+ER + +E+QLKEA+ +AE+A+RK+DE ARKL + E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
             R E  E KI+ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             AER+V KLQKEVDRLEDEL+ EKERYK+ S+ELD TF EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 31. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 257.5 bits 1101,  Expect = 4e-70
 Identities = 175/284 61%, Positives = 224/284 78%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKM AMK+EK+NA+DRA+  E+K+R   ++  +IEE+L + QKK    END+D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L  A + LE  EK+V E E EV+   R++TLLEE+LER EERL+ AT +LEEA+  A
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER  +V+E+RS+ D+ER + +E+QLKEA+ +AE+A+RKYDE ARKL + E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
             R E  E KI+ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+IS+ELDQTF EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 32. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 254.8 bits 1089,  Expect = 3e-69
 Identities = 172/284 60%, Positives = 230/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            M+AIKKKMQAMK+EKDNA+D+ADA E + R    K ++I EE++D +KK  Q E D+   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            +E+L+TAN NLE+KEK +   E+EVA+LNR++ ++EE LER+EERL  A  KL EA+H A
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DE+ R+ KV+ENRS QDEER + + +QLKEA+MLAE+AD K DEV+RK+  VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            +R ++G++KI+ELEEEL+VVGN+LKSLEVSEEKA QR + Y+ QI+T++ +LKEAE RAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
            +AE+ V+KLQKEVDRLEDEL   K+RY+++++E+DQTF ELSGY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 33. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 252.1 bits 1077,  Expect = 2e-68
 Identities = 172/251 68%, Positives = 209/251 83%, Gaps = 0/251 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDN +DRA   E++ R    + E+ EEE R  QKK+ Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L   N+ L+EK+K +Q AE+EVAALNRR+ LLEE+LER+EERL  ATAKL EA++ A
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RK++E++ + DEER + +E+QLKEA+ +AEEAD+KYDEVARKL MVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE+GE+KIVELEEELRVVGNNLKSLEVSEEKA  RE+ Y++QI+T++ RLKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 34. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 246.8 bits 1054,  Expect = 7e-67
 Identities = 167/284 58%, Positives = 216/284 76%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MD+IKKKM AMK+EK+NA DRA+  E+++R   ++  +IEE+L   QKK    EN++D  
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E      +  EE EKK  E+E E+ +LNRR+ LLEE++ER+EERL+ AT KLEEA+  A
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RKV+EN +   EER + +E QL EA+++AEEAD+KYDE ARKL + E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
             R E  E K+++LEE+L VVGNN+K+L+V  ++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             AER+V KLQKEVDRLEDEL+ EKERYK+IS+ELDQTF EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 35. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 235.9 bits 1006,  Expect = 1e-63
 Identities = 161/284 56%, Positives = 224/284 78%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK+EKDNA D+AD  E + ++   + ++I EE+ +  K++ Q   D +K 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
            +  L  AN +LEEKEK +   EA VAAL R++  +EE+LE++EER   A +KL EAT++A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DE+ R+ KV+ENRS QDEER + + +QLKEA+MLAE+AD K DEV+RKL  VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            +R ++GE KI+ELEEEL+VVGN+LKSLEVSE+KA QR + ++ Q+++++ +LKEAETRAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             AE++V+KLQKEVDRLED+L++EK++YK+I ++LD TF EL+GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 36. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 235.2 bits 1003,  Expect = 2e-63
 Identities = 164/282 58%, Positives = 212/282 75%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQ +K++K+NALDRA+ AE   +   DK +++E++L   QKK+  TE++LDK 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L  A   LE  EK   +AEA+VA+LNRR+ L+EEEL+RA+ERL  A  KLEEA   A
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER  KV+ENR+ +DEE+    + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+ED YEE+I+ ++ +LKEAETRAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELS 282
            FAERSV KL+K +D LEDEL  +K +YK+ISEELD  + +++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 37. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 235.0 bits 1002,  Expect = 2e-63
 Identities = 163/282 57%, Positives = 213/282 75%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQ +K++K+NALDRA+ AE   +   D+ +++E++L   QKK+  TE++LDK 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L  A   LE  EKK  +AEA+VA+LNRR+ L+EEEL+RA+ERL  A  KLEEA   A
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER  KV+ENR+++DEE+    E QLKEA+ +AEEADRKY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK  Q+ED YEE+I+ ++ +LKEAETRAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELS 282
            FAER+V KL+K +D LEDEL  +K +YK+ISEELD+ + +++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 38. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 235.0 bits 1002,  Expect = 2e-63
 Identities = 159/284 55%, Positives = 211/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKM AMK+EK NALDRA+  E+K+R+  +   +IE++     KK +QTEND D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
               L    +  E  EK++QE E E+ +L R+++LLEE + +AEER+  A+ KLEEA+  A
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RKV+EN +  ++ER + +E QL EA+ +AEEAD+KY+E ARKL + E DLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
             R E  E K+++LEE+L VVG N+K+L+V  ++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+IS+ELD TF EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 39. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 234.8 bits 1001,  Expect = 3e-63
 Identities = 159/284 55%, Positives = 210/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            MDAIKKKMQAMK++++NA D A+  E+K++       ++EEE+ + QKK+  TEN+ D  
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L  AN+ LE  EK++ + E++V  L RR+TLLEE+ ER+EE+L   T KLEEA+  A
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER RKV+E RS   EER + +E QL+ A+ +A +AD K+DE ARKL + E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
             R E  + K++ELEEEL VVG N+K+L+V  ++A QREDSYEE IR ++  LK+AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             AER V KLQKEVDRLEDEL+ EKERYK+IS++LDQTF E++GY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 40. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 219.9 bits 936,  Expect = 8e-59
 Identities = 156/282 55%, Positives = 206/282 73%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
            M+AIKKKMQ +K +K+NA+DRA+ AE   +   DK +++E+EL   QKK+  TE+++DK 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
             E L  A   LE  EKK  +AE EVAALNRR+ L+EEEL+RA+ RL  A  KLEEA   A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
            DESER  KV+ENR+ +DEE+    E QLKEA+ +AE++DRKYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK   +ED YEE+I  ++ +LKEAETRAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELS 282
            FAE++V KL+K +D LEDEL ++K + K+I EELD  + +++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 41. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 213.6 bits 908,  Expect = 5e-57
 Identities = 144/228 63%, Positives = 179/228 78%, Gaps = 0/228 0%
Query  57   LDKAQEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEA 116
            +D   E      + +EE EK   EAE E+ +LNRR+ LLEE++ER+EERL+ AT KLEEA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  THTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADL 176
            +  ADESER RKV+EN +   EER + +E QL EA+++AEEAD+KYDE ARKL + E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAE 236
            ERAE R E  E K++ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  TRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284
             RA  AER+V KLQKEVDRLEDEL+ EKERYK+IS+ELDQTF EL+GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 42. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 56.1 bits 218,  Expect = 5e-09
 Identities = 74/256 28%, Positives = 139/256 54%, Gaps = 28/256 10%
Query  1    MDAIKKKMQ---AMKIEKDNALDRADAAEEKVRQMTD-KLERIEEELRDTQKKMMQTEND 56
            +D+++  +    A ++E ++ L  A+    + +   D ++    EE+ D +KKMMQ + +
Sbjct  266  LDSVRVALDEESAARVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAE 325
Query  57   LDKAQEDLSTANSNLEEKEKKVQ-EAEAEVAALNRRMTLLEEELERAEERLKLATAKLEE 115
             ++  E +    S LE+ + ++Q E E  +  L +    +   LERA+E+L+    ++ E
Sbjct  326  YEEQIEIMLQKVSQLEKAKARLQSEVEVLIVDLEKAQNTIAI-LERAKEQLE---KQVLE 381
Query  116  ATHTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEAD 175
                 DE      ++E  + Q E RA   E  L++ + L E+A  + + +AR+   ++ D
Sbjct  382  MKSRIDEL-----LVELEAAQREARAALAE--LQKMKQLYEKAVEQKEALARENKKLQDD 434
Query  176  LERAEERAETGENKIVELE-EELRVVGNNLKSLEVS-EEKALQREDSYEEQIRTVSARLK 233
            L  A E       K+ EL+ E  R+ G  ++ L+V+ +E    R D+ E + +   A L+
Sbjct  435  LHEANEALADANRKLHELDLENARLAGE-IRDLQVALKESEAARRDA-EARAQRALAELQ 492
Query  234  ----EAETRAEFAERSVQKLQK----EVDRLEDELVHEKERYKS 269
                E E R +  E  ++ L+K    E+DRL   L   + R K+
Sbjct  493  QVRIEMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEARMKA 536
 Score = 57.4 bits 224,  Expect = 2e-09
 Identities = 73/261 27%, Positives = 146/261 55%, Gaps = 45/261 17%
Query  4    IKKKMQA----MKIEKDNALDRAD-AAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLD 58
            ++KK QA    +++  DN L+RA+  A++ +++ ++++ +++  L DTQ+++ QT +   
Sbjct  541  LRKKYQAEIAELEMTVDN-LNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLDQYA 599
Query  59   KAQEDLSTANSNLEE---------KEKKVQEAEAEVA--------ALNRRMTLLEEELER 101
             AQ  +S  ++ LEE         + +K  EA+ E A        ++N  +T ++ +LE 
Sbjct  600  LAQRKISALSAELEECKTALDNAIRARKQAEADLEEAHVRISDLTSINSNLTAIKNKLE- 658
Query  102  AEERLKLATAKLEEAT---HTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEA 158
                L  A A L+E T   H ADE         NR++ D  RA  V+ +L E Q  + + 
Sbjct  659  --TELSTAQADLDEVTKELHAADERA-------NRALADAARA--VQ-ELHEEQEHSMKI 706
Query  159  DRKYDEVARKLTMVEADLERAEERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQRE 218
            D     +  ++  ++  ++ AE  A  G  +++  + E R+     + LEV+ ++  +R 
Sbjct  707  DALRKSLEEQVKQLQVQIQEAEAAALLGGKRVIA-KLETRI-----RDLEVALDEETRRH 760
Query  219  DSYEEQIRTVSARLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTF 278
               +  +R    R+KE + + +   +     Q   DR+ ++L  +K +         Q +
Sbjct  761  KETQSALRKKDRRIKEVQMQIDEEHKMFVMAQDTADRMLEKLNIQKRQLGEAEAMTMQNL 820
Query  279  QELSGY 284
            Q +  Y
Sbjct  821  QRVRRY 826

Sequence Alignment: 43. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 88/251 35%, Positives = 140/251 55%, Gaps = 37/251 14%
Query  1    MDAIKKKMQAMKIEKDNALDR-----ADAAEEKVRQMTDKLERIEEELRDTQKKMMQTEN 55
            ++ +K  M+    EKD  ++      A A EE  R + +   R + E+   +KK      
Sbjct  485  LNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIR 544
Query  56   DLDKAQEDLSTANSNLEEKEKKVQEAEAEVAAL---NRRMTL-LEEELERAEERLKLATA 111
            +L+ A ++ + ANS   ++ K +Q+   E+  L    RR++  L  +L  AE R ++A A
Sbjct  545  ELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAE-RKRVALA 603
Query  112  K-LEEATHTADESERVRKVMENRSFQDEERANTVESQLKEA--QMLAEEADRKYDEVARK 168
            + LE+A    + +ER RK  E       E A+T  ++L E   Q+ +   D++  E    
Sbjct  604  QELEDARALLEGAERARKNAET------ELADT-STRLSEITLQVTSLTNDKRRLEA--D 654
Query  169  LTMVEADLERA-------EERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSY 221
            L+ +++DL+ A       EERAE    +   L +ELR    N K+ E S  K L+ E   
Sbjct  655  LSAMQSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAE-SLRKQLEVE--- 710
Query  222  EEQIRTVSARLKEAETRA-EFAERSVQKLQKEVDRLEDELVHEKERYK 268
               IR ++ RL+EAE  A +   R V KLQ  V  LE EL +E  R +
Sbjct  711  ---IREITIRLEEAEAFATKEGRRLVAKLQVRVRDLEAELENEARRVR 755
 Score = 41.3 bits 153,  Expect = 0.0002
 Identities = 60/230 26%, Positives = 119/230 51%, Gaps = 24/230 10%
Query  19   LDRADAAEEKVR-QMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSTANSNLEEKEK- 76
            LD  +AA  K R Q+    + ++ +L D  ++    + +L   Q D    N  LEE+ + 
Sbjct  214  LDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNLSALQADYDNLNVRLEEEAET 273
Query  77   ------KVQEAEAEVAALNRR----MTLLEEELERAEERLKLATAKLEEATHTADESERV 126
                  ++ +  A+ +AL  R    + L  EE+E  + R+++   +LE+      E  RV
Sbjct  274  STNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRMQVRITELEDTC----EQLRV 329
Query  127  RKV-MENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAEERAET 185
            +   +E    +       +  +L+  Q++ ++  ++     R+L    A L+R  E   T
Sbjct  330  KNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR----NRQLENENAGLQRRIEEL-T 384
Query  186  GENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERS 245
            GEN  +  E+ L  +  +++ L VS  +  +R D+ + + + +S +L+EA    + A R 
Sbjct  385  GENNTLRNEKAL--LEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRE 442
Query  246  VQKLQKEVDRLEDE 259
            +  L++   +LE E
Sbjct  443  LADLRQLRSQLEAE 456

Sequence Alignment: 44. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 49.5 bits 189,  Expect = 4e-07
 Identities = 67/271 24%, Positives = 129/271 47%, Gaps = 19/271 7%
Query  4    IKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLE----RIEEELRDTQKKMMQTENDLDK 59
            +++K QA   E  + LD+   A+ K  +   K++     +  +L    K+ +    +++K
Sbjct  30   LRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQKFQAEVFELLAQLETANKEKLTALKNVEK 89
Query  60   AQEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAE------ERLKLATAK- 112
             +  +   N  +EE  + V E  +    L++  T L +E+   +        LK   A+ 
Sbjct  90   LEYTVHELNIKIEEINRTVIELTSHKQRLSQENTELIKEVHEVKLQLDNANHLKTQIAQQ 149
Query  113  LEEATHTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMV 172
            LE+  H  +E ER R  +EN        A+T+E +L+  ++  +E      E+ R+LT  
Sbjct  150  LEDTRHRLEEEERKRASLENH-------AHTLEVELESLKVQLDEESEARLELERQLTKA 202
Query  173  EADLERAEERAETG-ENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSAR 231
              D    + + E   +    E+EE  R +   +   E   E  L +  S E+Q   + + 
Sbjct  203  NGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSE 262
Query  232  LKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281
            ++      E A R  Q+L+K V +LE   +  K + + ++  ++Q  +EL
Sbjct  263  VEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKEL 312

Sequence Alignment: 45. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 48.8 bits 186,  Expect = 8e-07
 Identities = 71/272 26%, Positives = 143/272 52%, Gaps = 46/272 16%
Query  7    KMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTEND---LDKAQED 63
            ++Q ++ E +   D+ D    + +++TD L   + +L D ++++ + E +   L+  +++
Sbjct  404  ELQKLQHEYEKVRDQRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDE 463
Query  64   LSTANSNLE----EKEKKVQEAEAEVAAL----NRRMTLLEEELERAEERLKLATAKL-- 113
            LS A    E    ++E K Q   AE+A +     +R+   +EE+E   ++ ++   +L  
Sbjct  464  LSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNM 523
Query  114  ---EEATHTADESERVRKVMENR------SFQDEERANT-VESQLKEAQMLAEEADRKYD 163
               E       E  R++K  + +      S+    +AN  ++  +K+  +   E    YD
Sbjct  524  RLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYD 583
Query  164  EVARKLTM--------------VEADLER---AEERAETGENKIVELEEELRVVGNNLKS 206
            EV R+L                ++A+LE    A E+A   + +  +L EE  V  N L +
Sbjct  584  EVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQASRAKRQAEQLHEEAVVRVNELTT 643
Query  207  LEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKER 266
            + V+   A   +   E +   + A   E       ++  VQKL  E+   +D L+ E+ER
Sbjct  644  INVNLASA---KSKLESEFSALQADYDEVHKELRISDERVQKLTIELKSTKDLLIEEQER 700
Query  267  Y---KSISEELDQTFQEL 281
                +++ + L+Q  + L
Sbjct  701  LVKLETVKKSLEQEVRTL 718

Sequence Alignment: 46. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 44.2 bits 166,  Expect = 2e-05
 Identities = 69/267 25%, Positives = 129/267 48%, Gaps = 27/267 10%
Query  4    IKKKMQAMKIEKDNALDRADAAEEKVRQMTDKL-ERIEEELRDTQKKMMQTENDLDKAQE 62
            +++K QA   E  + LD+   A+ K    +DK  ++ + E+ +   ++     D   AQ+
Sbjct  116  LRQKHQAAIQEMQDQLDQVQKAKNK----SDKEKQKFQAEVFELLAQVETANKDKLVAQK 171
Query  63   DLSTANSNLEEKEKKVQEAE---AEVAALNRRMTLLEEEL--ERAEERLKLATA------ 111
             +      + E   K++E      EV A  +R++    EL  E  E ++ L  A      
Sbjct  172  TVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQ 231
Query  112  ---KLEEATHTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARK 168
               +LE+  H  ++ ER R  +EN        A+T+E +L+  ++  EE      E+ R+
Sbjct  232  IAQQLEDTRHRLEDEERKRSSLENH-------AHTLEVELESLKVQLEEESEARLELERQ 284
Query  169  LTMVEADLERAEERAETG-ENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRT 227
            LT    D    + + E   +  + E+EE  R +   +       E  L +  + E+Q   
Sbjct  285  LTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKAR 344
Query  228  VSARLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281
            + + ++      E A    Q L+K V +LE   +  K + + +S  L+QT ++L
Sbjct  345  LQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDL 398

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.